current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

COG2864
Query: [C] COG2864 Cytochrome b subunit of formate dehydrogenase, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst MSKIEISNDTRIIRHRTPARISHWMLVICFFMTMFTGVAFFFPDFAWLTEILGTPQIARAIHPFTGILMFFAFIYLALLYWDHNIPEKNDIRWAKGVIEVLKGNEHAVADNGKYNLGQKMLFWTLNLAMVTLLVTGIIMWRQYFSHYFSIPVLRIAILLHSASAFMLFTGILVHIYMAFWVKGSIRGIVEGWVTVRWAKKHHPRWYREEVLSKLEEDLLNEQSGKVGKTKVLFKGFGKLast
1 -106.000[C] COG2864 Cytochrome b subunit of formate dehydrogenase  ali  100  1MSKIEISNDTRIIRHRTPARISHWMLVICFFMTMFTGVAFFFPDFAWLTEILGTPQIARAIHPFTGILMFFAFIYLALLYWDHNIPEKNDIRWAKGVIEVLKGNEHAVADNGKYNLGQKMLFWTLNLAMVTLLVTGIIMWRQYFSHYFSIPVLRIAILLHSASAFMLFTGILVHIYMAFWVKGSIRGIVEGWVTVRWAKKHHPRWYREEVLSKLEEDLLNEQSGKVGKTKVLFKGFGK 238
2 -69.500[C] COG1969 Ni,Fe-hydrogenase I cytochrome b subunit  ali follow..  16  2..QQKSDNVVSHYVFEAPVRIWHWLTVLCMAVLMVTGYFIGKPLPSVSATYLFYMGYIRLIHFSAGMVFTVVLLMRIYWAFVGNRYSRELWQGVWYEIRWYLFLAKRPSADIGHNPIAQAAMFGYFLMSVFMIITGFALYSEHSQYAITGGNSMDIHSWHRLGMWLIGAFVIGHVYMALRDDTVISTMVNGYRSHKFGKISNK................................... 232
3 -66.800[C] COG4117 Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)  ali follow..  16  46.PKTAGGEEHRDYLYSLAIRRWHWGNALLFVLLLLSGLFGHFS--------LGPVALMVQVHTWCGFALLAFWVGFVLINLTTGNGRHRQTRFYLFGIMKGEAHPFVATEQNKFNPLQQLAYLAIYALVPLLIITGLLCLYPQV-----AGLGPVMLVLHMALAIIGLLFICAHLYLCTLGDQIFRSMVDGYHRHRTAPRGDKS.................................. 252
4 -48.000[C] COG3658 Cytochrome b  ali follow..  14  2........KNKTKVWDFPTRLFHWLLAASLPFMWYSAKTG---------------GDMLQWHTRVGLFILFLLVFRLCWGIWGSDTARRFVRGWSGIREYMKNGIPEHVQPG-HNPLGALMVVALLAAVSFQVGTGLFAADENTNHLVSEHTGSLMRKIHLNFFKLLAVFSAVHIAAVAAKKNLVLPMITGFKYIE.......................................... 187
5 -34.100[C] COG3038 Cytochrome B561  ali follow..  10  1.....MTLKGTAERWDWMSQALHWLIAVLILGLGIGGLIMGN------LPKTPNYFWVYTAHKSTGISVLALAVLRLLWRLYVGAPKP------------------IAGPPVWQERVANATHIMLYVLIFTIPLAGWLYDSARALVSPNETIRGVALEIHKLSFWALIGLVVLHAGAAFYRDATLARMLPRNWFSSKS........................................ 188
6 -14.400[T] KOG4293 Predicted membrane protein, contains DoH and Cytochrome b-561/ferric reductase transmembrane domains  ali follow..  12  245.....................AHIALQTTGFLLGLTGVICGL------VLENRLKANNVSKHKGLGITILVMGVLQMLAL--------------------LARPDKQSKYRKYWNWYHHNIGRLLIILAISNIFYGIHLAKAGTSWNGGYGF---------AVAVLALTAIGLEVRKFLKKNWKKKKKEMLRTRLLWFTLGFSVTGGSIAHIVWRDLYAERFAISSDMK......... 417
