current user: public




Query: ACL93483.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# E-value Template Links and tools%idFirst MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARALELEAYPGFTDAAITEIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPFWKKEHGPEGPRWIEPTARDRTDAQRWDQEALast
1 3.000e-88gi|780126044|ref|WP_045482950.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. StFLB209]  clstr ali  44  1MSVRVQAATFDPGAEVNALHAANRGVGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALGKIGDQARQRWPLLGVEVLHRVGNLEPGEPIVFVGVTSAHRQAAFEACEFIMDYLKTRAPFWKRETTPQGQRWVDGRSSDQQAADRWD... 149
2 8.000e-88gi|739139837|ref|WP_037004721.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas pseudoalcaligenes]  clstr ali  44  1MTIRVQSQPFDPGTELNALHAANLGIGAVVTFVGYVRDFNEGVGGMFLEHFPGMTEKALARIAEEARERWPLLGIEIIHRIGRLEPGEPIVFVGTSSAHRQASFDACNFIMDYLKTRAPFWKKEDTSQGPRWVEGRCSDQSAAERWQRP. 151
3 7.000e-87gi|497209655|ref|WP_009523917.1| molybdenum cofactor biosynthesis protein MoaE [Ralstonia sp. PBA]  clstr ali  43  1MPIRVQTEDFDLGREIAALRAGSPQVGAVASFIGTVRDINDGVSAMELEHYPGMTEKALEQIVAAARQRWEIIDALVIHRVGPLRPLDQIVLVAVTSAHRGEAFAACEFIMDYLKSEAPFWKKEQTPAGARWVDARVSDDAALKRWGIE. 151
4 1.000e-86gi|786211452|ref|WP_045751198.1| molybdenum cofactor biosynthesis protein MoaE [Candidatus Methylopumilus turicensis]  clstr ali  39  1MTVRVQTEDFDVGTEIDALRRISPHIGAVVSFVGQVRDLNDGVASMTLEHYPGMTEKSLASIIEQAQARWAVTDALIIHRVGELKPLDQIVLVLVASAHRKDAFAACEFMMDFLKTEAPFWKKEQTPQGERWVEAKDSDDQARSRWH... 149
5 2.000e-86gi|319743858|gb|EFV96262.1| molybdopterin converting factor, subunit 2 [Lautropia mirabilis ATCC 51599]  clstr ali  43  8..IHVQTQDFDVGAELKRLQALTREVGAVASFVGYVRDQGDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRHRDAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQ... 155
6 2.000e-86gi|498172430|ref|WP_010486586.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. S9]  clstr ali  44  1MSIRVQPDAFDPGDELSRLHAQNLGVGAVVTFVGYVRDFNEGVGGMFLEHFPGMTEKALGKIVDEATQRWPLLKVELIHRIGRLEPGEPIVFVGTSSAHREAAFEACAFIMDYLKTRAPFWKKEDTADGPRWVEGRCSDQQAAQRWKQD. 151
7 2.000e-86gi|501027072|ref|WP_012079173.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium sp. Marseille]  clstr ali  41  1MPVRVQTENFDVSHEVAALRAHSPQVGAVVTFIGTVRDMNDGVAEMELEHYPGMTEKALQNIVEQAKARWPIFDALVIHRIGPLLPLEQIVLVAVTSAHRGEAFSACEFIIDYLKTDAPFWKKEQTPQGARWVDARTTDDTALAKWKQPS 152
8 3.000e-86gi|498494624|ref|WP_010795360.1| molybdopterin synthase catalytic subunit [Pseudomonas sp. HPB0071]  clstr ali  51  1MTIRVQAEAFDPGVETSAMHAANVGVGAVVTFIGYVRDFNDGVSGLYLEHFPGMTEKSLAKIAQEANSRWPLLKVDIIHRVGRLEPGEPIVFVGTASAHRQAAFEACAFIMDYLKTRAPFWKKEDTPQGPRWVEGKSSDISAAQRWK... 149
9 3.000e-86gi|558878730|ref|WP_023534283.1| moaE family protein [Pseudomonas putida]  clstr ali  46  1MAVRVQEGAFDPGVETNALHAANVGVGAVVSFIGYVRDFNDGVAGMMLEHYPGMTEKALAKIVDEAQQRWPLLKVEVLHRVGYLAPGEPIVFVGVASAHRQASFEACNFIMDYLKTRAPFWKKETTGQGDRWVEGRQSDQDAAGRWGQSG 152
10 3.000e-86gi|490764300|ref|WP_004626536.1| molybdenum cofactor biosynthesis protein MoaE [Ralstonia pickettii]  clstr ali  44  1MSVRVQEADFDLGAEIAALRAGRPNIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALADIVSAAMQRWELIDALVIHRVGKLKPQDQIVLVAVASKHRGESFAACEFIMDYLKSEAPFWKKEQTPEGARWVDARVTDDKALARWGIA. 151
11 6.000e-86gi|860301571|ref|WP_048368232.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas helleri]  clstr ali  44  1MAIRVQTTAFDPGAEVNALHAANLGVGAVVSFVGYVRDFNDGVAGMFLEHYPGMTEKALAKIVVEAQHRWPLLSLEVLHRVGALEPGEPIVFVGVASAHRQAAFDACAFVMDYLKTRAPFWKKEHTADGPRWVEGRASDDAAAKRWQRS. 151
12 2.000e-85gi|493627723|ref|WP_006579783.1| molybdopterin biosynthesis protein E [Cupriavidus sp. HPC(L)]  clstr ali  46  1MSVRVQREDFDLGAEVAALRAGRPGVGAVASFIGTVRDVNDGVQAMELEHYPGMTEKALERIEAVARERWALDGVTIIHRVGPLQPQDQIVLVAVASAHRGNAFAACEFIMDYLKSEAPFWKKESTPDGARWVDARVTDEAALARWGVRS 152
13 2.000e-85gi|516020402|ref|WP_017450985.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum]  clstr ali  39  1MPVRVQTADFDLSTEVAQLRLSNPRVGAVVSFVGTVRDLNEGVSAMELEHYPVMTERALEQIVQQAKARWPIFEALVIHRVGPLQPCEQIVLVAVTSPHRGEAFAACEFIMDYLKTQAPFWKKEQTPQGARWVDARESDDTALAKWTQQ. 151
14 3.000e-85gi|517970511|ref|WP_019140719.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum massiliense]  clstr ali  39  1MPIRVQTEDFDLSTEVARLRAGNPAIGAVASFIGTVRDVNDGVTGMELEHYPGMTEKALEAIVEQARQRWRVIDALVIHRVGPLKPLDQIVLVAVASAHRGDAFAACEFIMDFLKTQAPFWKKEQTAQGARWVDARVADDKALARWGENS 152
15 3.000e-85gi|654858854|ref|WP_028311182.1| molybdenum cofactor biosynthesis protein MoaE [Derxia gummosa]  clstr ali  46  1MPVRVQTEDFDLGAEIAALRAGDPCVGAVATFLGTVRDANGEVRELVLEHYPGMTEKSLEAICAEARGRWDLLDILVIHRVGPLRPTDQIVLVAVTSAHRGEAFAACEFVMDYLKTRAPFWKKERTPDGERWVEARDSDDSAADRW.... 151
16 3.000e-85gi|736751444|ref|WP_034755053.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium lividum]  clstr ali  40  4.TVRVQQADFDLSQEIAQLRAGNPKVGAVVGFVGTVRDMNEGVAAMELEHYPGMTEKSIETIVEQARGRWPLSGALVIHRVGPLLPQEQIVLVAVSSAHRGEAFAACEFIIDYLKTEAPFWKKEDTPEGARWVDARDSDETALDKWAAKA 154
17 3.000e-85gi|963316717|ref|WP_058379025.1| molybdenum cofactor biosynthesis protein MoaE [Pandoraea norimbergensis]  clstr ali  39  1MPIRVQTEDFDLSAEIRQLRAGDLRVGAVASFVGTVRDLNDGVSRMTLEHYPGMTEKALEQIVAQASERWRLFDALVIHRYGDLGPGDQIVLVAVTSAHRGDAFAACEFIMDYLKTEAPFWKKESTPQGERWVDARDTDTAARERW.... 148
18 7.000e-85JCVI_PEP_1096690715751 /source_dna_id=JCVI_ORF_1096690715750 /offset=0 /translation_table=11 /length=183 /full_length=183  ali  43  10MSVRVQEADFDLGAEIAALRAGRPNIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALAGIVSAAMQRWELIDALVIHRVGKLKPQDQIVLVAVASKHRGESFAACEFIMDYLKSEAPFWKKEQTPQGARWVDARVTDDKALVRWGIAS 161
