current user: public




Query: [E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLGGLast
1 -117.000[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali  100  1MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLGG 233
2 -62.800[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  33  1MLKLASISKRFGGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEPTGGTLTFGGTSLVGKKPHQITQMGIARTFQNIRIFKEMTLLENVVVGGYRAAERRARDRALELLSWV--LDHKAGDIADNLSYGDQRKLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIRARGYTIFMIEHDMRFVMGLCERIAVLNFGRIIAEGPPEAIRNNPQVIEAYLG. 248
3 -61.000[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  32  3ILTAENLAKSYKSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIVIDGEDISLLPMHNRAQRGIGYLPQEASIFRRLTVYENLMAVLEIRKDLTPQQRREKADELIENISHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKIIATGTPEQVMNDEQVKRVYLG. 236
4 -52.600[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  31  1MINFKNVSKHFGKIQVLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKLEVITRGQLIVDGLDVNSPNIDRQIRLEAGMVFQQFYLFPHLTALENVAFGPTKVRGTSKEEAKKQALALLSKLEDRAHHYPAELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEEGMTMVIVTHEVGFAQKVASRLIFIDKGRIAEDGDPDSLISNPPSERL.... 232
5 -51.200[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  26  1MITLTDCSRRFQDVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQGVITVDGFDTVKQPAEVKQRIGVL-FGGETGLYDRMTAKENLQYFGYGLNRHEIKARIEDLSKRF--MRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALESLYES.......... 227
6 -50.800[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  27  1MLKLTDITWLYH--HLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPSR---RPVSMLFQENNLFSHLTVAQNIGLGL-LKLNAVQQEKMHAIARQM-GIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGMTNELLSGKASASALLG. 229
7 -50.700[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  29  2SIQLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDFTKTPS-LRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCFTEPQTEA...... 235
8 -50.000[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  25  7LLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIY-RQQVSYCAQTPTLFGD-TVYDNLIFPWQIRNRQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVRENIAVLWVTHDKDE-INHADKVITLQPHAGEMQEARYELA............ 225
9 -49.900[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  27  5ILEIQDLTVSFDGFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRIARLGVGRKFQTPRVYLNLTVAENLDLAVMGQATGAEQRSVGGLLETI-GLTPKAHLAAALLSHGEKQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLAL-AESHSIIVIEHDMEFVRQIARKVTVLHQGSVLCEGNMDQIQNDPKVIEVYLG. 244
10 -49.200[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  25  5KLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVRDKD-LRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEARERAVKYLAKVERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQSPRL.... 248
11 -47.100[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  25  1MLCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALASCTGELWLNEQRIDILPTAQ---RQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRAAIPVVQVTHDLQDVPADSSVLDMAQWSEN...................... 212
12 -46.000[D] COG2884 Predicted ATPase involved in cell division  ali follow..  33  1MITLDHVSKKYLARPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPGRHILRQVIGCVFQDFRLLQQKTVYENVALEVIGRRSDAINQVVPDVLETV--LSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLV..................... 217
13 -45.000[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  23  1MLTIDHVTKTFGDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRPVNYHISNK-----IGYLPEERGLYPKMKVRDQLVYLARLKEKREAVKELGTWLERF-NITDYENKKVEELAKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNSGVSILFSSHRMEHVEELCENLCILQKGKPVVQGKLKEIKRSFGKKNVTI.. 227
14 -45.000[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  26  7SIRVTDLSYSVAGRELLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLTGELGK--SGVELFGQPLRDIKPAEAAKR-RAVLPQQTPLSFAYEVLDVVLLGRIPHGQRETVQDRAIAAACLERLSGYETRDVLTLSGGEQQRVHFARTLAIGERVLLLDEPTASLDLAHQHATLRLARELCREGVGVLAVLHDLNLAAQYADRVLMLAEGHVIACDHPAVALTPESIRTAY... 240
