current user: public




COG1704
Query: [S] COG1704 Uncharacterized conserved protein, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MTWIILGVIALIVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVAELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVVSNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVDFSGLGDLast
1 -86.800[S] COG1704 Uncharacterized conserved protein  ali  100  1MTWIILGVIALIVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVAELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVVSNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVDFSGLGD 186
2 -8.190[R] COG4105 DNA uptake lipoprotein  ali follow..  16VLLALSLVVPSLFLSACMSSEKDIDLSKYVDQTEPA-AGRLDEASKKFDAVDRQHPAFADYRKGSYDEAISSAKRYLALYPSTDDAP-QKEARQTLQTMQDLVTRWPT-DAKEKIRFANDQLAGKEMQIGLERREYIAAVKRFRTVVENYSNT................................. 217
3 -7.150[Z] KOG3565 Cdc42-interacting protein CIP4  ali follow..  10  26............................SMYPVWKSFLEGTMQVANYKNFISEPARTVRSLKEQQLKRCVDQLTKIQTQETVKDLAKGKKKYFETEQMAHAVREKADIEAKQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIM........................... 178
4 -7.070[R] KOG0553 TPR repeat-containing protein  ali follow..  13  1....................................MDNKKRLAYAIIQFLHDQLGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAEGNEQMKVENFEAAVHFYGKAIELNPANAVYAAAYSKLGNYAGAVQDCERAICID...... 155
5 -6.440[T] COG2206 HD-GYP domain  ali follow..  12  251........................................LKKSGRLHFQEQQAVDAHTIYAHSYIVNTLKYPNSVGLSVLQHHEHWNGKGYPQSLARILAVTDNFAAMLAPKSYRKPFSGYQAMKSLLADNARRFDDVIKAMIQSVGIYPIGSLVLLNNSAVARVVKTTATAPLRPCLRI..... 400
6 -6.260[K] KOG4552 Vitamin-D-receptor interacting protein complex component  ali follow..  1........................................MSFHLSTKERLLLLIDDIEMIAKELIEQAHQKISSTELVDLLDLLVAKDEEFRKMLELAEEQAKVEEAMDQRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQ.................................. 113
7 -6.220[K] KOG1510 RNA polymerase II holoenzyme and mediator subcomplex, subunit SURB7/SRB7  ali follow..  12  1.............................MADRLTQLQDTVNQQAEHFCNAIGVIQQTSLPSKFVNFERIGPQTPIPCPPQEDYAQLFAQLIARCAKDIDTLIESLPNEDSSIELKRLEIENQGTARDLEEVVQKGELLLEKMQYSLECIAQAQL............................... 131
8 -6.160[D] COG2846 Regulator of cell morphogenesis and NO signaling  ali follow..  12  92....................PELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE...................................... 220
9 -6.060[R] COG1579 Zn-ribbon protein, possibly nucleic acid-binding  ali follow..  18  26....................KEHQKELAKVQSLKSDIRRKVQEKELEMENLKTQIRDGENRIQEISEQINKLENQQAAVKKMDEFNALTQEMTTANKERRSLEHQLSDLGGEDLIVSLKESLASTENSSSVIEKEIFESIKKINEEGKA..................................... 159
10 -5.790[O] KOG3470 Beta-tubulin folding cofactor A  ali follow..  16  8.......................................QLVIKSGVVRRLTREKYCYAKEVLTEQARLEKLRGDGADDHVLRKQEEVKRRLQKEYEVLEKYLADEQDLIETDSYKKAAEILKDAKAELE........................................................ 109

FFAS is supported by the NIH grant R01-GM087218-01
6 2 0 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.