19 7.000e-85gi|913710495|ref|WP_050462207.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum autotrophicum]  clstr ali  36  1MPIRVQTADFDLAAEIAQLRRNDPGIGAVVSFVGTVRDINDGVATMELEHYPGMTEKALQQIVADAKTRWDICDALVIHRVGPLLPLDQIVLVAVTSRHRGTAFAACEFIIDYLKTEAPFWKKEQTPEGARWVDARDSDAQALDKWKPAG 152
20 8.000e-85gi|953981831|ref|WP_058066726.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. TTU2014-080ASC]  clstr ali  44  1MSVRVQPHAFDPGVELNALHADNLGIGAVVSFVGYVRDFNDGVGGMFLEHFPGMTEKALNKIIAEAQQRWPLLKVDVIHRIGRLEPGEPIVFVGTCSAHRLAAFEACHFIIDYLKTRAPFWKKEDTANGPRWVEGRNSDQAAADRWR... 149
21 9.000e-85gi|736178008|ref|WP_034295156.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum sp. RV1423]  clstr ali  38  1MPIRVQTADFDLSAEIAALRLSNPKVGAVVSFVGTVRDLNDGVQEMELEHYPGMTEKALEQIVVDARARWDIFDALVIHRVGPLKPLEQIVLVAVTSKHRGEAFAACEFIMDFLKTQAPFWKKEQTPEGARWVDARESDDHALSKW.... 148
22 9.000e-85gi|653577431|ref|WP_027591052.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Pseudomonadaceae]  clstr ali  46  1MSVRVQTASFDPGAELNALHAAQLGIGAVVGFVGYVRDYNDGVAGMYLEHYPGMTEKALAKIVTEAEARWPLLQVEVLHRVGALTPGEPIVFVGTASAHRQAAFAACDFIMDYLKTRAPFWKREDTAEGARWVEGRDSDQQAAARWDQ.. 150
23 9.000e-85gi|499934847|ref|WP_011615581.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Cupriavidus]  clstr ali  47  1MSVRVQREDFDLGAEVAALRAGNPAVGAVASFIGTVRDVSDGVSAMELEHYPGMTEKALAQIEAAACARWALLGVTIIHRVGPMQPLDQIVMVAVASAHRGNAFAACEFIMDYLKSEAPFWKKEDTPEGARWVDARVTDEAALQRWGIAS 152
24 1.000e-84gi|512439510|ref|WP_016415330.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas anticariensis]  clstr ali  49  1.MIRVQHEPFDPGREQRALIQGRSDIGAVVSFTGLVRDFNERVEALTLEHYPGMTESALTDIVKEAESRWPLQGVCVIHRVGRLTPGDPIVLVVVASAHRREAFEACDFIMDYLKTRAPFWKKEHTSSGHYWVAERASDQRDARRWEEP. 150
25 1.000e-84gi|736831546|ref|WP_034832933.1| hypothetical protein [Endozoicomonas numazuensis]  clstr ali  44  1.MISIQQEDFDPGSEQDQLS-SNCGTGALVTFTGLVRDEGDDVGGLYLEHYPGMTEKALQAIIDEAAERWPLQAIKVIHRVGQLHPGDRIVFVGVASAHRKAAFEICEFVMDYLKTRAPFWKKETTAEGDRWVDARESDEEAAKRWGQE. 149
26 1.000e-84gi|340552761|gb|AEK62136.1| Molybdopterin converting factor subunit 2 [Collimonas fungivorans Ter331]  clstr ali  36  3MPIRVQAEDFDFAAELAQLRLSNPKIGAVVSFLGTVRDLSDGVAQMELEHYPGMTEKALSAIIDQAKQRWEIFDALVIHRIGPLLPLDQIVLVAVSSAHRGDAFAACEYIIDYLKTEAPFWKKEHTEQGARWVDARSTDDEALAKWEQDA 154
27 2.000e-84gi|545464537|ref|WP_021701145.1| molybdopterin synthase catalytic subunit [Pseudomonas alcaligenes]  clstr ali  48  1MAVRVQVEAFDPGVEVNALHAANLGIGAVATFIGYVRDYNDGVRGMFLEHYPGMTEKALAGIIGEAEQRWPLLRVEVLHRVGRLQPGEPIVFVGIASAHRQAAFDACNFIMDYLKTRAPFWKKEDTPEGARWVEGRDSDQDAAARWSRS. 151
28 2.000e-84gi|490372462|ref|WP_004252066.1| molybdopterin biosynthesis protein MoaE [Thauera sp. 63]  clstr ali  43  10.SVSVQQADFDVGGEIAALSEGRRDVGAIASFVGLVRDLNDGVSAMTLEHYPGMTEKALEEIVEQARQRWSLQGVRVIHRFGRLEPADRIVFVGVASPHRGEAFAACEFIMDYLKTRAPFWKCEETPGGARWVDARESDDSAAARWQDR. 159
29 2.000e-84gi|802109494|ref|WP_046028125.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas fluorescens]  clstr ali  42  1.MIRVQTAGFDPGAEINALQASSMSVGAVVSFVGYVRDFNAGVDGMFLEHYPGMTEKALGKIADEARQRWSLLGLVLIHRVGELLPGEPIVFVGVSSAHRQAAFDACAFVMDYLKTRAPFWKKEQVADRSQWVEARDSDREAAQRWDR.. 149
30 2.000e-84gi|515797576|ref|WP_017228373.1| molybdenum cofactor biosynthesis protein MoaE [Cupriavidus basilensis]  clstr ali  45  1MSVRVQQEDFDLGAEVAALRRGQPGVGAVASFVGTVRDVNDGVSAMELEHYPGMTEKALARIEAVARERWELLGVTIVHRVGPLLPLDQIVLVAVASAHRGTAFAACEFIMDYLKSEAPFWKKEQTPEGARWVDARVTDESALARWGVRS 152
31 3.000e-84gi|748791619|ref|WP_040039630.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum sp. TSA66]  clstr ali  38  1MTIRVQTQDFDLGAEVAQLRGGDARVGAVVSFVGTVRDMNDGVSEMELEHYPGMTEKALEDIVAKAKARWNIFDALVIHRVGPLKPLDQIVLVAVTSAHRGEAFAACEFVMDYLKTQAPFWKKEQTAQGARWVDARVADDQALTKWGVSS 152
32 4.000e-84gi|759390699|ref|WP_043115994.1| molybdenum cofactor biosynthesis protein MoaE [Solemya velum gill symbiont]  clstr ali  44  4.SVRIQHEDFDIGAEIRHFQQSRTEIGAVATFTGLVRDLNDKVSSMTLEHYPGMTEKSLQEILEQAIERWQLIDAMVIHRVGKLLPGDQIVFVTTASAHRGDAFSACEFIMDYLKTQAPFWKKEETASGSRWVDARETDSDAAERWK... 151
33 4.000e-84JGI.Meta 7062523745 SRS017227_Baylor_scaffold_27253__gene_31941 moaE protein [Human Supragingival plaque microbiome from visit number 1 of s  ali  42  53.HVCVQTGDFDVGAELRRLQRLTLETGGVASFVGYVRDQGDTIGGLTLEHYPGMTERSLERICAQAEARWPLLGVTVIHRVGPLAPGDQIVLVATASRHRDAAFESCRFIMDYLKTEAPFWKKESTPDGERWVDARDSDEAARRRWEQ.. 201
34 4.000e-84gi|821538341|ref|WP_046860221.1| molybdenum cofactor biosynthesis protein MoaE [Sedimenticola thiotaurini]  clstr ali  41  4..IKIQTEPFDLTAIQEEMRRQNPAIGAVVTFLGQMRDEGDQVTTMTLEHYPGMTEKALQAIVDEANERWQLLGIRVVHRVGPLQPLDPIVLVAVASAHRGEAFQACEFIIDYLKTRAPFWKKEQTPEGERWVDARHTDEQAEQRWKRAG 153
35 4.000e-84gi|506312188|ref|WP_015831963.1| molybdenum cofactor biosynthesis protein MoaE [Methylotenera mobilis]  clstr ali  40  1MTVRVQTADFDIGAEINQLRQARKNVGAVVSFVGLVRDLNDGVSQLTLEHYPGMTEKSLAAIIEQAKNRWSIMDALIVHRVGTLQPSDQIVLVIVTSAHRGDAFSACEFMMDYLKTEAPFWKKEANSTGEHWIEAKSADDTARDRWNIE. 151
36 5.000e-84gi|746502800|ref|WP_039540023.1| molybdopterin synthase catalytic subunit [Vibrio vulnificus]  clstr ali  39  4.RISVQVEDFDIAAEYAWLSQGSA-AGAVVTFVGKVRDMGDNVTGLSLEHYPGMTEKALGEICDQAEQRWPLLNVRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTGTTRWVESRESDAQAAERWQ... 150
37 5.000e-84gi|950254425|ref|WP_057290944.1| molybdenum cofactor biosynthesis protein MoaE [Noviherbaspirillum sp. Root189]  clstr ali  40  1MAVRIQTEDFDLSREVAALRAGQAQVGAVVSFVGTVRDINDGVSEMELEHYPGMTEKALEDIVDQAKTRWTIIDALVIHRVGPLKPLDQIVLVAVTSAHRGEAFSACEFIMDYLKTEAPFWKKEQTPDGARWVDARVTDDRALAKWGIAS 152