15 -44.900[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  22  5ILKVENLTVYQGNYLAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDLIPRRVGQIEIFGRPITKLGN---LRHLLGYMPQNFIF---ISVEELVGLGWVAEKSAAIATALKRT------TYHLRNQAIGTLSGGQLKRILLAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELKQQGWTVLQVSHDIDMVSRHCDRVLCL-NQTVVCTGQPEIALSPQNLLATY... 246
16 -44.400[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  26  24VLAVKGLVKAYKSHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINDTQNIAALTTKQMWRAKCGMIFQDFCLVPRLDVITNVLLGRLSYTST--EQDQARAIELLQWMLPHALQRAENLSGGQMQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISENDIAVIVNLHSVDLVKDYCTRVIGIAHGRIIFDGPPSML-NDSIIQDIY... 269
17 -44.300[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  31  4VVHFKNVNKYYGGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGEIYLEGKPITHLPPNR---RNVNIVFQDYALFPHLNVGRNIAFGLELKSSDAIHKRTMELLALV-KLQDFADRMPDQLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPNELYSRPRSRANFIG. 236
18 -43.500[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  23  5LLQVHELSKSYGGIKACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADHIAVDHGNVTYISRSGEDLEIFQLAEAGFVQQNPRDGLRMRVSAGANIGERLLDIGVRHYGNIRDEAAHWLREVPTRIDDLPAQFSGGMQQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRNHLSVIIVTHDIGVVRLLAHRLLVMQQGQVVESGLTDQVLDDPQ........ 243
19 -43.400[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  27  3.IEIANIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHARD---RKVGFVFQHYALFRHMTVFDNIAFGLTVLNAAAIKAKVTKLLEMV-QLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEEKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPDQVWREPATRFVL... 234
20 -43.300[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  25  6AIEVKGLTKSFGSSRIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSILIDGTDIIECSAKELIRTLFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLQLLGGDEKKFPGEISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQDATILIVTHNVNIARTVPDNMGMLFRKHLVMFGPREVLLTSDEVVRQFLNG 244
21 -43.100[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  22  1MIEINDVNKKYQQTTVLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADSGNVLFNGLDVAKTSGDKLATI-LSVLRQENHFTSRLTVSDLVGFGRYPYSRGRLNKNDRQHIDAFLNLMPLKDRYLDELSGGQRQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADEHKTIILVIHDINFASAYSDHIIAMKNGEVIYRGAPAEIMQPSILEEIF... 233
22 -42.600[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  25  4VMQLQDV----AESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMT-SGKGSIQFAGQPLEAWSATKLALH-RAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALA----LDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPNLAQAY... 230
23 -42.500[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  16  13AIRVSGMQFAYEV-PIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAGHMVGGKNVVQVLSRSATQLVCSGDLSYLGGSWSKTVGSAGEVPLQGDFSAEHMIFGVEG--TDPVRREKLIDLLDINLQWRMHKVSDGQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQGATIVYATHIFDGLETWATHLAYIQDGELNRLSKMTDIEE........... 238
24 -42.000[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  27  1MIRLQDIQVTFNP-RALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETPIVGGQVLIDEIDVTKQSVDQRANCARVFQDPLAGTCGALTIEENMALAYMRGKKRGWSLALERISILGLGLEDRLGDNIGLLSGGQRQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIKEFNLTVMMVTHSMKDALACGDRTVMLHQGQIVLDVTGEQ.............. 235
25 -41.400[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  28  4ILSISGVSKTYTGFTALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNRSTGTVTVDGHDIGKDYRAARSLIGL--VPQELTIDAFESVWATVNYSRGLFGKPPNHGFVEKVLRDLS-LWDKKDAKAITLSGGMKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLREDGVTIILTTHYIEEAEAMADRVGVINRGEIILVENKAELMHKLGRKRLVL.. 232
26 -41.100[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  25  1MINVQNVSKTF-RLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQIEWVDLVTAPARKVVKTTVGWVSQFLRVIPRISALEVVMQPLLDTPREACAAKAARLLTRLNVPERLWHLAPSTFSGGEQQRVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREAKTRGAAIVGIFHDEAVRNDVADRLHPMGASS....................... 226
