current user: public




COG3110
Query: [S] COG3110 Uncharacterized protein conserved in bacteria, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MKTGIVTTLIALCLPVSVFATTLRLSTDVDLLVLDGKKVSSSLLRGADSIELDNGPHQLVFRVEKTIHLSNSEERLYISPPLVVSFNTQLINQVNFRLPRLENEREANHFDAAPRLELLDGDATPIPVKLDILAITSTAKTIDYEVEVERYNKSAKRASLPQFATMMADDSTLLSGVSELDAIPPQSQVLTEQRLKYWFKLADPQTRNTFLQWAEKQPSSLast
1 -101.000[S] COG3110 Uncharacterized protein conserved in bacteria  ali  100  1MKTGIVTTLIALCLPVSVFATTLRLSTDVDLLVLDGKKVSSSLLRGADSIELDNGPHQLVFRVEKTIHLSNSEERLYISPPLVVSFNTQLINQVNFRLPRLENEREANHFDAAPRLELLDGDATPIPVKLDILAITSTAKTIDYEVEVERYNKSAKRASLPQFATMMADDSTLLSGVSELDAIPPQSQVLTEQRLKYWFKLADPQTRNTFLQWAEKQPSS 220
2 -8.010[M] COG5581 Predicted glycosyltransferase  ali follow..  12  16........ILGVLRDLNKNQVPLRISWA-KILAVDPEKLIVDYGSQEYENSAVLRAGQVAIIAET------QGAKVEFTLPQLVTGEYQRLPAFITPLPSSLWFVQRREYFRPYYGVTTLPDTRTLRFRLFDLSLGGMGALLESAPDGLIEGARFSQVELNMGQWGIFHVDAQLISISERKVIDGKNETITTPRLSFRFLNVSPAVERELQRIIFSLE.. 232
3 -7.970[S] COG5316 Uncharacterized conserved protein  ali follow..  11  1MNRRMMLASAALLLAPLAAQAQTRDVS---TIYNSNL----ALVEDARPLDLKAGRQKLEFK---------DVSAAIRPETVSLSAPGVTILEQNFDYDLLTPDKLMEKAVQKVKIVRTNPGDGKETTEVATVLAANQGVVLKIGDRIEVLRDDG------VPTRVIFDKVPETLRARPTLSVSVEAAGAGTRQAKLSYLTSG-------LSW....... 186
4 -7.530[S] COG4704 Uncharacterized protein conserved in bacteria  ali follow..  10  1MRKKWAVSLILLTTLGNLAWSWSARANFNGKLTVEIDGLKNSIFTSSQGFPGDRKRVFDRQCTQINETPLKLTFNNLKAGTYAVAAIQDLNGDGTLNRNDLGMPVEPFGFSRNPEVRTSAPKFGDAAFILA......................................................................................... 138
5 -7.250[R] COG3895 Predicted periplasmic protein  ali follow..  9WGRPAKVVLVALILGGLGLAIPSYAQETQTYYCSPTETLTIKMVEGSAIQVTLPDGRTVVLKYSNTVWSKGNTALVEEGGNVKWQ....................................................................................................................................... 105
6 -6.900[T] COG3103 SH3 domain protein  ali follow..  11  1MPKLRLIGLTLLALAVSHAEETRYVSDELNTWVRSGPGDHYRXVG-----TVNAGEEVTLLQ---------------DANTNYAQVKDSSGRTAWIPLKQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTW---------NQRTAEMQQKVAQSDSVINGLKEENQKLKNELIVAQKKVDAASVQLDDKQRTIIMQWFMYGG-PSRKRKDRWM...... 205
7 -6.620[S] KOG3306 Predicted membrane protein  ali follow..  10  17VLQICFIFFASTFPCSSGSEDSYTITGRVK-VILNGGQKITFLRPDGY--EVPAGTHLIEVSAMG-----------YFFSPVRVDVSARHRGKVQATLTETRRSLNIMSIVKSPMGLMVGFMVVVVFLMPKLMENIDPEEMKQAQEEMRRQGVPSLTSLLPGAGA....................................................... 196
8 -6.500[NU] COG3539 P pilus assembly protein, pilin FimA  ali follow..  13  183.....ALARLFECYNIPAGDSCTTTGTPVLVYYLSGTINSLG-VNAGETIEVDLGD-------AANFRVVGHKPLGARTAELAIPVRCNTGNNVNLSLTATTDPSYPQAIKTSRPVVVTDSQNNIISPAGGTLP...................................................................................... 315
9 -6.480[R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain  ali follow..  10  1MKKIITLFGACALAFSMANA---------DVNLYGPGGPHTALKDIANKYSEKTGV-KVNVNFGP---QATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAK 240
10 -6.410[M] COG3203 Outer membrane protein (porin)  ali follow..  12  2MKRNILVVIPALLAAGAANAAEIYNKDGNKL-DLYGKDKSYVRFGFKGETQITDQLTQWEYNIQANNAEDTGAQDGNATRLGFAGLKFAEFGSFDY............................................................................................................................ 115

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 8 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Harder T, Kolodny R, Sitbon E, Li Z, Godzik A. Using an alignment of fragment strings for comparing protein structures. Bioinformatics. 2007 Jan 15;23(2):e219-24.