38 5.000e-84gi|647646214|ref|WP_025918140.1| molybdenum cofactor biosynthesis protein MoaE [Herminiimonas sp. CN]  clstr ali  40  1MPVRIQTEDFDLTTEVSQLRVANPKVGAVVAFVGTVRDLNDGIASMELEHYPGMTEKALEEIVQQARSRWVFFDALVIHRVGPLAPLDQIVLVAITSAHRGEAFAACEFIMDYLKTAAPFWKKEQTPNGARWVDARESDDQALAKWGISS 152
39 5.000e-84gi|518547882|ref|WP_019718089.1| molybdopterin synthase catalytic subunit [Ralstonia solanacearum]  clstr ali  43  3.TIRVQEADFDLGAEIAALRAGRPQIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALANIVDAAMQRWDLIDALVIHRVGKLRPEDQIVLVAVASGHRGEAFAACEFIMDYLKSEAPFWKKEQTAQGARWVDARVTDERALARWG... 150
40 5.000e-84gi|653585552|ref|WP_027598488.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. MOIL14HWK12:I2]  clstr ali  46  1MAIRVQAAAFDPGQELNALHAANTGIGAVVGFVGYVRDFNDGVGGLFLEHFPGMTEKALARIVEEAKQRWPLLGVDILHRVGRLEPGEPIVFVGTASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGPRWVEGRASDQDAAGRWAKE. 151
41 6.000e-84gi|740705228|ref|WP_038490517.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium agaricidamnosum]  clstr ali  43  4..VRIQTDDFDLSSEVARLRAGQPQVGAVVTFVGTVRDMNDGVSEMELEHYPGMTEQAITAIVEQAKQRWPLYGALVIHRVGPLKPLEQIVLVATSAAHRGEAFAACEFIIDYLKTEAPFWKKEQTPQGARWVDARVSDDIALSKW.... 149
42 8.000e-84gi|835517105|ref|WP_047537337.1| molybdenum cofactor biosynthesis protein MoaE [Methylotenera versatilis]  clstr ali  42  1MTVRIQTEDFDVGLLLNQLRLANPGAGALVSFVGQVRDDGDSISTLTLEHYPGMTESALAAIKAEASTRWDLMDSLIIHRVGTLKPLDQIVLVAVLSAHRGEAFKACEFMMDYLKTQAPFWKKEITPEGARWIDAKLSDDAALKRWNK.. 150
43 8.000e-84gi|498314166|ref|WP_010628322.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. KM-1]  clstr ali  48  1.MIRVQEAPFDAGVEQQRLLADRSDIGAVVSFTGLVRDFNEDVTALTLEHYPGMTEAALGEIVNQAEARWSLQGVRVIHRVGRLTPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHSITGDYWVAERESDYRDASRWESE. 150
44 8.000e-84gi|860333154|ref|WP_048383563.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas taetrolens]  clstr ali  47  1MTVQVQTELFDLGELTRSLHAEDPGVGAVATFVGYVRDQGDQVSELFLEHYPGMTERSLQQIIDQAHQRWPLQRVTIVHRVGALKVGEPIVFVGVASEHRQEAFDACNFLMDYLKTRAPFWKREHTPSGERWVEGRESDQLAVNRW.... 148
45 9.000e-84gi|504003220|ref|WP_014237214.1| molybdenum cofactor biosynthesis protein MoaE [Azospira oryzae]  clstr ali  42  1MSVRVQQEDFDLSAEVAALRAGQPGVGAVAAFVGLVRDMNEGVSEMALEHYPGMTEKALEAIVAEARARWDILGARIIHRVGTLQPCDQIVLVAVSSAHRGEAFAACEFIMDYLKTRAPFWKREVTPAGARWVDARETDDSAAARWEKGG 152
46 1.000e-83gi|501368777|ref|WP_012400343.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia phymatum]  clstr ali  40  1MTVRVQTEDFDLSTEVAALRAQNPKVGAVACFVGTVRDEGETVETMELEHYPGMTEKSLEAIVDAARERWPGTEVLIVHRVGKLQPLDQIVLVATTSKHRGNAFASCEFVMDYLKTQAPFWKKEKTESGERWVDARVADEQALARWGLES 152
47 1.000e-83gi|503556070|ref|WP_013790146.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas fulva]  clstr ali  44  1MGIRVQQAVFDPGLETNAVHAANTGVGAVACFVGYVRDFNDGVAGMFLEHFPGMTEKALAGIESQARERWPLLGVEVIHRVGRLEPGEPIVFVGVASAHRQAAFQACEFIMDYLKTRAPFWKKEDTPSGPRWVEGRDSDQASARRWQADS 152
48 1.000e-83gi|519012700|ref|WP_020168575.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Methylotenera]  clstr ali  38  1MSIQVQTEDFDVGLLLNQLRLANPSAGALVSFVGQVRDMNDGVNTLTLEHYPGMTETALAAIETQAHARWNLIDTLVIHRVGTLKPLDQIVLVAVLSAHRGEAFKACEFIMDYLKTQAPFWKKEITPTGERWVDAKLSDDESLEKWSK.. 150
49 1.000e-83gi|490886456|ref|WP_004748425.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio tubiashii]  clstr ali  41  4.RVSVQFEDFSVGSEYEALAQG-TSAGAVVTFTGKVRDMGDNVTGLSLEHYPGMTEKALGEICNEAEQRWPLLNIRVIHRVGDLDIGDQIVFVGVSSAHRGAAFEACEFVMDYLKTKAPFWKKERTTESTRWVDSRDSDAKAAERWQQKS 153
50 1.000e-83gi|921157132|ref|WP_053103228.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [unclassified Pseudomonadaceae]  clstr ali  44  1MQISVQTDAFDAGQLLNQMQAKQLGIGAVASFVGYVRDYNQDVSELLLEHYPGMTEKALEKIVEQAEQRWPLLRVKVVHRVGLLGLGEPIVFVAVASAHRQAAFAACEFIMDYLKTRAPFWKKEHTEQGARWVDGRDSDQQAAARWTEKS 152
51 1.000e-83gi|496497410|ref|WP_009205946.1| molybdenum cofactor biosynthesis protein MoaE [Sulfuricella denitrificans]  clstr ali  40  1MEVRIQTEDFDLGAEILNLRRGNPGIGAVASFVGLVRDLNHSVTEMTLEHYPGMTEKALAEIMGEAKQRWNIIGALVIHRIGPLKPTDQIVLVAVSSAHRGDAFAACEFIMDYLKTRAPFWKKEQTEAGAHWVDARESDETAAQRWTAP. 151
52 2.000e-83gi|515528283|ref|WP_016961500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio norvegicus]  clstr ali  40  1.MISVQHEDFSLAEEYQRLN-DSDSDGAIVTFIGKVRDMGDNVTGLTLEHYPGMTEKSLNEIVLQAKQRWPLTHIRVIHRVGALNIGDQIVFVGVTSAHRNAAFEACEFIMDYLKTRAPFWKKERLNDDERWVEARESDDTAANRW.... 146
53 2.000e-83gi|546180324|ref|WP_021821045.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas huangheensis]  clstr ali  46  1.MIKVQYEPFDAGQEQQSLLAGRTDIGAVVSFTGLVRDFNEDVEALTLEHYPGMTEASLVQIADEAHQRWSLSGLTLIHRVGRLAPGDPIVLVIVASEHRRAAYEACEFLMDYLKTRAPFWKKEHTASGDYWVSEREQDHADAQRWE... 148
54 2.000e-83gi|985874973|gb|KXB31977.1| molybdenum cofactor biosynthesis protein MoaE [Dechloromonas denitrificans]  clstr ali  42  1MKVRVQEADFDVGAELAALRAGDARVGAQASFLGLVRDLNDGVSEMTLEHYPGMTEKALEEIVAQAKGRWEIYDALVIHRVGPLKPCDQIVLVAVTSAHRGEAFAACEFIMDYLKTRAPFWKREATPDGGRWVDARETDDSAAARWEKHA 152
55 2.000e-83gi|552548479|ref|WP_023006460.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. PBN3]  clstr ali  48  1.MIRVQQAPFDAGEEQRALLAGRTDIGAVVSFTGLVRDFNERVAALTLEHYPGMTEAALAAIVDEARERWPLDGVSVIHRVGRLAPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHASDGDYWVSERDSDHADARRWE... 148
56 2.000e-83gi|495387736|ref|WP_008112439.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum sp. YR522]  clstr ali  40  1MPVRVQTADFDLSTEVARLRLANPGVGAVVTFLGTVRDLNEGVSTLELEHYPAMTERALQQIVDQARARWPIFDALVIHRVGPMQPQEQIVLVAVTAPHRGEAFAACEFIMDYLKTQAPFWKKEQTPDGARWVDARESDDIARDKW.... 148
57 2.000e-83gi|502912950|ref|WP_013147926.1| molybdenum cofactor biosynthesis protein MoaE [Methylotenera versatilis]  clstr ali  42  1MTVRVQTQDFDAGFEISLLRNARKDTGAVVSFIGQVRDEGDTVSQLTLEHYPGMTEKALEAIVNQAQSRWDIFDAIVIHRVGILQPTDQIVLVAVSSAHRGEAFKACEFIMDYLKTEAPFWKKEVTSQGERWVDAKLTDDDARERWK... 149
