current user: public




COG2441
Query: [C] COG2441 Predicted butyrate kinase, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MISAGIDPGTGSYDVVAIEDGKVVFRKNIPTEEVRASPDVIVEVIEESGAEVAAGLSGYGLPVKRFSELDEVDLLLMTLNFDSERAIGLRNIIKAVKERNVNLYTVPAVIHLPTVPPWRKMNRIDIGTADKLCSAVLAVAKLSEEEELTKLNFILAEVGEGFNAFIAVRNGRIVDGMGGTTSFPGYSSLGAMDAELAYIIGEFPKKLIFSGGVKSFASEWKVNENEVTNILSEFVLKGIRAMEVSTDADFYMLSGRFAPDVLRKLRGEGKEVRLLGGFGRGKQSAQGAAIIANAIAGGEYREIVDYMRIFEAKGTLLDYITSDIMEYVRRGLKRRGDLast
1 -99.300[C] COG2441 Predicted butyrate kinase  ali  100  1MISAGIDPGTGSYDVVAIEDGKVVFRKNIPTEEVRASPDVIVEVIEESGAEVAAGLSGYGLPVKRFSELDEVDLLLMTLNFDSERAIGLRNIIKAVKERNVNLYTVPAVIHLPTVPPWRKMNRIDIGTADKLCSAVLAVAKLSEEEELTKLNFILAEVGEGFNAFIAVRNGRIVDGMGGTTSFPGYSSLGAMDAELAYIIGEFPKKLIFSGGVKSFASEWKVNENEVTNILSEFVLKGIRAMEVSTDADFYMLSGRFAPDVLRKLRGEGKEVRLLGGFGRGKQSAQGAAIIANAIAGGEYREIVDYMRIFEAKGTLLDYITSDIMEYVRRGLKRRGD 337
2 -46.100[S] COG4020 Uncharacterized protein conserved in archaea  ali follow..  14  1MTFIGVDHGTTAMRFALIEDEKVLTFELGRAEAAAMSEKEILAAIRIGDIDLVALTYSMGDGFSAIKDVRKEGRGLQSIEGAGKKTGGGTRVFDAVRNSEIPAIAIPGL---------HSGSRVDPRMKVFSHLTSPEKLGIAYILCLGYEDFVVSDISSN-TVTLAVVAGKVIGAIDACIFAPGVHH-GPLDLQAIRNVDDTANQAFIEAGTLKMTPYKDKPALLALDTIALFAAMEIASMQLLGTTGTVFLAGSVGEVEICTHLD--QECLSLGKWHAAIGCAEIARDVSAGKKQ........................................ 316
3 -45.300[C] COG3426 Butyrate kinase  ali follow..  17  3YDVLTINPGSTSTKLAVYHGDKVLFEETVRHEQFDFRWQVLRRVIDANKLDAVVGRGGLLRPVAGGTYVTEKMLADLKNNKYGEHASNLGAMLAKKLADKLIPSFIVDPVVVDEMQPVARFSARKSIFHALNHKAAGRKIAKELGSEYEKMNFVIAHLGGG-ISVAAHRQGKAVDVNNALDGFSPERSGSLPMNDFLEACRELHELIVGRGGMISYLGTNSEDAIKAFDAMAYQVSKEIGACSVVGKIDAIILTGGLARSEIIEQTNWIARVIIEPGEDELEALNSGVQRVLAGIEKEKVY.................................... 355
4 -31.600[C] COG0282 Acetate kinase  ali follow..  14  4KLVLVLNCGSSSLKFAIIDDGSKQEAALGAGAAHSEALNFIVNTILAAQLTAIGHRIVHGGEKYTSSVVIDESIKDSASFAPLHNPAHLIGIKNVAVFDTAFHQTMPEESYLYALPYYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGG-SVSAIRNGKCVDTSMGLTPLEGLTRSGDIDPAIIFHLDQINKMLTKESGLLGLTEATKEDAKRAMDVYCHRLAKYIGSYTALGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFE----------------VDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDA... 395
5 -12.100[G] COG0837 Glucokinase  ali follow..  5..ALVGDVGGTNARLALCATGEILQAKTYSGLEYESLEDVIKQYLSEHQAKVTDACIAIACPITGDWVAMTNHTWAFSIAAMQQNLGLDHLEV---------------------------INDFTAVSMAIPVLPAQDVLQFGGTQPQPGKPVAVYGAGTGLGVAHLVNVDRRWISLAGEGGHVDFAPNSEEEDQILAVLRQ--ERVLSGPGLVNLLADSCTDCRRALSLFCVIMGRFGGNLALNLSTFGVYIAGGIVPRFMKGRFKDFLQDIPVYMITHPQPGLLGAGAYLRQKLGYE...................................... 320