7 -11.600[C] COG2181 Nitrate reductase gamma subunit  ali follow..  37.........SSELLEKKKLAAGSTLFHWGLLCVVGGHVMGILIPEGVYASLGISEHMYHKMAIGAGLPAGIAACTGLVILTYRRLFDK------------------------RIRKTSSPSDILTLLLLLFMMLSGVAAIVLFRPDASLMESVPLWFKFHIVIGYVVFILWLVHVFSL............................................................ 207
8 -11.100[S] COG3182 Uncharacterized iron-regulated membrane protein  ali follow..  14  1MSTVTTPQPTAAARRKTLYFLWHFYAGLFMLMLALTGLVMLFAEVLNVTPQAQVMPVSQQLAAVVTQFIPAHQPDLANRFSVLFSDGSTQFVTVSPYSAVVLGAIDRSESWYEWGDWGDYLIEVAASLGMILLVSGIYLWLPFLKIRVGSGARIFWRDLHANLGGMLSLVLLF--------------LISG............................................... 220
9 -10.500[P] KOG3733 Mucolipidin and related proteins (TRML subfamily of transient receptor potential proteins)  ali follow..  11  450...........LLVYVGVLRYFGFFSQYNILMLTLK----------------------RSAPNIMRFMTCAIVLYAGFLIAGWVIIGPY---------------------------SMKFRTLAESSEALFSLLNGDDMFATFYTINDSNTVIKVFGTVYIYLFVSLFIYVVLSLFIAIIMDA---EVVKDRYSDGLRAIEKRGCLRDFVESNPPPSELGSPTTRSAYAPSNLLNLGR 625
10 -10.100[S] COG5395 Predicted membrane protein  ali follow..  13  1MDPHGKSISQASDRWSGLRNAALGVGAATLIVALTAPGAFTFQPHAPDFSRIAAAPAVVQVHLFSALTALAIGVVLMM--------------------------------RVKGTTLHKLLGWTWVLAMGSTAVSSLFIREINHGAFSFIHLLSGWTIIGLPGAVYAI--VSAHMFVGGLLVAGVFTFLPGRL............................................. 179
11 -9.570[O] COG5264 Vacuolar transporter chaperone  ali follow..  10  110.LRVSGPIKVEAKVWLANERFLKWLHVV--VLLGSLALALYN--------------AGERLGQAFGVVYTLLAIFIGFYAWKLHAKRSQMIK---------------SRSPAPMTDYWGPLIVGTALAISLIVNMSFAL................................................................................................... 218
12 -9.500[S] COG2717 Predicted membrane protein  ali follow..  11  1MAAATGTRKKKTPRPGQWKLWLLYTAGFVPAVWTFLGLRFLILTLLVTPMRDLTGITLLRYRRALGLLAFYYALMHFTTYMVLDQGLNLSAIITDIVRRPFI-----------------TIGMISLALLVPLALTSNNWSIRKLGRRW--------SSLHKL-VYIAIAGSAVHFLMS............................................................ 174
13 -9.160[S] KOG4474 Uncharacterized conserved protein  ali follow..  73......STLKKWRISNESVSMVHSAISGFWAAYALTGYLL-NDLVDLICNERSVRIVELLFHHVVVLSAFTICLFYDLMLGIVVAGLLMELNSIFLHIRSLMNLYGFDKKLTAFRVTVILNIITLVVFRLIVNV--YMIYF-------------VFASFSMSPWYIASTICVLILCLASSNMVLTYRLLAADGFCGASRQRQVP--RVETEVPPEHQNLVKQVVQGSDQNDGIIG... 309
14 -9.090[S] KOG2568 Predicted membrane protein  ali follow..  220..NHTGMRPLALTTWVVTIGALRKTVSRILILCVSMGFGVVKSTLGGLTSKVLLVGVTYFIASEILDIAEMSGRSKLFLVLPDAFLDAFLILWIFTSLSKTLEQLQMKRTSVKLEIYRKFSNALAVMVVASVAWIVYEVYFKATDPFNERWQTAWTITAFWDVIAFLLLCIICYLWTPSQNSQRDANMKLMMDRYAYSGDVDEENEEAQSLTGGKQDGDISLVKQEKNAESD...... 456

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.