58 3.000e-83gi|491911942|ref|WP_005666787.1| molybdopterin synthase catalytic subunit [Massilia timonae]  clstr ali  40  4..VRVQAGDFDLGQEVARLRANDARIGAVVSFVGTVRDLNDGVSEMELEHYPGMTEKSLEAIAARACERWPLYGTLVIHRVGPLAPLDQIVLVACSAAHRGDAFAACEFIMDYLKTEAPFWKKEQTPDGARWVDARVTDDSAKARWEAP. 152
59 3.000e-83gi|495338036|ref|WP_008062772.1| molybdenum cofactor biosynthesis protein MoaE [Methyloversatilis universalis]  clstr ali  44  3VSVSVQQADFDIGAEIDALLAGRTDVGAVATFTGLVRDINDGVHAMTLEHYPGMTEAALEDIVAQAKARWDILAVRVIHRVGTLQPADRIVLVIVAGSHRGEAFSACEFIMDYLKTRAPFWKREDTPDGSRWVDARDSDDSAAQRWMQQG 154
60 3.000e-83gi|505234450|ref|WP_015421552.1| molybdopterin biosynthesis protein MoaE [beta proteobacterium CB]  clstr ali  39  6..IRIQEQDFDLTSEVKALRKDDPRVGAVVTFVGTVRDMNDGVKGMTLEHYPGMTEKSLEVIIKQARSRWDLYKTLVIHRVGPLLPEDQIVLVAVTSAHRGEAFAACEFIMDYLKTAAPFWKKEDTPEGSKWVDARVTDDAAMARWN... 152
61 3.000e-83gi|519208746|gb|EPM92880.1| molybdenum cofactor biosynthesis protein E [Pseudomonas syringae pv. actinidiae ICMP 19070]  clstr ali  44  1MTIRVQAAAFDPGTEVNALHAANLGIGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALAKIVEEAEQRWPLLRLDVLHRVGALEPGEPIVFVGVASAHRQAAFEACDFVMDYLKTRAPFWKKENTSQGPQWVEGRDSDQAA........ 144
62 3.000e-83gi|517436410|ref|WP_018607297.1| hypothetical protein [Uliginosibacterium gangwonense]  clstr ali  40  1MSVSVQHTDFDLDAETAHLASVSHNVGAVATFLGYVRGD-DALAAMTLEHYPGMTEKSLADIVSQAQARWPLLAVRVIHRIGRLLPGERIVFVGVASRHRGAAFDACEFIMDYLKTRAPFWKKEETEQGARWVDARDSDESALEKWGK.. 147
63 3.000e-83gi|655154603|ref|WP_028601281.1| molybdenum cofactor biosynthesis protein MoaE [Ottowia thiooxydans]  clstr ali  43  4VRVSIQTEDFNLSEEVAALRANDARVGAVCAFVGTVRDRNDGVGSLELEHYPGMTEKSIEAMVSEALERFDLFGVRIIHRVGLLAPQDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEETPEGSRWVDARSSDDAALARWGIKA 155
64 3.000e-83gi|503207844|ref|WP_013442505.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Methylovorus]  clstr ali  40  1MTIRVQADDFDVGAEINRLRQQRPDIGAVAAFVGQVRDQGDAIAGMTLEHYPGMTEKSLEAIVQQAKARWDIMDAVVIHRIGELKPLDQIVLVAVAGAHRGEAFHACEFIMDYLKTEAPFWKKEQTPEGERWVDARSSDDAARARWQDA. 151
65 4.000e-83gi|654304729|ref|WP_027818359.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia bannensis]  clstr ali  40  1MPVRVQTEDFDLSTEVAQLRAHNPSIGAVACFVGTVRDLNDGVAGMELEHYPGMTEKALEAIVTQAQQRWPGIDVLIVHRVGKLALLDQIVLVATTSKHRGDAFASCEFVMDYLKTEAPFWKKEETEHGARWVDARTSDDAALARWGVKS 152
66 5.000e-83gi|935649076|ref|WP_054488674.1| hypothetical protein [Idiomarina abyssalis]  clstr ali  42  3ISVRVQQEDFDLATEYQRL-AQNKQCGAVVTFTGLVRDSEGGLRGLELEHYPGMTEKALTDIVEEAQKRWDLRGVTVIHRVGYLSLNEQIVMVAVASGHRQAAFSAASFIMDYLKTQAPFWKKEHTEEGEHWVEAKQSDQQAAEQWSQQ. 151
67 5.000e-83gi|746386984|ref|WP_039429894.1| molybdopterin synthase catalytic subunit [Vibrio navarrensis]  clstr ali  40  4.RVSVQLEDFDLATEYAQLAQGSA-AGAVVTFVGKVRDMGDKVIGLSLEHYPGMTEKSLSEICDQAQTRWPLLSVRVIHRVGDLALGDQIVLVGVSSAHRSAAFEACEFIMDFLKTKAPFWKKEITTDQTRWVESRESDNKAAQRWHSS. 152
68 5.000e-83gi|835544717|ref|WP_047549126.1| molybdenum cofactor biosynthesis protein MoaE [Methylotenera sp. G11]  clstr ali  42  1MTVRVQTEDFDAGFEINQLRRARRDVGAVVSFIGQVRDEGDEVSQLTLEHYPGMTEKSLEAIIAQARTRWNIMDVLIIHRVGTLQPCDQIVLVAVSGGHRGEAFAACAFVMDYLKTEAPFWKKEVTQSGERWVEAKTSDDEARERWDKA. 151
69 5.000e-83gi|171192760|gb|ACB43721.1| molybdopterin biosynthesis MoaE protein [Polynucleobacter necessarius subsp. necessarius STIR1]  clstr ali  35  25MSIRIQEGDFDLSFEIASLRKGDPRVGAAVAFLGTVWDMNDGIKGMTLEHYPGMTEKSLQEILDQAKARWDIYHTLVIHRIGSLLPEDQIVLVAVTSAHRGEAFAACEFIMDYLKTAAPFWKKEDTPDGARWVDARVTDEAAMARWKK.. 174
70 6.000e-83gi|749662081|ref|WP_040261256.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. CB1]  clstr ali  45  1MAVRVQRIAFDPGAELNGVHQRQLGVGAVASFTGYVRDFNDGVAGLFLEHYPGMTEKALEKIVVEAQGRWPLLNVEVLHRIGELAPGEPIVFVACASAHRQAAFQACEFIMDYLKTRAPFWKRETTPEGSRWVEGRQSDQDSAERW.... 148
71 7.000e-83gi|947734591|ref|WP_056396731.1| molybdenum cofactor biosynthesis protein MoaE [Massilia sp. Root418]  clstr ali  38  8..VRVQAEDFDVAAEVAQLRAGNARVGGIVTFVGTVRDLNEGVAEMELEHYPGMTEQSIETIIEQAKARWPIYGALVIHRIGPLKPTEQIVLVAVTSAHRGEAFAACEFIIDYLKTEAPFWKKEQTPDGARWVDARVSDDAALKKW.... 153
72 7.000e-83gi|545467332|ref|WP_021703833.1| molybdopterin synthase catalytic subunit [Vibrio proteolyticus]  clstr ali  40  4.RVSVQQQDFSVGDEYQRLALGSA-AGAVVTFVGKVRDMGDNVTGLSLEHYPGMTEKSLLNICDQAEQRWPLLHTRVIHRVGDLDIGDQIVFVGVVSAHRGAAFEACEFIMDYLKTQAPFWKKERTTNQTRWVESRDSDTQAAKRWQK.. 151
73 8.000e-83gi|668956245|gb|KFC74889.1| Molybdopterin synthase catalytic subunit [Massilia sp. LC238]  clstr ali  41  16..IRVQEADFDLSRELAALRAGDGRVGAVVSFVGTVRDLNEGVSEMELEHYPGMTEKALEEIVAQARARWPLFGVQVIHRVGPLKPLDQIVLVACSSAHRGEAFAACEFIMDYLKTDAPFWKKEQTPEGARWVDARASDDSAKRKWAEA. 164
74 8.000e-83gi|516564861|ref|WP_017940047.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas thermotolerans]  clstr ali  47  1MAIRVQSETFDPGLELNALHAANRGIGAVVGFVGYVRDFNDGVAALFLEHAPGMTEKALARIVAEAEQRWPLLGVEVLHRVGHLQPGEPIVFVGTASAHRQAAFEACNFIMDYLKTRAPFWKKEDTPEGPRWVEGRDSDLAAAERWRR.. 150
75 8.000e-83gi|1001918004|gb|KXS39069.1| molybdopterin synthase catalytic subunit [Halomonadaceae bacterium T82-2]  clstr ali  45  1.MIRVQTAPFDAGAEQAALTAQRRDIGAVVCFTGLVRDFNERVSALTLEHYPGMTEKALADIVAEAESRWPLNGVRLIHRVGRLAPGDPIVLVAVASAHRLAAFEACHFIMDYLKTRAPFWKKEHTAEGDYWVAERTTDHDAARRWEAS. 150
76 8.000e-83gi|517332721|ref|WP_018508213.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus thioparus]  clstr ali  47  1MKILVQSEAFELGAEVDALRRGRTDIGAIASFVGLARDMNDGVAAMTLEHYPGMTEKALAALVEEAQSRWTLLDVTLIHRVGRLLPGDPIVLVAVAGSHRGEAFAACEFIMDYLKTRAPFWKKEVTPEGERWVEARASDDVAATRWGK.. 150
