current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

COG1510
Query: [K] COG1510 Predicted transcriptional regulators, from COG0312

Results of FFAS03 search in COG0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MKKTALDIIEHAEEHLIEKIAENMHTFGMPSTVGRVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVRKDLYDVEQDYYQTFISLFAANWTKVVSKNKVLYKKLNRELSDLLQRDGLTPEAEEKVNQLLNELKEWLHYYDWLSRLIEFFESEEVFRYVPKTKECSSLKLast
1 -71.300[K] COG1510 Predicted transcriptional regulators  ali  100  1MKKTALDIIEHAEEHLIEKIAENMHTFGMPSTVGRVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVRKDLYDVEQDYYQTFISLFAANWTKVVSKNKVLYKKLNRELSDLLQRDGLTPEAEEKVNQLLNELKEWLHYYDWLSRLIEFFESEEVFRYVPKTKECSSLK 185
2 -31.900[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  11  2...........KQEEMLKKLEDLLKAIGLKKNEIRIYRLLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQSGWLGYIYTPVSPLE-ILQKIKEHLMKSIEELERDLKNQTRS............................................................. 113
3 -30.500[K] COG3355 Predicted transcriptional regulator  ali follow..  12  4.......KVRFPDGREVDIHDFIAFMYGLSKSDVEVLHILL-QNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKEERKGRPNYIYWVEKERLYRKLEADLEKLAGTVKEALQK............................................................. 119
4 -27.800[K] COG1846 Transcriptional regulators  ali follow..  12  19.......RLILQLRRLESTPRTFGRAGALTPSEIHTIDAI--TDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPKVSRGIQVVLTDKGREAYRAHADMHAAFYEELQQSFTK-------------------EEIAIFEQCVSKLRDILSE........................... 149
5 -24.800[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  11  60.......LASHAFSRWMVRCMAAAGLPGLSPIEILILHSIRHRDREKKLADICLALDIETHIATYAIRKLEKAGLLTTGK---AAKEKTVKITAKGAEACAHYAQIRERLLVDSTANARPSEETLSELAALLRFMSGAFNQATRSAITL.................................... 199
6 -22.900[K] COG4738 Predicted transcriptional regulator  ali follow..  11  10ISEENDFKMGEVEYEMVE----LLRRLNINRPVALTLACLS-KGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKKNRPVKLYKLTVQMETIIDTIEENVIAESKTILQNIERLKS.............................................................. 131
7 -19.900[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  12  1............................MKMKTLFLLIKLAKKEITVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRE---SRKGTLVELTEKGINLLEKLYEEISTALYS........................................................................ 87
8 -18.300[K] COG3432 Predicted transcriptional regulator  ali follow..  40...................................MFDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKT---ENDRKIYEITEKGKLLRTHI-----EEFIKIRENLYSAKEKVSELLRTDSE................................................... 130
9 -18.000[K] COG1777 Predicted transcriptional regulators  ali follow..  12  1...............MIDDIDNFIAAIE-NSTRREIIRML-TQFERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFVPSSVGAKRKLYEPTGFSTLIVDYGRNFLMIQRIPLENDSERVSVSFDEAISKLESIQHHIEELTKKRTELVKKKDELMAAIKYQLEDE............... 153
10 -17.800[S] COG2469 Uncharacterized conserved protein  ali follow..  176.......TMDMLQEYIQNFIEKSKPKEKLSEVEEQILTMVY---TGVDSVSVESILGVTTEELNKMYDRLVNLGLARVVKIRKE-----IELTPRGVALVSEIMKKAAR............................................................................ 269
11 -17.400[K] COG1378 Predicted transcriptional regulators  ali follow..  13  1MAHACLIEIKKVYNFVVDEIIEVLKRLGFRDYEARVYATLA-TRGEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETI---KSSPAVFRAID---ESVLEEYKEQLVSAVDTAIRSIRESEDF-LHPVWCVRGLAGIKNRAKAMLQRSEE.................................. 152
12 -15.800[K] COG4190 Predicted transcriptional regulator  ali follow..  12  67............................LTPRVLELIEAI-RQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFF--EEDGQRKRPVVWFD........................................................................................... 129
13 -15.700[K] COG5111 DNA-directed RNA polymerase III, subunit C34  ali follow..  52LLSRRLLDPLRQGNVLVYRADEAKTVSTMEGDEQIVYSFIKNSNEGIWRKTLTLRTNLHVSVVDRCLKSLESKNLVKSIKSVKNPTRKIYMLYDL-VEFIENLKKVIYRYVHSKSFPPKKAAMGPDLVWGPEYNGYPTALQIHNWLRSTNITKVDLANVISLVDVLIYDGKVEKRSDGASYRAIR 259
14 -15.200[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  1................MSEYEKEIDELINDYDMLRVLKHFTIA-HVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDYYTNTSIKRHTYYQINKKAEAVLKEITPKL------YVHHLKSADLQMLCSRKERKENPEACSSLLRM---LIDKCYDLTDLGR--EVFDTARRMQILHCEDRN.... 168
15 -15.100[K] COG2345 Predicted transcriptional regulator  ali follow..  12  15.............................GDTRRKILLIL-LERAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAANPRGRPAKTYRLTDKG----RSIFGHEYDSLAAAALATLREVGGDDAVRQFARKRIETIVEGITPADVTDQSIEDTAKSLVEAFSR.................... 154
