current user: public




Query: [S] COG1704 Uncharacterized conserved protein, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MTWIILGVIALIVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVAELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVVSNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVDFSGLGDLast
1 -97.300[S] COG1704 Uncharacterized conserved protein  ali  100  1MTWIILGVIALIVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVAELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVVSNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVDFSGLGD 186
2 -6.830[D] COG2846 Regulator of cell morphogenesis and NO signaling  ali follow..  12  94......................LILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE...................................... 220
3 -6.780[K] COG1191 DNA-directed RNA polymerase specialized sigma subunit  ali follow..  11  103..............WSVHVPRRIKELGPKIKNAVEELTRELQSS----PQISDIADFIGVTEEEVLEAMEMGKSYQALSVDHSIEADSDGSTITLLDVVGGTDDGFERVNQRMLLEKVLPVLDEREQKILQYTFIENRSQKETGELL....................................... 231
4 -6.690[T] KOG4225 Sorbin and SH3 domain-containing protein  ali follow..  11  673....................GERITLLRQVDENWYEGRIPGTSRQGIFPTYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQQPQAQQRRVTPDRS--QTSQDLFSYQALYSYIQNDDELELRDDIVDVMEKWFVGTSRR-TKQFGTFPGNYVKPLY........................... 815
5 -6.440[F] COG4741 Predicted secreted endonuclease distantly related to archaeal Holliday junction resolvase  ali follow..  10  3LITFLILVLAALFLVIVLLIFYIVSLKRSVLLKQHEVEMTLKKANELINEAMASREEAMKEKEEINKKIEDARRESVSKSRDVVVGRVSEQLAPFFPGFKYNPKDVRFIGTPIDLIIFDGMDNGNITSIVFLE--VKSGASKLTEREKAVMEAINSGRVSFDI---YRINTTNSAIDEI....... 176
6 -6.210[D] KOG2398 Predicted proline-serine-threonine phosphatase-interacting protein (PSTPIP)  ali follow..  13  37...................VAQFVKERLSVEDEYVKAINRSVNKWLLTKGTMELMAEIHVMLVKNLQDLSREVLKYKEDVNRTRKELKQPQVAEAVNLMQTTTTCLQKAKVKKETNVNVKEISKVELKVARAREEYKSYVDKYELVREDFETKMSDSCKKFQTFD..................... 208
7 -6.000[O] KOG3470 Beta-tubulin folding cofactor A  ali follow..  16  8.......................................QLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVLRKQEEVKRRLQKEYEVLEKYLADEQDLIETDSYKKAAEILKDAKAELE........................................................ 109
8 -5.880[K] KOG4552 Vitamin-D-receptor interacting protein complex component  ali follow..  1........................................MSFHLSTKERLLLLIDDIEMIAKELIEQAHQKISSTELVDLLDLLVAKDEEFRKMLELAEEQAKVEEAMQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQ.................................. 113
9 -5.760[E] KOG0784 Isocitrate dehydrogenase, gamma subunit  ali follow..  17  117.............................TEGELQGLNMRLRRSLDLFANVVEQTEGYSSLEHELVPGVIECLKISTRTKAERAKFAFDYATKTGRKKVTAVHKANIMKLGDGLFLRTCEGVAKQYPKIQFESMIIDNTCMQLVSKPEQFDVMVMPNLYG.......................... 271
10 -5.760[Z] KOG0980 Actin-binding protein SLA2/Huntingtin-interacting protein Hip1  ali follow..  11  802...................FEHLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLNDEGSLDFSYLSLHAAKKE--------EMESQVKMLELEQSLNQERAKLAALRK.................................................... 908

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.