77 9.000e-83gi|515577318|ref|WP_017010076.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio calviensis]  clstr ali  40  1.MISVQRDDFSVAEEYQWLN-DNASDGAVVTFVGKVRDMGDNVTGLTLEHYPGMTEKSLEEICNDAKTRWPLGKVRVIHRVGALNLGDQIVFVGVSSAHRKAAFDACEFIMDFLKTRAPFWKKEKLVDDERWIEARDSDDEAANRW.... 146
78 9.000e-83gi|551344449|ref|WP_022963861.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas pelagia]  clstr ali  41  1MAITVQTASFDPGAMLNRLHAQQLGVGAVVGFTGYVRDFNDGVAGMLLEHYPGMTEKALQIIVDEAQGRWPLLSVEVLHRVGRLEPGEPIVFVGVSSAHRAAAFDACQFIMDYLKTRAPFWKKEDSADGPRWVDARDSDSQALDKWR... 149
79 1.000e-82gi|654355686|ref|WP_027848144.1| hypothetical protein [Marinospirillum minutulum]  clstr ali  43  7..VSVQSKVFDLNQETQALIKGRSDLGALVTFTGYVRDFNEDVLALTLEHYPGMTEQALKAILQEAEQRWALKGTRIIHRIGRMEPSDPIVLVATSSAHRQDAFDACNFIMDYLKTRAPFWKKEHTLTGDYWVSARTSDTQAAERWK... 153
80 1.000e-82gi|917365439|ref|WP_051972151.1| molybdenum cofactor biosynthesis protein MoaE [Massilia sp. 9096]  clstr ali  40  15..VRVQAADFDLGAELARLRAGDARVGAVVSFVGTVRDMNDGVAELELEHYPGMTERSLEDIVAQARARWPLYGALVIHRIGPMKPMEQIVLVAVSAAHRGEAFAACEFIMDYLKTDAPFWKKEQTPGGARWVDARTSDDSAKAKW.... 160
81 1.000e-82gi|942688501|ref|WP_055393178.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. SD340]  clstr ali  37  5.RVSIQTEDFDLSTEVAALRRENKGIGAVCSFVGTVRDEGDQVSSMELEHYPGMTEKSIEAMVDEAFRRFDIFGARVIHRVGLLQPLDQIVLVVVTSAHRGQSFQACEFLMDYLKTQAPFWKKEETAQGARWVDARVSDDAALARWGIVA 155
82 1.000e-82gi|913424237|ref|WP_050407128.1| molybdenum cofactor biosynthesis protein MoaE [Massilia sp. NR 4-1]  clstr ali  38  4..VRIQTDDFDVAGELAGLRAGDARVGGIVSFVGTVRDLNEGISSMELEHYPGMTEQSIQAIIDQARQRWPLYGALVIHRVGPLRPMDQIVLVAVTSAHRGEAFAACEFIIDYLKTEAPFWKKEETPEGARWVDARVSDDQALRKW.... 149
83 1.000e-82gi|930019999|ref|WP_054124139.1| molybdenum cofactor biosynthesis protein MoaE [beta proteobacterium AAP99]  clstr ali  49  1MSVRVQIEDFDLGVEVAAMRAGRTDIGGIASFIGTVRDEGDAVSTLTLEHYPGMTEGALQGIVEEAHRRFELLDARVIHRVGRLAPGDQIVLVITASGHRGEAFAACEFLMDYLKTRAPFWKKEVTPDGERWVDARERDDEAAARWSSA. 151
84 1.000e-82gi|1011000119|ref|WP_061958234.1| molybdenum cofactor biosynthesis protein MoaE [Cupriavidus pauculus]  clstr ali  45  1MTVRVQLADFDLGAEVAALRADNRGVGAVASFIGTVRDVSDGVSTMELEHYPGMTEKALEKIEAAARARWPLLGVTIVHRVGLLAPLDQIVLVAVASAHRGSAFAACEFIMDYLKSEAPFWKKEVTPDGAKWVDARVSDDAALRRWGIES 153
85 1.000e-82gi|500232694|ref|WP_011902287.1| molybdenum cofactor biosynthesis protein MoaE [Polynucleobacter necessarius]  clstr ali  39  6..IRIQEQDFDLSAEIVALRKGDARVGAVVSFLGTVRDLSDGVKGMTLEHYPGMTEKSLQAILDQAATRWNIFQTLVIHRVGLLLPEDQIVLVAVTSAHRGEAFSACEFIMDYLKTAAPFWKKEDTPEGSRWVDARVTDETAMARWNKS. 154
86 2.000e-82gi|497206393|ref|WP_009520655.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Hydrogenophaga]  clstr ali  38  6.RVSIQTADFDLSTEVARLREQDKGVGAVCSFIGTVRDRNDGVSAMELEHYPGMTEKAVEAMIDEAFRRFQILGARVIHRVGPLQPLDQIVLVVVSSAHRGQSFQACEFLMDYLKTQAPFWKKEETPEGARWVDARVSDDAALARWGIQA 156
87 2.000e-82gi|947489657|ref|WP_056153881.1| molybdenum cofactor biosynthesis protein MoaE [Duganella sp. Leaf126]  clstr ali  40  11..VRIQTEDFDLTTEVARLRAANPKIGAVVTFVGAVRDLNDGVAELELEHYPGMTEQAIAAIIDQARQRWPTFGALVIHRVGPLKPLDQIVLVAATAAHRGEAFAACEFIIDYLKTEAPFWKKEATPDGARWVDARVSDDAALAKWQGSA 160
88 2.000e-82gi|516387084|ref|WP_017776760.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia kururiensis]  clstr ali  42  1MTVRVQTEDFDLSAEVAALRAQNPRIGAVACFVGTVRDEGSGVEAMELEHYPGMTEKALADIVDAARDRWRGVDVLIVHRVGKLYPLDQIVLVATTSAHRGDAFASCEFVMDYLKTQAPFWKKEKTAAGECWVDARESDDAALARWGIKS 152
89 2.000e-82gi|852215773|ref|WP_048307038.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. PR-M31]  clstr ali  49  1.MIKVQTQPFDVGEEQRALLAGRTDIGAVVCFTGLVRDFNEEVQGLSLEHYPGMTEQALANIVVEAEQRWALQGVRLIHRVGHLEPGDPIVLVAVASAHRRNAFQACDFIMDYLKTRAPFWKKEHTTEGHYWVSERSSDKQDAKRWE... 148
90 2.000e-82gi|505248350|ref|WP_015435452.1| molybdenum cofactor biosynthesis protein E [Azoarcus sp. KH32C]  clstr ali  45  1MSVSVQESDFDVGAEIAALSEDRREVGAVASFVGLVRDEGATVAAMTLEHYPGMTEQALEEIVAEARSRWSLHAVRVIHRYGRLEPGDRIVFVGVAGAHRGESFAACEFIMDYLKTRAPFWKKEETPDGARWVDARDSDDSAARRWERR. 151
91 2.000e-82gi|981553885|ref|WP_059756754.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  46  1MKILVQAEAFDLGAEVNAISQGHTDIGAIASFVGLARDEGSGVQAMTLEHYPGMTEKALAALVDEARSRWALLDVTVIHRVGRLLPGDSIVLVAVASSHRGEAFAACEYIMDALKTRAPFWKKEETPEGERWVDARVSDDAAAARWTDS. 151
92 2.000e-82gi|951199663|ref|WP_057675724.1| molybdenum cofactor biosynthesis protein MoaE [Curvibacter sp. PAE-UM]  clstr ali  40  4.RVVIQTQDFDVGAEIAALRAQDKRVGAVCTFIGTVRDRNDGVSTMELEHYPGMTEKSIEDMIDAAFQRFDIYAARVIHRVGPLLPLDQIVLVVVTSAHRGESFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDQALAKWGIAS 154
93 2.000e-82gi|640742941|ref|WP_025164997.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas taeanensis]  clstr ali  46  1MAIRVQLDAFDPGVETNALHAANVGVGAVVSFVGYVRDFNDGVGGMFLEHFPGMTEKALTKIAVEAEQRWPLLNIQIIHRIGRLEPGEPIVFVATASAHRQAAFDACAFVMDYLKTRAPFWKKEDTSEGPRWVEGRSSDQSAAERWHKA. 151
94 2.000e-82gi|654509737|ref|WP_027979045.1| molybdenum cofactor biosynthesis protein MoaE [gamma proteobacterium L18]  clstr ali  45  1MGVRVQVEAFDPGVEVNAMHAAHVGVGAVVSFVGYVRDFNDGVSGMFLEHYPGMTEKALSKIVGEAEQRWPLLKVEVLHRIGALDPGEPIVFVGVASAHRQAAFDACNFIMDYLKTRAPFWKKEQTGAGERWVEGKASDGDAAERWG... 149
95 2.000e-82gi|488498503|ref|WP_002541945.1| molybdenum cofactor biosynthesis protein MoaE [Grimontia indica]  clstr ali  40  1.MISVQEQDFSVADEYQRLN-DHAGDGAIVTFIGKVRDMGDNVTGLTLEHYPGMTEKSLAEIVEQAKSRWPLTHVRVIHRVGALDIGDQIVFVGVSSAHRGAAFEACEFVMDYLKTKAPFWKKERLTDQERWIEARDSDEDAAKRW.... 146