16 -15.100[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  17  246............................LSPELCEVLDIIRGHKGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLRN--GRENILVLVDE........................................................................................... 309
17 -14.200[K] COG1695 Predicted transcriptional regulators  ali follow..  14  3................................RYAIKALVLLSKKPRTLYQMSKEISVSHGTLMPMIRKLLQERYID--FETRGREKVYHL-TERGSRFVESLGKIEEDVKQNLISRTMGDAFFYLNLLSKNDTSEAIKSAIQILLPAIIAQVEYAFRMLMEGHREEVEGVARDLLRKYGE.... 152
18 -14.100[K] COG1497 Predicted transcriptional regulator  ali follow..  10  9.............................ELTRFQILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVES-----GSGRSHYKITRRGAEKIKEAAMDLRRYADEVLESMSFYRSVWPAIAWE...................................................... 105
19 -14.000[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  19  3............................LSPVFARRLYLAVESLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDGRR.................................................................................................... 61
20 -13.900[K] COG4742 Predicted transcriptional regulator  ali follow..  10  12.............................SQKRRDLLLLL--GEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGSYELTDMGEQVFKKARALVDVLTEKDNYWIEHDLGGIPQYLLDKIGEIKDCNLVKADPSQIFEPNTELLEYFASSRYLMVFSSFYRPEFLPLYSKLGRLESEVS 167
21 -13.700[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  20  185.............................NATNQRIISEI-QNGKCNTNLALAREIGVSRATISWYVKNLKETGLIDE--TRSGRSIIYSINPSYEPLIEK.................................................................................... 253
22 -13.300[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  10  16...................................ILYLITKNQGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKPYQG------VELTEKGAEEAVRIKRKHQVLETFLADVLDFDRKEAHREACELEVSDSVLERLYDFLGN..................................... 124
23 -13.000[K] KOG3233 RNA polymerase III, subunit C34  ali follow..  12  57LLSMGQLDLLRSNTGLLYRIQNAGKMKGSDNQEKLVYQIIEDANKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNL-QPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQRNSSFASSHEVWKYICELGISKVELSMEDIETILNTLIYDGKVE 249
24 -12.400[K] COG1675 Transcription initiation factor IIE, alpha subunit  ali follow..  1MKAETTTGVEELLNELVGRAAG----------EVGLILFSLGIEGEFTDDQLSLELGIEINEIRKALFALYEIGLADYVRRRDDETGYWRINYDKALDVLKRELEKTAKKLREKIEAETSTIYYICPNMCVKVSYNDAMEL-LDCSKAIEKIEEEVRRIEEILESLDKNS............... 176
25 -12.300[S] COG4860 Uncharacterized protein conserved in archaea  ali follow..  12.................GELVSIFHAAD-SEVKRKLLLDL--STGWITLPVIEQKYGKE---GRRALLYLDKIKMIETQWITGQNEKAYHTYYTNVQINIMGSLSELADIIYAATLSDEQLSEYEDKIKAMMKNGE--GVFLGDVSDSLGISQTLIRGIVKRSSILERGYKIELVSGAE...... 168
26 -12.300[K] COG4189 Predicted transcriptional regulator  ali follow..  15  1MAPNFLLVDAEKEFDVLKAAA--------SLIRVQILKLL-HEANGLNVNEIAQRLALPQSTVSAGVAVLEEAGLLRTETRKA-RKGSQKICFATCDELIVSFRKPETPAASNYIA..................................................................... 106
27 -12.000[K] COG0640 Predicted transcriptional regulators  ali follow..  10  1................................................MNEITMQTQADQPKVSSNLAILSEARLVDSIQM--GREKIYRIAPEKFEDMVDWLDS................................................................................ 55
28 -11.800[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  20  22..................................SVINVL-LREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSR......................................................................................................... 66
29 -11.800[K] COG1522 Transcriptional regulators  ali follow..  1.......................MSKVELDKIDRKILEVL--SNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVIRQYAALLDPGKIGLGLSAYINVRLEKQGGAPKG--KAPSDIFRAAVATWPEVVTCYAMTGEMDYLLKVFVEDMDHFARFIRDQLLAHPAVIDVKSSFALERIKDTTAL. 158
30 -11.700[K] KOG2587 RNA polymerase III (C) subunit  ali follow..  367..KSIISVAQKDEAVVMRRYGK---------EAFRMFRYLSQEGRFVETDKIADAALTEKKDTPQFLLKMWKDGYLHMQKLAVTATPFLLWKVNK-LIVTTQMLDEMYHASLNLSLRLAHELEAEKELLLLPLDLKERLKKVKAKRLLLSSTMFKLDDAIMLFHDF................... 529
31 -11.600[K] COG1414 Transcriptional regulator  ali follow..  11  22..................................DILELLASVDGGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTK........................................................................................................... 65