27 -40.900[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  27  6SVEVHRLRKSVHELSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEALRAQHVGFVFQSFMLIPTLNALENVELPALLRGENSGQSKAGAKALL---LGKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREGTTLILVTHDPALAAR-CDRRLRLVNGQLQ..................... 225
28 -40.800[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  26  1MLNVSGLWAEYQGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTPSAGVITLDNIPVSGPSAER------GVVFQNEGLLPWRDVVSNVEFGLQLAGSKEQRRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIRDTGKQILLITHDIEEAVFLASELLLLSPGQVV..................... 210
29 -39.700[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  30  25.MATEDLHVYYGDNHAIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMNDE-EGQILYDGININRKEVDLYVRKEIGMVFQKPNPFT-KSIYENVAFGL-MKNKKEIMERVEKSLRLWDEVKDDLGKSALSLSGGQQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINELKNK-YTIIIVTHNMQQAARVSDYTSFFYLGEVVEFSGTSELFTNPQEKQTYISG 268
30 -38.800[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  28  1MIEIKSVNKVFKQIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQLARRNIGMIFQHFNLLSSRTVFENVALPLELASQQHIETKVTELLALV--LSEKRESYPANLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRQNLTILLITHEMDVVKSICHEVAIIGGGELVEKGTVGDIFAHPK........ 233
31 -38.100[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  27  6.LKITDLYKSYGSVSVLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDIAINGKSVSNLHPSQ---RDIAMVFQSYALYPNMTVAGNIAFGMEIRPKPERDKAIQQVADML-QIGHLLDRKPSQLSGGQRRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSRKTTIVYVTHDQIEAMTLATKIAVLKDGVLQQFGTPAEIYNNPA........ 228
32 -38.000[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  23  1MLEARELLCERDERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVRDS--YHQNLLWIGHQPGIKTRLTALENLHFYHRDGDTAQCLEALAQA------LAGFEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGIVILTTHQP........................................ 186
33 -37.900[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  23  4MLEVKHINKTYKGYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLARKQLGFVFQDFNLLDTLTIGENIMLPLTLEAPSVMEEKLHGIAAKL--IENLLNKRTFEVSGGQRQRAAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRDDHVTALMVTHDPVSASYCRRVIFIKDVVLFNEENRQVFYEQILDVLSMLGG 247
34 -37.600[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  20  5LLEVRNLSKTFQTVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPLHFGDYSFRSQIRMIFQDPSTSLNPRQRISQILDFPLRLNTDLEPEQRRKQIIETMRMVPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADVLASP......... 242
35 -37.100[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  26  5MLEIRNLSRCFGEVRAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGLEKPSCGEIRIDGEMIAAGAHSRAHGKKVQMVFQNSSLNPRRTVGQSVALDAHGFPSLQRAKRISELLEMVQLPANFAERFPHELSGGQKQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRRDLTYLFISHDLSLMRNFASRVGILYRGKLVETGKTDEVFYRP......... 243
36 -37.100[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  30  339.LTLRDVQFTYPE-QALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAAL-RQTISVVPQRVHLFSA-TLRDNLLLASPGSSDEALSEILRRVLLEDAGLNSWLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMREKTVLMVTHRLR--GLSRFQQIIVMDNGQIIEQGTHAELLARQ......... 563
37 -36.700[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  29  1MIELDKLSKTFKEFRAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPPTSGRVLIDGQDTADLDEVTL-RRHIGYVIQQIGLFPNMTIEENIMVVPRLLDKARCKEKARELMSMV---KQYLQRYPRELSGGQQQRVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRKGMTVIMVSHDIDEAIKLGDKVAVFKSGRLLQYDHPDTLLAHPEFVSAFTG. 242
38 -36.700[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  24  18.IELKDVQISFGRFDAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQGLNRKA------GYLFQQDALMPWKTVLENVAIGLEIAGPKAKAREQAREWLNKVGLGTFGDRYPHMLSGGQRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLSQDKKAVMFVTHDLEEAIALADRVVIMSAG........................ 226