96 2.000e-82gi|499798751|ref|WP_011479485.1| molybdenum cofactor biosynthesis protein MoaE [Methylobacillus flagellatus]  clstr ali  38  1MTVRVQEQDFDVGEEITRLRLQYPQAGAVVSFTGQVRDLNDGVASLKLEHYPGMTEKSLAAIVEQARKRWPIFDAVVIHRIGTLAPQAQIVLVVVASAHRGDAFAACEFIMDYLKTEAPFWKKEATPEGEKWLDSRESDQAARGRWQ... 149
97 2.000e-82gi|890673835|ref|WP_048896952.1| molybdopterin synthase catalytic subunit [Photobacterium swingsii]  clstr ali  38  1.MISVQEADFSVAEEYERLAQG-TSAGAVVTFIGKVRDFGDDVTGLSLEHYPGMTEKSLEKIVEQANARWPLLATRVIHRVGDLELGDQIVFVGVSSAHRGAAFQACEFIMDYLKTQAPFWKKERTTEATRWVDARDTDTSAADRWNQD. 149
98 3.000e-82gi|518358900|ref|WP_019529107.1| hypothetical protein [Dasania marina]  clstr ali  39  5..VRVQTADFDVSTELNLLRQQSLQTGAVVNFVGTVRDNGQSIANMELEHYPGMTEKSIQDITLQAAQRWQLLAATVIHRVGLLQPGEQIVLVAVSSQHRGEAFQACEFIMDYLKTQAPFWKKEQTEQGAQWLDARESDGEAAKRWQ... 151
99 3.000e-82gi|1004047799|ref|WP_061503022.1| molybdenum cofactor biosynthesis protein MoaE [Ramlibacter tataouinensis]  clstr ali  40  4.SVSIQTADFDLSGETEALRREDTRVGAVCSFVGTVRGSADGVRSMELEHYPGMTEKAIEAMIDEARRRFDIYAARVIHRVGLLRPGEQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEETPEGARWVDARASDDAALARWGIAG 152
100 3.000e-82gi|928995404|ref|WP_054019593.1| molybdenum cofactor biosynthesis protein MoaE [Ideonella sakaiensis]  clstr ali  44  14.TVRIQTADFDLGAEVAVLRAGDHGIGAVASFIGTVRDRNDGVAGMTLEHYPGMTEKAIDAMVDAAAARFPLLGVTVVHRVGPLAPGDQVVLVAVASAHRGAAFQACEFLMDYLKTQAPFWKKEQTPQGGRWVDARVSDDAALARWGIAA 164
101 4.000e-82gi|655964080|ref|WP_029006733.1| molybdenum cofactor biosynthesis protein MoaE [Azospirillum halopraeferens]  clstr ali  44  1MTIRVQCEDFDVGAELEALTRGRTSIGGVTSFVGYVRDMAGGVSAMTLEHYPGMTERQLEAIAGEARRRWPLDAVLVIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTRAPFWKLEATPEGERWVEAKASDDAAAQRWRE.. 150
102 4.000e-82gi|491624876|ref|WP_005482416.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio parahaemolyticus]  clstr ali  39  4.RVSVQVEDFSVDQEYQRLSEG-TASGAVVTFIGKVRDMGDNVIGLHLEHYPGMTEKSLSDICDEAEARWPLLGVRVIHRVGDMDSGDQIVFVGVSSAHRGAAFDACEFIMDYLKTKAPFWKKERTTNEDRWIESRDTDHQAARRWENR. 152
103 4.000e-82gi|836678535|ref|WP_047826446.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Massilia]  clstr ali  42  8..VRVQKEDFDLGAEIARLRAGDPRIGAVVSFIGTVRDMNEGVAELELEHYPGMTERSLEDIVEQARARWPLYGALVVHRVGPMQPMEQIVLVAASAAHRGEAFAASEFIMDYLKTEAPFWKKEQTPDGARWVDARVSDDAARAKWS... 154
104 5.000e-82gi|504859354|ref|WP_015046456.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Simiduia agarivorans]  clstr ali  40  4.HIAVQTEDFDHTSLYQRLLSDTPEIGAIVTFTGLVRDLGDAVAGLFLEHYPGMTEKSLQAIVDEARQRWPIMRVELIHRVGQLAPADQIVYVGVSASHRGDAFAACEFIMDYLKTRAPFWKREATPEGDRWVDARDSDHQAATRWK... 151
105 5.000e-82gi|493273383|ref|WP_006231194.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium profundum]  clstr ali  38  1.MISVQFDDFSVAEEYALLSEG-TDAGAVVTFIGKVRDFGDDVTGLSLEHYPGMTEKSLEEIVVQARERWPLLKTRVIHRVGDLGLGDQIVFVGVTSAHRGAAFEACEFIMDFLKTRAPFWKKEQTSNETRWVDARDTDTSAADRWQNK. 149
106 6.000e-82gi|938316198|ref|WP_054620424.1| molybdenum cofactor biosynthesis protein MoaE [Rhodocyclaceae bacterium Paddy-1]  clstr ali  43  1MKITVQEADFDVGVELAAMTRGQPAVGACASFVGYVRDRNDGVAAMTLEHYPGMTEKALATIVDEARGRWELLDVTVIHRVGRLDIGDQIVLVAVTSAHRGEAFAACEFIMDYLKTRAPFWKREETPEGARWVDARETDDVAAGRWEN.. 150
107 6.000e-82gi|930051649|ref|WP_054154919.1| molybdenum cofactor biosynthesis protein MoaE [beta proteobacterium AAP51]  clstr ali  45  4.RVSIQTQDFDLGAEVAALRAGDPAVGAVASFIGTVRDRNGGISAMELEHYPGMTEKCIEAMIEQALQRFDLRAARVVHRVGLLQPGDQIVLVAVSSAHRGAAFQACEFLMDYLKTQAPFWKKETTAQGARWVDARVADDAALARWG... 154
108 6.000e-82gi|760016806|ref|WP_043700000.1| molybdenum cofactor biosynthesis protein MoaE [Tepidimonas taiwanensis]  clstr ali  44  7.SVCIQTADFDLGAEVAALRAGDPGVGAVCAFVGTVRDRNDGVAAMELEHYPGMTERAIDAMIDEAARRFDIRGVRVIHRVGPLQPQDQIVLVAVTSAHRGEAFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGITA 157
109 6.000e-82gi|517819956|ref|WP_018990164.1| molybdenum cofactor biosynthesis protein MoaE [Azoarcus toluclasticus]  clstr ali  48  1MTVSVQAEDFDVGAEIAALSAGRNEVGAVATFLGLVRDVSGGVGAMTLEHYPGMTEASLEEIVVQARARWSLYAVRVIHRFGRLEPGDRIVFVGVAGAHRGETFAACEFIMDYLKTRAPFWKLEETPEGARWVDARDSDDSAAARWEQGG 152
110 8.000e-82gi|550112482|gb|ERO65326.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. CMAA1215]  clstr ali  46  1MGIQVQQQAFSLDALNTALQAGDPAVGAVVTFVGYVRDLGQAVQSLFLEHYPGMTERSLRGIVAQAEQRWPLLRVELVHRVGLLRVGEPIVFVGVASAHRQAAFEACDFIMDYLKTRAPFWKREVTDSGEHWVEGRASDQQAASRWQQP. 151
111 9.000e-82gi|992333844|ref|WP_061052323.1| molybdopterin synthase catalytic subunit [Vibrio mimicus]  clstr ali  43  4.RVSVQTEDFSVAQEYEALSQG-THAGAVVTFIGKVRDMGDNVVGLHLEHYPGMTEKSLLEICDMAEERWPLQRVRVIHRVGDMLSGDQIVFVGVTSAHRNAAFEACEFIMDYLKTRAPFWKKELTTQESRWIDSRDSDQKAAQRWE... 150
112 9.000e-82gi|499558804|ref|WP_011239587.1| molybdenum cofactor biosynthesis protein MoaE [Aromatoleum aromaticum]  clstr ali  45  1MSVSVQQADFDVGAEIAALSQGRHEVGAVASFVGLVRDVSGGVAAMTLEHYPGMTERSLEDIVGEARRRWQLDGVRVIHRYGRLEPGDRIVFVGVAGAHRGEAFAACEFVMDYLKTRAPFWKLEETPDGAHWVDARDSDDSAAARWD... 149
113 1.000e-81gi|759819799|ref|WP_043516029.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. BC04]  clstr ali  47  6.KVQVRHEPFDAGVEQQRLLADRSDIGAVVSFTGLVRDFNEDVTALTLEHYPGMTESALSDIVTEAEMRWPLQGVRLIHRVGRMTPGDPIVLVVVASAHRREAFEACDFIMDYLKTRAPFWKKEHSVSGDYWVAERESDHQDASRWEGD. 155
114 1.000e-81gi|654851949|ref|WP_028304338.1| hypothetical protein [Oceanospirillum maris]  clstr ali  43  5IYIKVQEAPFDLAVVNRGMTEGRTDIGAVVTFSGLVRDFNEDVQGLTLEHYPGMTEQALQQIAEEASERWSLQAVSVIHRVGHLTPGDPIVLVAVASAHRQAAFDSCAFIMDFLKTRAPFWKKENTREGDYWVSARTSDEDAAQRWHK.. 154