32 -11.400[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  143............................FTPKRAQVVCVLLDAPQDAPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGS........................................................................................................ 197
33 -11.200[P] COG0735 Fe2+/Zn2+ uptake regulation proteins  ali follow..  6............................LTKNQSLVMGALAHSDGPMSAYTILDKLRDNPLQVYRALDKLLEYGLVHRLESLN...................................................................................................... 64
34 -10.600[T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases  ali follow..  13  132...TLAFDLTWIAASEERMLDNHLLSIGRRTAIERAAYLIAFLYRPVTQQHVADTLGLSIVHTNKTLRKLVDRGLIR............................................................................................................ 219
35 -10.200[K] COG1654 Biotin operon repressor  ali follow..  17  9..................................TLISLL-ADGEFHSGEQLGERLGMSRAAINKHIQTLRDWGVVFTVPGKGYS.................................................................................................... 59
36 -10.100[K] COG2378 Predicted transcriptional regulator  ali follow..  28..................................EIIQILRLARRPVTAQTIADMLEVTARSVYRDIAALQTMRVIEGERGVGETEAIVLALAMVDRSGDAELRQAAKKVSDKIAASLPEPLSKTLSANALHAWGSIAPAPAGIDLATVRRAVRDEERLDLCYSDESGVETQRRIR......... 187
37 -10.000[K] COG1802 Transcriptional regulators  ali follow..  13  18............................ENVLRQAIMSGRFTPGERLIERELCETLGVSRTSIREALRRLEAEKLVSIVPHKG-REFAQRATDVAIVHFAQAIQALRMAGMTKDRAKVLKAKTDLYDVLLDNCGNGLVKETLTSLHSRINLLRATSLMDPQRLPV-EIDDLYQALKARDPDAAER 201
38 -9.930[K] COG4465 Pleiotropic transcriptional repressor  ali follow..  12  155LREKAEEIEEEARSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIE-SRSLGMKGTYIKVLNNKFLIELENLKSH............................................................................... 259
39 -9.720[K] COG1733 Predicted transcriptional regulators  ali follow..  15  12...................LSMAAEVLC---TRWTMVLMRELVAGSTRFNDLRRGVKMSPTLLSQRLKELELAGIVERKEVPGEKGIFDYRLTEAGRDLRPVVEA................................................................................ 95
40 -9.680[T] KOG4603 TBP-1 interacting protein  ali follow..  10.............................AGAAGILLRYLQEQNRPYSSQDVFGNLGLGKAVVVKTLEQLAQQGKIKEKM---GKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTT-PEMQKEIQELKKECAGYRERLKNIKAAT............... 151
41 -9.530[K] COG3682 Predicted transcriptional regulator  ali follow..  15  3............................ITAAEAHVMEALW-RRSPLSADELVAEVG-GEATVKTLINRLLKKKAIKS--ERAEGKHGYRPLVDRSAYVQAESQGLLDRLFDGQLAPL------ISHFAQHRPLKPDEVAKLKKLIDEMGE.................................. 120
42 -9.360[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  12  7....................GNILRSLNRSELRRKVLFYLLIYPYRSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQSKNGFK--YFKINPEIVEEVRNMKNMFS............................................................................. 103
43 -9.240[K] KOG2593 Transcription initiation factor IIE, alpha subunit  ali follow..  4LVAKTFYDNYTPKNNNQKKSAKNG----SGGIAVLVLDALTRRQ--VREEDLAKELKLNTKQLRTILRYFEEQQFIMRVHRKEKSYSYCCLDYSQIYDVIRYKLHRMKKEFKDVLEDKDNVQEKLTSEEVVVDGSDNPRSRRDHLKDLLQNMEVRLKPLMDHINRIKDLPV.............. 211
44 -9.210[K] COG5340 Predicted transcriptional regulator  ali follow..  1...............MSSTQETQTIRQGLSTRESRLLSHLAAEGHQISIDDVEATLEVAPNTAREIASRLTEKGWLDRL-----LPGRYLIIP............................................................................................ 74
45 -9.110[K] COG1725 Predicted transcriptional regulators  ali follow..  12  24...................................ITGEWKGEDKLPSVREMGVKLAVNPNTVSRAYQELERAGYIYAKRGMG---SFVTSDKALFDQLKKELADAITERFLEEAKSIGLDDQTAIELLIKRSRNHE................................................ 122
46 -9.110[K] COG2188 Transcriptional regulators  ali follow..  21  36...............................................SENELVASLGVSRMTVHRALRELTAAGFLIRLQGVGT..................................................................................................... 72
47 -9.080[S] COG3132 Uncharacterized protein conserved in bacteria  ali follow..  16  5............................LTALEARVIGCLLEKQ-PLSVNGVVTAMNLSESEVQEQLDNLVKRHYLRTVSGFGNRVTKY................................................................................................ 81
48 -9.020[KT] COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases)  ali follow..  14  1.....MERLTEAQQELYEWLAEYIRIHQHSP----------------SIRQMMQAMNLSPAPIQSRLEHLRTKGYIEWTEGKA...................................................................................................... 63

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 1 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.