39 -36.200[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  18  228VIEVEELQ----LKKGGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSASRRKIKLDGVDTRLSGPDDALMRGIGLLPESRKLITSFSILQNISLNNYRKDLKKELEHTTKAMAQVQVKAQGPYARVDTLSGGNQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFAARGHSIIMISSELPEVIGMSDRVCVFRSGGIVATVEGEDINSETIMTNA.... 463
40 -36.100[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  25  6.ISTETLSLGYGDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGGSVLLEGRAIAKLPTKEVAKE-LAILPQGPSAPEGLTVHQLVKQGRYKEDEEAVERALKAT-----KLEDMADRAVDSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEEDRTIVMVLHDLNLACRYAHHLVAIKDKRIYAEGRPEEVITCDLVQNVF... 239
41 -35.300[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  22  4LLDVKDLRVEFGIVTAVNDLNFSLKQGETLGIVGESGSGKSQTVFAIMGLLAKNTGSAKFEGKEILNLPEREL-QIAMIFQDPMTSLNPYMKVSDQLMEVLMLHKGMGKAEAFEESVRMLPEARKRITMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKRENTAIIMITHDLGVVAGSCDKVLVMYAGRTMEYGSVNDIFYNP--SHPYAEG 252
42 -35.200[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  23  30..........YRQILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLTGLIKPSGGKVRVAGFDPFRRQTAFLRRTSLVM--QKQQLIWDLPTLDSLRIAIYEIPDQVFEQRLGELSEMLD-LTTELKQPVRKLSLGQRMKAELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRRQATVLLTSHYMADITTLCERVLLIHQGQLMYDGDLEALVER.......... 243
43 -34.700[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  26  16..................TINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKGICLKRRVGYVFQDARLFPHYKVRGNLRYGMAKSMVDQFDKLVALL------IEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTRENIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVMN...... 223
44 -34.400[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  22  477.VELKNITFGYSRLELIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQPWTGEIYFDSQPREEISLQLL-TNSVAMVEQEILLFGG-TVRDNLTLWDTTVPDKNLMRACDVIFSMSGGYDAELIEGAANLSGGQRQRLEIARALVNNPSILVMDEATSALDAETEKIIDQNLRRR---GCTCIIVAHRLS-TIRDCDQIIVLERGKVVQQGTHQELWQVE......... 701
45 -34.400[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  21  3LLDIRNLTIEFGPVKAVDRISMTLTEGEVRGLVGESGSGKSLIAKAICGVSKDTADRFRFNDIDLLQLTPRKVIGHNISMIFQGLQLIQAIPGWTYKGRWWQRFHWRKRRAIELLHRVGIKDHKDIMHSYPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNTTILLISHDLQMMSKWATRVNVLYCGQTVESAVCEDLLSTPH........ 251
46 -33.800[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali follow..  24  5LLEVKNLTKSFGEVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSEGDM-DMQIIFQDPYASLNPRHTIEKIIREPLIVHQIGTKKEQLERVEELLETVSDHATRYPHQFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETALTYIFIAHDLSVVKHISDRVAVMYLGRMVEMATKDQLFENP......... 247
47 -33.000[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  25  5AIELIGINKSFGAVRANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQADSGEIRVGGKPASIKTPNDAIALGIGMVHQHFMLVDNFSVLENIILGALKSSIAKARSELERLEREY--LEVDPDAIIEELPVGLQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKEQGKTVVLITHKLREIMAITDNVSVMRQGTMVATRETSKTTVGE......... 232
48 -32.700[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  25  335MVSFNSFSKQYGDGFSLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKPDEGDPGIEVK--------------ISYKPQYIKADTPVSVQDFLRGITKRFGTSYYEVEIANPLQ----LERIYESLLTELSGGELQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAENQKTAMVVDHDIYMIDMLSQRLLVFE-GKPSVYGEAHGPFSMESGMNRFL.. 547
49 -32.500[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  21  7SLQILQGTFRLSDTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLSFEQLQKVSDEWQRNNTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQF-GITPLLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQSGITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKEELLQQALVAQ..... 234
50 -32.400[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  24  32....EQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDAL---LENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPA........ 257
51 -32.200[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  20  314ILEVKDLSMHFGEMKALDGVSIKLLPGETLGIVGESGSGKTTMGRSIMRLYDPTAGEMLYRRADGSVVDLSKIEGKELKAARRELRMVPRMTVAQVIGEPLLVNGIAKGKELEERVCSLMEQVPSGRERYPHAFSGGQRQRIGIARAITLRPRIIVADEATSALDVSVRFQVLDLLMKLQDEGLAYIFISHDIGVIRYMCDRVGVMYRGKLVEVGEAEKVCNAPD........ 551