115 1.000e-81gi|501315412|ref|WP_012347047.1| molybdenum cofactor biosynthesis protein MoaE [Leptothrix cholodnii]  clstr ali  43  5.RVTIQQADFDLSAEVAALRAGDGGVGAVASFIGTVRDDGAGVSAMELEHYPGMTERSIEAMIDTALQRFDIRAARVIHRVGLLQPQDQIVLVAVSSAHRGQAFQACEFLMDYLKTEAPFWKKETTPEGARWVDARVSDDDALRRWG... 152
116 1.000e-81gi|517757558|ref|WP_018927766.1| MULTISPECIES: hypothetical protein [Pseudomonas]  clstr ali  41  1.MIRVQTERFEPGTEINALQALSLNVGAVVSFVGYVRDTGQEVAGMFLEHYPGMTEKVLGKIADEARQRWPLLGLVLIHRIGALQPGDPIVFVGVSSSHRQAAFDACAFVMDYLKTRAPFWKKEQVAESSHWVEARHSDREAAQRWE... 148
117 1.000e-81gi|654642953|ref|WP_028104107.1| molybdenum cofactor biosynthesis protein MoaE [Pseudoduganella violaceinigra]  clstr ali  39  4..VRIQTDDFDLSHEVAQLRAGNAKVGAIVTFVGTVRDLNDGVAEMELEHYPGMTEQAIQAILEQAKVRWPIYGALVIHRVGPLKPMDQIVLVAVTSPHRGEAFSACEFIIDYLKTEAPFWKKEQTPEGARWVDARTSDDEARKKWS... 150
118 1.000e-81gi|499630805|ref|WP_011311539.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  48  1MKIAVQNEAFDLGSEVAALTHGRRDVGAVASFVGLARDEGSGVAAMTLEHYPGMTEKALAALVDEACARWALLDVSVVHRVGRLLPGDPIVLVAVASAHRGEAFAACEFIMDALKTRAPFWKKEETPDGERWVEARASDEAAAGRWEKR. 151
119 1.000e-81gi|504408922|ref|WP_014596024.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  44  1MAVRVQQGSFDPGAELNALHAANLGIGAVAGFVGYVRDFNDGVAGMFLEHAPGMTEKALEKIVQEAEQRWPLLRLDVLHRVGPLEPGEPIVFVGAASAHRDAAFDACRFVMDYLKTRAPFWKKENTAAGPRWVEGRASDQLAAERWNEKS 152
120 2.000e-81gi|497352952|ref|WP_009667165.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium IMCC9480]  clstr ali  40  1MTIRIQQADFDMSTELANLRAGSPQVGAIVSFVGTVRDLNDGVSQMELEHYPGMTEKSIAVIVERARAHWPIADALVIHRIGPLLPTEQIVLVAVAAAHRGEAFAACEFIMDYLKTEAPFWKKEQTPEGARWVDARAVDDAALAKW.... 148
121 2.000e-81gi|518389273|ref|WP_019559480.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Caldimonas]  clstr ali  43  5.RVRIQTEDFDLGAEVAALRAGDPAVGAVAVFVGTVRDHNDGVRCMELEHYPGMTEKAIEAMIDEAQRRFEIRAARVIHRVGLLQPQDQIVYVGVTSAHRAEAFRACEFLMDYLKTQAPFWKKETTPAGARWVDARLSDDEALRRWGIEA 155
122 2.000e-81gi|544832997|ref|WP_021248775.1| hypothetical protein [Thauera terpenica]  clstr ali  44  10.RVSVQEADFDVGAEVGSLHGGSGQVGAVASFVGLVRDEGDGVTAMTLEHYPGMTEKALEEIVAQARERWALLGVSVIHRFGRFVPTDRIVFVGVASAHRGEAFAACEFIMDYLKTRAPFWKREETPAGARWVDARDSDDSAAARWQTAG 160
123 2.000e-81gi|556740201|ref|XP_005965647.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Pantholops hodgsonii]  clstr ali  42  23.RVSIQTEDFDVSAELAALRSGDARVGAVCSFIGTVRDRNEGVASMELEHYPGMTEKSIEAIIDEAVQRFGIHGARVIHRIGPLQPMDQIVLVAVTASHRGMAFQACEYIMDYLKSLAPFWKKEQTPEGARWVDARVSDEEALARWRQ.. 171
124 2.000e-81gi|658513324|ref|WP_029708831.1| molybdenum cofactor biosynthesis protein MoaE [Rhodoferax saidenbachensis]  clstr ali  40  10.RVTIQTADFDLSAEVAALRAGHKGVGAVCSFVGTVRDRADTISAMELEHYPGMTEKAIEAMIDEAYKRFDILGARVIHRVGLLQPLDQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEQTPQGAQWVDARVSDDAALAKWGISA 162
125 2.000e-81gi|738875420|ref|WP_036763478.1| molybdopterin synthase catalytic subunit [Photobacterium damselae]  clstr ali  41  1.MISVQFEDFSVADEYEKLAQG-TEAGAVVTFIGKVRDFGDSVTGLSLEHYPGMTEKALSEIVEQARARWPLLQVRVIHRVGDLDLGDQIVFVGVSSAHRGASFEACEFIMDYLKTRAPFWKKEQTPEESRWVDARESDTSAADRWHDK. 149
126 2.000e-81gi|781561287|dbj|GAO24574.1| molybdopterin-converting factor subunit 2 [Alicycliphilus sp. B1]  clstr ali  41  7.RVSIQTQDFDVSAELAALRARDARVGAVCCFVGTVRDRNDGVATMELEHYPGMTEQSIEAMIDEAFARFDLYGVRVIHRVGLLAPLDQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEATPQGARWVDARVSDDAALARWGIAA 157
127 2.000e-81gi|740365524|ref|WP_038201052.1| molybdenum cofactor biosynthesis protein MoaE [Xenophilus azovorans]  clstr ali  43  8.RVRIQTQDFDLAAEVAALRAGDARAGAVCSFVGTVRDRSDGVAAMELEHYPGMTEKAIEAMIDEAQQRFGILGARVVHRVGPLLPLDQIMMVAVTSAHRGEAFQACEFLMDYLKTQAPFWKKESTPEGARWVDARVADDEALARWGIQA 158
128 2.000e-81gi|494074662|ref|WP_007016718.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bermanella marisrubri]  clstr ali  34  3.KIAVQEADFDIAQEYQAMRQDNPNDGAIVFFTGLVRDFNQGVTGLFLEHYPGMTEKSLENIVEQAKQRWPINRVSLIHRIGQLHISDQIVFVSASSPHREAAFDACRFIMDYLKHEAPFWKKETTQEGDRWVKANQKDKDALKKW.... 149
129 2.000e-81gi|947998047|ref|WP_056657513.1| molybdenum cofactor biosynthesis protein MoaE [Pseudorhodoferax sp. Leaf265]  clstr ali  43  5.RVSIQTTDFDLGAEIAALRAQDARVGAVCSFVGTVRDRPGQVTALELEHYPGMTERAIEAMVDEAFARFPLYGARVVHRVGPLAPTDQIVLVAVTSAHRGASFQACEFLMDYLKTQAPFWKKEQTPEGGRWVDARVSDDAALARWGIS. 156
130 2.000e-81gi|515789778|ref|WP_017222196.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Moritella dasanensis]  clstr ali  39  5.SIQIQTEDFDLATEYAALGQSH-STGAIVTFIGKVRDFGDNVSGLTLEHYPGMTEKSLAKILVEAETRWSIQGVKVIHRIGELALGDQIVFVGVASMHRGDAFQACEFIMDYLKTQAPFWKKEATEDGSHWVDARETDTTAADRWK... 151
131 2.000e-81gi|827454005|ref|WP_047214081.1| molybdenum cofactor biosynthesis protein MoaE [Pandoraea thiooxydans]  clstr ali  41  1MPIKVQQDDFDLSAEVAALRAGDLRVGAVACFVGTVRDLGEDVAELELEHYPGMTEKSLAAIVEQAHERWDIYDALVIHRYGKLKPADQIVLVAVTSAHRGEAFAACEFIMDYLKSEAPFWKKEQTPAGARWVEARHSDEAALARWGVD. 151
132 3.000e-81gi|489380450|ref|WP_003287142.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  43  1MSVRVQQAAFDPGAELNALHAANLGIGAVAAFVGYVRDFNDGIAGMFLEHAPGMTEKALGKIIAEAETRWPLLGIDVLHRVGALEPGEPIVFVGVTSAHREAAFEACRFVMDYLKTRAPFWKKESTPAGERWVDGRDSDQAAAERWQR.. 150
133 3.000e-81 GL0072640 [Complete] locus=scaffold47540_3:1953:2417:+  ali  41  7.KILVTTEPFDIGEETARIREGSPDMGAIVTFTGVVRNVNDGVTAMTLEHYPGMTQKSLAKIVETARGRWPLGDVTVIHRVGRMVVGEEIVLVAVASRHRHAAFEAASFIMDWLKTEAPFWKKEETPEGARWVDARESDDLAKARWG... 154
134 3.000e-81gi|946920739|ref|WP_055843356.1| molybdenum cofactor biosynthesis protein MoaE [Xylophilus sp. Leaf220]  clstr ali  40  9.RVSIQTADFDLSAEVAALREGDRGVGAVCSFVGTVRSRGDEVASMELEHYPGMTEKSIEAMVDAAHARFDIRGARVIHRVGLLVPGAQIVLVAVASAHRGESFQACEFLMDYLKTRAPFWKKEQTPGGGRWVDARSSDDAALARWGIDS 159