6 -11.500[KG] COG1940 Transcriptional regulator/sugar kinase  ali follow..  12  47.VRIGIDLGGTKTEVIALGDAGEQLYRPTPRDDYRQTIETIATLVDMAEQA-TGQRGTVGMGIPGSISPYTGVVKNANS---------------------------TWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAAGAQTVFAVIIGTGCGA---GVAFNGRAHIGGNGTAGEWGHNKQGCIETGFATDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVD-QFVFGGECETPVRKAKHGDSSGVRGAAWLW............................................. 345
7 -8.410[E] COG4820 Ethanolamine utilization protein, possible chaperonin  ali follow..  10  32...LGVDLGTCDVVSMVVDRDGQPVAVCLD----------WADVVRDGIV--------------------------WDFFGAVTIVRRHLDTLEQQFGRRFSHAATSFPPGTDPRISINVLESAGLEVSHVLDEPTAVADLLQL------DNAGVVDIGGGTTGIAIVKKGKVT--YSADEATGGHHISLTFAGNRRISLEEAEQYKRGHG----------EEIWPTVKPVYEKMADIVARHIEGQGITDLWLAGGSCPGVAELFRKQFPALQVHLPQHSLFMTPLAIASSGREKAEGLYAK................................... 278
8 -8.170[G] COG2971 Predicted N-acetylglucosamine kinase  ali follow..  11  9..LIAVDGGGTGCRALLAKDGNVISKAVGGPANIGADTAMAIANVMETVTRAVH---------DAGLHISRLDETGAVLGLAGANSIPDRLELVA------------------------GLPFAWVRIVSDTVTALQGALGDNDG--------AIVILGTGSAFVRQVQGGFMLSDHAGLLAFDGMASRTELTEAVMVRFNDDLRQIISF--VFEYVAKGDPLGLSIAERACAYIKKGLDRLEVETLGR-FSLTGGLA----SSYAALPFLPYPALYHPPLGDALEGALSLAMLANRW....................................... 292
9 -8.020[KG] COG1548 Predicted transcriptional regulator/sugar kinase  ali follow..  12  41MSSLGIDIGGANLKVASKDGWEIIY----EAERLEGKLREIAEKYSTAKAGVV---------------MTAELADFFK-----SRAEGVEFIAKACKKAFEDVRFLDVEGNLKSDIDNPENFAASNWVASCRFLL-----------EEAYRNFLFVDMGSTTTDIIPVTSKIYVLKEFEGAPLCPEFFAITADVFVTTCMRRLARTVCSDLEELGEEKVKEL-ALEAKWAMIDRLSEVIEHKSKIYGLKTVFACGILIAEACEEAGAECRLISELYGDYSKLFPAYAMLKLVEQ........................................... 354
10 -7.680[H] KOG2201 Pantothenate kinase PanK and related proteins  ali follow..  12  19MPWFGMDIGGTLTKLVYFE------PKDITPDEQDREAGILRNIRRYLTKNSAYGKTGHRDTHLQMDNVEIRKRRHFIRFQTTDMGNFLSLAKQKGMAELVTTVCATGGGAFKFEQDFRDQVNMKLAKFDELDTLIKGILFADLHNRTECYYFILVNVGSGVSILAVYGPDCLLTGCTSFEEAIQLATKGDNR-KVDKLVKDIYGGDYNRFGLPGDLKRVSVSREDLANATLVTITNNIGSIARMCKIDRVVFVGNFLRVAYAMEFWSNGTMKGLFLEHEGYFGALGCLLQFNGELAAALNDGVE................................ 384

FFAS is supported by the NIH grant R01-GM087218-01
6 0 4 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jambon M, Godzik A. New avenues in protein function prediction. Protein Sci. 2006 Jun;15(6):1527-9.