52 -31.400[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  21  350.IIANDLVVLSQGKRLAGPLSFTLQSGKTTALVGPSGAGKTSLINTILGFM-PYQGSLTINGIELRELDHAQWRQT-ISWVGQNPLLLYG-TIRDNVTLGKHNIADEQVTQTLQAAFVEQQGLDYPISDRSAGLSVGQAQRLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQQRTALFVTHQ---QPLQSVEQILVMENGLLVQAGHFEDLSQQSGLFATML.. 579
53 -30.400[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  22  412VLESFGVRQRVVERYVLRDVNLEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKPSSGMVEVVVDSIAAM------IPSELEPQITEKSILEQIFDITGDIHLAVEVLNRAGISDAVLYR--ARFNELSTGQKERFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELAREKITLIAVTHRKEVINALSDRILYVGYGGVTES................... 619
54 -30.000[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  23  336.LRVENVTIVPERKPTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMPAAGKVRLDGASFDQWDRETL-GRHIGYLPQGVELFDG-TIGENISRFDDNPDPEAIAARAAGAHELILRFEKDIGEAGSTLSAGQRQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKARGGIAVVVAHRPS-AIGAVDYILMMEDGRMKAFGPRDEVLSK.......... 562
55 -29.700[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  22  275VLEGRHVEVTFLMLRAVDDISIRLQRNQTIGIVGESGSGKSTLGRALLRLL-PSDGLIRFGDRDISTADRQAMRPLRRQMQLVFQDPFGSLSITEGLLVHEPNLSGKQRDQRAVEALREVGLDPNARNRYPHEFSGGQRQRIAIARAMILKPKMVVLDEPTSALDRSVQKQIVELLRKLQADELSYLFISHDLSVVRAMADYIIVMKQGKIVEEGPTEAIFSNPQ........ 518
56 -29.400[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  22  323.LELRNVTFAYQD--SVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDY-RKLFSAVFTDVWLFDQL-----LGPEGKPANPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQDPHFRREFYVLLPLMQEMGKTIFAISHDDHY-FIHADRLLEMRNGQLSELTGEERDAASRDA....... 542
57 -28.900[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  20  78.DLAKDTTHRYGANGFKLHRLPIPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNTPPTHFRGSELQSYFIRVVEENLKTAIKPQHVDYIKEVVRGGKMLEKLDERGLMEEICADM-ELNQVLEREARQVSGGELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRHDSYVIVVEHDLSVLDYLSDFVCCLYGKPGAYGVVTLPFSVREGINVFLAG. 315
58 -28.200[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  27  363.ISFKDVHFAYDP-PILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESL-RKFIGMVPQDTVLFND-TIAYNIRYGRTDASEEDVEKELAQIAGFIKHLPDGYKSMVGELSGGEKQRVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSRGRTTLVIAHR---STVIGADEIIVLKDGLIAERGTHRHLLDQKGL....... 590
59 -28.000[U] KOG0058 Peptide exporter, ABC superfamily  ali follow..  22  504.VDFENVTFTYRTTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYL-HRVISLVSQEPVLFAR-SITDNISYGLPTVPFEMVVEAAQKIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLS--TVEHAHLIVVLDKGRVVQQGTHQQLLAQGGL....... 733
60 -27.600[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  26  342.IEFRHVTFYYPG-PALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGAL-RNQVALVSQNVHLFND-TVANNIAYAR-IEEAARMAYAMDFINKMEHGLDTVIGENGIMLSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS--TIEKADEIVVIEDGRIVERGVHAELLVQQ......... 569
61 -27.400[U] KOG0057 Mitochondrial Fe/S cluster exporter, ABC superfamily  ali follow..  25  439.ISFENVHFSYLP-KILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDVDSGNVKIDGQDIKEVRLESL-RSSIGVVPQDTVLFND-TIFHNIHYGNLSATEEEVYNRRAAIHDTIMKFPDKYSTAVGELSGGEKQRVALARAFLKSPAILLCDEATSALDSKTEAEIMKTLRSLASNRTCIFIAHR---TTAMQCDEILVMEKGKVVEKGTHEVLLGKSGR....... 666
62 -26.900[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  27  108..............TLLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGKGTVKLNGETLQS----RMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRPKSKKKLRVQALIDQL--IRNAAKTIIGDISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMIHQPSHRVLGLLDRLIFLSRGHTVYSGSPASLPR........... 323
63 -26.700[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  20  1MLEIRNLHARIVD-EIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAG-YEVTEGDILYNGQSILEMDPAERATSGIFLAFQYPMEIPGVATMEFLKVAMNEQRKARGEEPLKASLNMDMAMLKRPLNVG--FSGGEKKRAEILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRAPDRAFLVITHYQRLLEHIVDSVHVLYRGQVIKSGDKSLALDLEA........ 240
