current user: public




Query: [H] COG0314 Molybdopterin converting factor, large subunit, from COG0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MAETKIVVGPQPFSVGEEYPWLAERDEDGAVVTFTGKVRNHNLGDSVKALTLEHYPGMTEKALAEIVDEARNRWPLGLVTVIHRIGELWPGDEIVFIGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRWLast
1 -97.600[H] COG0314 Molybdopterin converting factor, large subunit  ali  100  1MAETKIVVGPQPFSVGEEYPWLAERDEDGAVVTFTGKVRNHNLGDSVKALTLEHYPGMTEKALAEIVDEARNRWPLGLVTVIHRIGELWPGDEIVFIGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW 150
2 -8.120[M] COG3065 Starvation-inducible outer membrane lipoprotein  ali follow..  12  28.VTIPPAIQGTTATPLQDLNLIRSAPKIGQEARFGGTVVNVKNEPNRTRLEIASVP-LDSGARPILGEPSQGRV------IAYVDGFLEPGHLVTVVGPIVGVEAGKIGMTPYNFVVIKATG-RWHIAQ..................... 155
3 -7.220[J] KOG1004 Exosomal 3`-5` exoribonuclease complex subunit Rrp40  ali follow..  15  26........QDGSIRLGPGLVFQKKDREEEIVVSKAGRLHQTGKN-LIDSRTKRYIPATNDQVIGQIISRFAEGYRVDGSLVYARVGELKNGYMITGLSLSHCRK--LILPKNTLLQTLGSYIPF-EIAVGMNGRVWVNSENLSTTVL... 213
4 -6.620[J] COG1097 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain)  ali follow..  15  31..............................YSSLCGIENLKEDKVGVIPLAGAYIPSANDVVIGIVIVVTPSNWIFDGDSVILRVHKLKTG---QIIKVESVKVPRVIGHGGSMISMLKKETNC-SIFVGQNGRIWIDGKDEDIELLSK. 192
5 -6.480[T] KOG4250 TANK binding protein kinase TBK1  ali follow..  12  46VAVKTACKKLEVAAIGIEIEILKKLKGASNIVQYFGFAMEYASSSLEAEMRPKNHRGLSSNALIDLVVDCSMALSLREHNIAHR--DIKHMN--ILLFPGTPTRGRRSTHLFKLCDMLSENTPNLDPLMAQNRHNWKTKSAYTSEQCDLW 235
6 -5.770[P] COG0226 ABC-type phosphate transport system, periplasmic component  ali follow..  13  108......QFIQGTVDFGASDVAMKDEEIQKVLPVTAGGIVLAYNLPGVTELNL------PRVVYTDILLGKIKTWD--------EIKAANPNVNLPSQPITVVYRSDGSGTTGVFTKHLAAVSPEWKSKVEGKSVSWVGGKGNEGVTA... 246
7 -5.680[R] COG3800 Predicted transcriptional regulator  ali follow..  15  95....WLMPGQRAFQIATQLALVGQSDLISSIVATDDQLST--EARGVARIGLANY--RAAEQLRYDIDLLGRRFGVGFETVCHRLSTLQRGIPFIFVRTKAGNISKRQSATAFHFSRVGGSCPLWVVHDAFAQPERIVRQVAQMPDGRSY 254
8 -5.680[S] COG0799 Uncharacterized homolog of plant Iojap protein  ali follow..  16  49.........................................................DAADHALETVLASLEDSKAEDIVSLDIAGKSALADYMVVVSGRSNRHVSAI--CEHLLKDMKDEGFGNARIEGLEAGDWVVIDAGD....... 132
9 -5.660[R] KOG1675 Predicted cyclin  ali follow..  23  511MDSIGFEVLKSDFGYCVESGWTGRSERLRASEEAAEELKRQSKGDSRAVQREEHQVGLQEKQLKEQCPRLRKCEPVPLCAVLSRNGLKSRNEKADYMGPSASCRSNWKDAED---DRKKEQHPFLKERRKTSTTNWVARYPHQPENLDRW 683
10 -5.470[CO] COG2924 Fe-S cluster protector protein  ali follow..  21  1.................................MARTVFCTRLQKEADGLDFQLYPGLGKRIFDNICKEAWAQWQTKQTMLINE.................................................................. 52

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.