current user: public




Query: [K] COG1510 Predicted transcriptional regulators, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MKKTALDIIEHAEEHLIEKIAENMHTFGMPSTVGRVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVRKDLYDVEQDYYQTFISLFAANWTKVVSKNKVLYKKLNRELSDLLQRDGLTPEAEEKVNQLLNELKEWLHYYDWLSRLIEFFESEEVFRYVPKTKECSSLKLast
1 -93.200[K] COG1510 Predicted transcriptional regulators  ali  100  1MKKTALDIIEHAEEHLIEKIAENMHTFGMPSTVGRVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVRKDLYDVEQDYYQTFISLFAANWTKVVSKNKVLYKKLNRELSDLLQRDGLTPEAEEKVNQLLNELKEWLHYYDWLSRLIEFFESEEVFRYVPKTKECSSLK 185
2 -21.100[K] COG3355 Predicted transcriptional regulator  ali follow..  11  2.....AEKVRFPDGREVDIHDFIAFMYGLSKSDVEVLHIL-LQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKEERKGRPNYIYWVEKERLYRKLEADLEKLAGTVKEALQK............................................................. 119
3 -19.500[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  11  2...........KQEEMLKKLEDLLKAIGLKKNEIRIYRLLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRE-QSGWLGYIYTPVS-------LEILQKIKEHLMKSIEELERDLKNQTR.......................................................... 112
4 -16.800[K] COG4738 Predicted transcriptional regulator  ali follow..  13  10ISEENDFKMGEVEYEMVELLRRL----NINRPVALTLACL-SKGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKGRPVKLYKLTVQM-ETIIDTIEENVIAESKTILQNIERLKS.............................................................. 131
5 -13.500[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  12  60.......LASHAFSRWMVRCMAAAGLPGLSPIEILILHSIRHRDREKKLADICLALDIEDTIATYAIRKLEKAGLLTT--GKAAKEKTVKITAK--------------AEACAHYAQIRERL-----LVDSTANARPSEETLSELAALLRFMSGAFNQATRSAITL................... 199
6 -12.300[K] COG1846 Transcriptional regulators  ali follow..  19  41...............................TPSEIHTIDAITDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPKVSRGIYRAHADMHAAFYEELQQSFTKE---EIAIFEQCVSKLRDILSE...................................................... 149
7 -11.700[K] COG1777 Predicted transcriptional regulators  ali follow..  16  1...............MIDDIDNFIAAIE-NSTRREIIRML-TQFERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFVPSSRKLYEPGRNFLMIQRIPLENDSERVSVSFDEAISKLESIQHHIEELTKKRTELVKKKDELMAAIKYQLEDEDPVLEYLNTFDVEEVSRRTALPLEI.... 183
8 -11.600[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  19  3............................LSPVFARRLYLALLSLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDGRR.................................................................................................... 61
9 -11.400[K] COG4742 Predicted transcriptional regulator  ali follow..  14  9............................VFRSQKRRDLLLLLGEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQ........................................................................................................... 58
10 -11.000[K] COG1497 Predicted transcriptional regulator  ali follow..  10  14..................................QILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVES----GSGRSHYKITRRGAEKIKEAA-MDLRRYADEVLESMSFYRSVWPAIAWED..................................................... 106
11 -10.900[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  20  185.............................NATNQRIISEI-QNGKCNTNLALAREIGVSRATISWYVKNLKETGLIDE--TRSGRSIIYSINPSYEPLIEKY................................................................................... 254
12 -10.800[K] COG1378 Predicted transcriptional regulators  ali follow..  13  1MAHACLIEIKKVYNFVVDEIIEVLKRLGFRDYEARVYATL-ATRGEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETI---KSSPAVFRAID-------ESVLEEYKEQLVSAVDTAIRSIRESEDFSTLHPVLAGIKNRAKAMLQRSEEITAKRVYLDMILKIKSP................. 172
13 -10.600[K] COG4190 Predicted transcriptional regulator  ali follow..  16  67............................LTPRVLELIEAI--QEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFE-EDGQRK................................................................................................... 122
14 -10.500[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  18  246............................LSPELCEVLDIIRGHKGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKL-RNG-RENILVLVDE........................................................................................... 309
15 -10.400[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  14  20..........................................KEITVTMRELSRELDVSPQTVLRWLEELKEQGYIHK--RESRKGTLVELTEKGINLLEKLYEE................................................................................ 80
16 -10.200[K] COG3432 Predicted transcriptional regulator  ali follow..  40...................................MFDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNI--KTENDRKIYEITEKGKLLRTHI------EEFIKIRENLYSAKEKVSELLRTDS.................................................... 129
17 -9.580[K] COG1802 Transcriptional regulators  ali follow..  13  18............................ENVLRQAIMSGRFTPGERLIERELCETLGVSRTSIREALRRLEAEKLVSIVPHKGEAAELFALRGLLEGFAAREFA---QRATDVAIVHFAQAIQALRMAGMTKDRAKVLKAKTD.......................................... 138
18 -9.440[S] COG3132 Uncharacterized protein conserved in bacteria  ali follow..  12  5............................LTALEARVIGCLLEKQVPLSVNGVVTAMNLSESEVQEQLDNLVKRHYLRTVSGFGNRVTKYE--------------QRFCNSEFGDLKLSAAEVALITTLLLRGAQTPGELRSRAARMYEFSDMAEVELTLEQLANR-EDGPFVVRLAREPGKRESR 162
19 -9.250[K] COG4465 Pleiotropic transcriptional repressor  ali follow..  13  155LREKAEEIEEEARSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIE-SRSLGMKGTYIKVLNN........................................................................................... 247
20 -9.120[T] KOG4603 TBP-1 interacting protein  ali follow..  1MSKGRAEAAAGAAGILLRYLQE--------------------QNRPYSSQDVFGNLGLGKAVVVKTLEQLAQQGKIKE--KMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTT-PEMQKEIQELKKECAGYRERLKNIKAAT............... 151
21 -9.030[K] COG1654 Biotin operon repressor  ali follow..  19  13.......................................LLADGEFHSGEQLGERLGMSRAAINKHIQTLRDWGVVFTVPGKGYS.................................................................................................... 59

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.