64 -26.300[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  23  6EIVNTDFSLAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIAN-------------GQLDGFPDKDTLRTCVEHKLQGEE--GDLDLVSFIALDEELQSTS--REEIAAALESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEH--TDITSLIVSHDSGFLDTVCTDIIHYENKKLAYKGNLAAFVEQKPEAKSY... 218
65 -26.000[R] COG3910 Predicted ATPase  ali follow..  18  12..KPEGREEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPERGIVRNNSLDRRSHGEG-FLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIATHSP--VLLAIPEATIYYFDEDGITERLYDELENIAFLRRFLD. 250
66 -25.900[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  18  7LIELRVDKYTYNGRVGLSDFYATFEGCDFI--IGPTGSGKSTVLKMVNGLIPNLEGKVRVFGEKPNPRIAFFVKQ-------NPEEMITSTQVIDELVFPLQGFGWGEAKREAEEVCEEL-GIGGLLERKTYELSTGELQLVQIAAALASKARILVFDEPFANLSRKNVLKVIKILR-----DYPHLVSEHRLEFSSFFEKTINLGLECEDF..................... 211
67 -25.800[P] KOG0056 Heavy metal exporter HMT1, ABC superfamily  ali follow..  25  576.IEFSNVTFGYSP-IVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQSL-RKAIGVVPQDTVLFNN-TIFYNIEYAKLGASDEAVYEAARDIHERILGFPEKYETKVGELSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCANRTTIIVAHR---STIIHADEILVLQQGSIAERGRHEELVLREDGIYADM.. 808
68 -24.900[GM] COG1134 ABC-type polysaccharide/polyol phosphate transport system, ATPase component  ali follow..  21  297....MSFNFKNETFWALKNVSFDIKEGEVVGIIGHNGAGKSTLCKLLTKILTPDEGELELSGE------TTSLLSYGTGFNAQ-------LSGKDNVYLNGMLIPKERVAQEYPNIVA-FSELEKHMDKPVKSYSSGMKSRLGFSIAATLQPDIFIIDEALSTGDVAFQQKASEKIQEMMERAKAVIIVSHSMKFVESVCTRAIWLEKGQVRFDGDPEEAVK........... 502
69 -22.800[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  20  385VIMVQNVNFRYND--IYKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNSHRIARYHQHLHELLDLDASP--------------LEYMMRAFPDVKEKEEMRKIIGRYGLTGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHL----METIDALADAINDFDGGMVLVSHDFRLINQVAEEIWVCEKETVT..................... 582
70 -21.800[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  18  673ILGVHNVTFAFSQKPLFIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQRKNHRHVGRFDQHSGEHLTAEESA----------------AEYLQRLFNLPHEKARKALGSFGLVSHAHTIKMKDLSGGQKARVALAELCLSAPDVLILDEPTNNL----IESIDALAEAINEYEGGVIIVSHDERLIRETGCTLYVIEDQTINEIVGEFDDYRKEVLDS..... 883
71 -21.300[R] COG0488 ATPase components of ABC transporters with duplicated ATPase domains  ali follow..  28  324VIEVQNLTKSYGDRTLIDDLSFSIPKGAIVGIIGANGAGKSTLFRMLSGQEQPDSGSVTM-GETVV-----------LASVDQFRSMDDKKTVWEEVSNGQDILTIGNFEIPSRAYVGRFNFKGVDQQKRVGELSGGERGRLHLAKLLQRGGNVLLLDEPTNDLDVETLRALENAILEFPGCAMVIWFLDRIATHILDYGDEGKV............................ 521
72 -20.400[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  20  426.VHVVAVEVRTSAGEQLDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWPYASGTL---------------------SRPDGKNETMFLSQLPYVPLGNLRGPEDTVRDTLTKV---LNPLCDRLDEEAKILSPGEQQRIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLRSELPDCIIV-----------SVSHRRAVLHAQQLELLGGGQWRLGPVEKEPLHV.. 638
73 -20.000[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  18  442.IRFDNVPLVTPNGDVLERLNFEVPSGTNVLVCGPNGCGKSSLFRVLGELWPLFGGTLTKPAKG------------KLFYVPQ-RPYMTLGTLRDQIIYPDRPLDMIRKGVSDSDLEQMLENVQSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREK---NITLFTVSHRKSL--------WKYHEYSLYMDGRGSYRFEQIDDQSDQFGS 661
74 -19.100[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  18  505.ISLRAVPVVTPNCDIVPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAGELH--------IPRPVKDVPCMFYIPQ-RPYMSIGSLCDQIIYPDTREDMKRKHITENELRSILKMVSDVVRDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM---GITLLTITHRPTL...................................... 697
75 -13.500[L] COG0178 Excinuclease ATPase subunit  ali follow..  24  610....KTVELKGAVGNNLKNVDLSIPVGLFTCVTGVSGSGKSTLINTYTGIFTPQPGRFSFNGGRCEACQGDGVIKVEMHFLPDGKRYYKGKTIDEVLDM---VEDAREFFDPVPVIARKLQTLMDRLGQSATTLSGGEAQRVKLARELSKRDTLYILDEPTTGLHFHDIQQLLSVLHRLRDHGNTVVVIEHNLDV---IKTADWIIDLGLIIAEGTPEDVAQIEA........ 928

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 1 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.