current user: public




Query: [S] COG3110 Uncharacterized protein conserved in bacteria, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MKTGIVTTLIALCLPVSVFATTLRLSTDVDLLVLDGKKVSSSLLRGADSIELDNGPHQLVFRVEKTIHLSNSEERLYISPPLVVSFNTQLINQVNFRLPRLENEREANHFDAAPRLELLDGDATPIPVKLDILAITSTAKTIDYEVEVERYNKSAKRASLPQFATMMADDSTLLSGVSELDAIPPQSQVLTEQRLKYWFKLADPQTRNTFLQWAEKQPSSLast
1 -100.000[S] COG3110 Uncharacterized protein conserved in bacteria  ali  100  1MKTGIVTTLIALCLPVSVFATTLRLSTDVDLLVLDGKKVSSSLLRGADSIELDNGPHQLVFRVEKTIHLSNSEERLYISPPLVVSFNTQLINQVNFRLPRLENEREANHFDAAPRLELLDGDATPIPVKLDILAITSTAKTIDYEVEVERYNKSAKRASLPQFATMMADDSTLLSGVSELDAIPPQSQVLTEQRLKYWFKLADPQTRNTFLQWAEKQPSS 220
2 -7.950[O] COG2143 Thioredoxin-related protein  ali follow..  12  7VSKKFLSVLLLISLFLSACKSNNKDKLDENLLSSGSQSSKEGLEDVFSDNKSISPNDKYMLRFKKDLKNVKELRDYIKEHFSAYYVNISYSKEHDFKVGDKNNEKEIKMSTEEPTIVLSDKTGKTIYELPGYMPSTQFLAVLEFIGD......................................................................... 189
3 -6.840[T] COG3103 SH3 domain protein  ali follow..  11  1MPKLRLIGLTLLALAVSHAEETRYVSDELNTWVRSGPGDHYRXVG-----TVNAGEEVTLLQTDA------------------AQVKDSSGRTAWIPLKQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTW---------NQRTAEMQQKVAQSDSVINGLKEENQKLKNELIVAQKKVDAASVQLDDKQRTIIMQWFMYGGIPSRKRKDRWM...... 205
4 -6.690[R] COG3054 Predicted transcriptional regulator  ali follow..  14  1MTLRKILAMSCLLLPIMACAHNLEVNQRVPPVGINKDEFSYKNWNSAQ-----AGKVRVLLHIAGRTSAKEKNATLIEA--TIVNTDDAIPGSGMFVRSSIESNKKLYPWSQGSAVIVLDKDGRVQWVKDGALTQQEVQQVVDLLHKLLS...................................................................... 184
5 -6.400[S] COG5316 Uncharacterized conserved protein  ali follow..  10  1MNRRMMLASAALLLAPLAAQAQ---TRDVSVTIYNS---NLALVEDARPLDLKAGRQKLEFK---------DVSAAIRPETVSLSAPGVTILEQNFDYDLLTPDKLMEKAVQKVKIVRTNPGDGKETTEVATVLAANQGVVLKIGDRIEVLRDDG------VPTRVIFDKVPETLRARPTLSVSVEAAGAGTRQAKLSYLTSGLSWKADYVALFDEAKST 200
6 -6.290[M] COG5581 Predicted glycosyltransferase  ali follow..  10  30........LRISWAHGQFISKILAVDPEKLIVDYGSQEYENSAVLRAGQVAIIAETQGAKVEF---------------TLPQLVTGEYQRLPAFITPLPSSLWFVQRREYFRPYYGVTTLPDTRTLRFRLFDLSLGGMGALLE-IPDGLIEGARFSQVELNMGQWGIFHVDAQLISISERKVIDGKNETITTPRLSFRFLNVSPAVERELQRIIFS.... 230
7 -6.100[S] KOG3306 Predicted membrane protein  ali follow..  10  17VLQICFIFFASTFPCSSGSEDSYTITGRVKIVILNGGQKITFLRPDGY--EVPAGTHLIEVSAMG-----------YFFSPVRVDVSARHRGKVQATLTETRRSLNIMSIVKSPMGLMVGFMVVVVFLMPKLMENIDPEEMKQAQEEMRRQGVPSLTSLLPGAGA....................................................... 196
8 -5.840[R] COG3895 Predicted periplasmic protein  ali follow..  9WGRPAKVVLVALILGGLGLAIPSYAQETQTYYCSPTETLTIKMVEGSAIQVTLPDGRTVVLKYSNTVWSKGNTALVEEGGNVKWQ....................................................................................................................................... 105
9 -5.800[S] COG2430 Uncharacterized conserved protein  ali follow..  10  51............................................SSLDDLVICP-STYLLLRLRTPF-PPRSTATIYLKAPVAAGVYVTANGEQRLITDIFSEVPEAGPWEAVTKVVVENTSDNYVEIRNVIYPIVYAQFY---------IDNMGNAYLETSKLSITSSNVGVVELRNEPPISGLPTCLKTEGGLPLPFLKPAGEKIAKFMEF....... 245
10 -5.680[M] COG5386 Cell surface protein  ali follow..  15  1MKKLWKKGLVAFLALTLIFQLIPGFASAADSRLKGGESEADKYIDHTATIKVENGQPYMYLTITN........................................................................................................................................................... 85

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.