135 3.000e-81gi|755077651|ref|WP_042429215.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas granuli]  clstr ali  42  7..VSIQTADFDVSAEIAALRAGDPGVGAVCCFVGTVREHGEAVASMELEHYPGMTEKSIAAMIEEARRRFDIRGVRVIHRVGLLAPTDQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEATPQGARWVDARASDDAALARWGITA 156
136 3.000e-81 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  41  7.KILVTTEPFDIGEETARIREGSPDMGAIVTFTGVVRNVNDGVTAMTLEHYPGMTQKSLAKIVETARGRWPLGDVTVIHRVGRMVVGEEIVLVAVASRHRHAAFEAASFIMDWLKTEAPFWKKEETPEGARWVDARESDEEAKARWS... 154
137 3.000e-81gi|759830515|ref|WP_043526337.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas xinjiangensis]  clstr ali  45  1.MIDVQHAAFDPGFEQTKLLQGRQDIGAIVSFTGLVRDFNEDILGMTLEHYPGMTESALNAIVEEAESRWPLQGVRVIHRVGYLAPGDPIVLVLVASAHRRAAFEACDFIMDYLKTRAPFWKKEHTASGHHWVAERASDQRDARRWGES. 150
138 4.000e-81gi|515607741|ref|WP_017040341.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio genomosp. F10]  clstr ali  41  4.RISVQQTDFSVADEYEKLSQG-TEPGAVVTFIGKVRDMGDNVTGLSLEHYPGMTEKALSEICDKAEERWPLLALSVIHRVGDLDIGDQIVFVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTQTTRWVESRDSDAQAALRWK... 150
139 4.000e-81gi|262207685|gb|ACY31783.1| molybdopterin biosynthesis MoaE [Comamonas testosteroni CNB-2]  clstr ali  42  15.RVSIQTQDFDLSAEIAALRAGDARVGAVCSFVGTVRDEGDAVSSMELEHYPGMTEKSIEAIIDKAVARFGIYGARVIHRIGLLQPMDQIVLVAVSSAHRGKSFEACEYIMDYLKSEAPFWKKEQTEQGARWVDARVSDEQALARW.... 161
140 4.000e-81gi|647595513|ref|WP_025872151.1| molybdenum cofactor biosynthesis protein MoaE [Methylobacillus glycogenes]  clstr ali  38  1MTVRVQAEDFDLGAEVRQLRLQSAGAGAVVSFVGQVRDLGENVASLTLEHYPGMTEKALQAIVTQAQARWPILNALVIHRIGTLQPLDQIVLVAVASAHRGDAFAACEFIMDYLKTEAPFWKKESSSKGEQWLEALGTDHQARERW.... 148
141 5.000e-81gi|501401258|ref|WP_012432824.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia phytofirmans]  clstr ali  41  1MPVRVQTEDFDLTAEVAALRARNPKIGAVACFVGTVRDLNDGVETMELEHYPGMTEKSLEAIIVSARERWPGIEVSIVHRVGKLYPLDQIVMVATTAAHRGEAFVSCEFVMDYLKTQAPFWKKEKTEAGERWVDARVTDDAALARWGIKS 152
142 5.000e-81gi|501059842|ref|WP_012111193.1| molybdenum cofactor biosynthesis protein MoaE [Parvibaculum lavamentivorans]  clstr ali  43  1.MIRIQTEDFDIGAEIAALTEGRTDIGAVVTFSGLVR-ETGGIASMELEHYPGMTEKKLARIESEATARWPLQATLIIHRVGKLLPGDNIVLVVAASAHRQAAFDAASFLMDYLKTRAPFWKREQTGDKSHWVDARESDGTAAAKWD... 145
143 5.000e-81gi|344226424|gb|EGV52760.1| molybdopterin synthase catalytic subunit [endosymbiont of Riftia pachyptila (vent Ph05)]  clstr ali  41  6..IRVQSEPFDPNVEVDLLRNHSPSIGGVVSFIGQVRDFNDDVLAMTLEHYPGMTEKALAAIVDEANARWELMGVRVVHRVGRMLPKDPIVLVAVASSHRGEAFQACEFIIDYLKTRAPFWKREESVEGARWVDARESDDHAEARWK... 152
144 7.000e-81gi|494152251|ref|WP_007091994.1| molybdenum cofactor biosynthesis protein MoaE [Thalassospira xiamenensis]  clstr ali  45  3.RVSVQENDFDPGAELAALTDGRTDIGAAVSFVGLVRDIGDQVSALTLDHYPGMTERELENIVDEAARRWPLDDVRIVHRFGRMLPGERIVLVITLSAHRRAAFEACDFIMDFLKTRAPFWKREQTPKGDHWVTAKASDDADAERWNTD. 152
145 7.000e-81gi|518171972|ref|WP_019342180.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  44  1MGVRVQQGPFDPGAELNALHAANLGIGAVTGFVGYVRDFNDGVAGMFLEHAPGMTEKALQKIIDEAADRWPLLTLEILHRVGRLEPGEPIVFVGAASAHREAAFDGCRFVMDYLKTRAPFWKKEDTSEGTRWVEGRCSDQAAADRWRQ.. 150
146 7.000e-81gi|504006495|ref|WP_014240489.1| molybdenum cofactor biosynthesis protein MoaE [Azospirillum brasilense]  clstr ali  44  1MTVKVQSEDFDVGAELAAMTGGKTGIGGVTLFVGLVRDMAGGVSAMTLEHYPGMTERQLEAIEAEARARWPLDDALIIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTKAPFWKMEATPEGERWVEAKESDDTAAARWTKPA 152
147 7.000e-81gi|748723325|ref|WP_039981443.1| molybdopterin synthase catalytic subunit [Vibrio sagamiensis]  clstr ali  40  3MRVSVREEDFSLEHEYQRLSTLNA-AGAVVTFIGKVRDNGDDIIGLHLEHYPGMTEKSLIDICEKAECRWPLLGVRIIHRIGDLDIGDQIVFVGVSSAHRAAAFEACEFIMDYLKTKAPFWKKERTSSESRWIEPRQSDQQAMLRWKNE. 152
148 7.000e-81gi|955157466|emb|CUI08499.1| Molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium sp. CG23_2]  clstr ali  42  2MAVRVQSADFDLSTEMAALRAQDARIGAVVTFVGTVRDMNDGVAAMELEHYPGMTEQALEKIVAQAGERWPLYGALVVHRVGPLAPLDQIVLVACTAAHRGEAFAACEFIIDYLKTDAPFWKKEQTPDGARWVDARVTDDAALAKW.... 149
149 8.000e-81gi|755135995|ref|WP_042486189.1| molybdopterin synthase catalytic subunit [Vibrio diazotrophicus]  clstr ali  40  5..VSVQVEDFSVAQEYEALSSG-TDAGAVVTFIGKVRDMGDHVTGLHLEHYPGMTEKSLNEICDEAKSRWPLLQLRLIHRIGDLDIGDQVVFVGVSSAHRSASFEACEFVMDYLKTKAPFWKKERTTDGTRWIDSRDSDSKAAQRW.... 149
150 8.000e-81gi|931434487|gb|KPK20012.1| molybdenum cofactor biosynthesis protein MoaE [Betaproteobacteria bacterium SG8_41]  clstr ali  38  1MTVRIQTADFDVSAEIAGLRRGNAKIGAVASFVGVVRDDGDPVAEMTLEHYPGMTEHSIEEIIAQARGRWQVIDALVVHRIGTLRPADQIVLVVVTSGHRGDAFAACEFIMDYLKTRAPFWKKESTAKGERWVDARASDDVAAERWRLKG 152
151 8.000e-81gi|400225456|gb|EJO55620.1| molybdopterin converting factor, subunit 2 [Burkholderia multivorans CF2]  clstr ali  46  4.TVRVQTDDFDLNAEVAALRARNPKIGAVACFVGTVRDEGDAVAALELEHYPGMTEKALEKIAAEAGRRWPGIDVAIVHRVGKLYPLDQIVMVATVAAHRGDAFASCEFVMDYLKTDAPFWKKETTPNGERWVDARSTDDAALARWGIES 154
152 9.000e-81gi|913632803|gb|KNZ31556.1| molybdenum cofactor biosynthesis protein MoaE [Methylibium sp. NZG]  clstr ali  43  5.RVSIQTRDFDLGAEVAALRASDGSVGAVVSFIGTVRDRNGGVSAMELEHYPGMTERSIEAMIDAAFQRFDMRAARVVHRVGVLQPLEQIVLVAVTSAHRGQAFQACEFLMDYLKTQAPFWKKETTPDGAHWVDARVSDDEALQRWGIAG 155
153 1.000e-80gi|490864602|ref|WP_004726636.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio furnissii]  clstr ali  42  4.RVSVQTQDFSVADEYAQLSAG-TQAGAVVTFVGKVRDMGDNVAGLHLEHYPGMTEKALLEICDEAARRWPLQNVRVIHRVGDMDIGDQIVFVGVSSAHRSASFEACEFVMDYLKTKAPFWKKERTTEATRWVDSRESDAKAAERWQQ.. 151
154 1.000e-80gi|736874435|ref|WP_034874077.1| molybdenum cofactor biosynthesis protein MoaE [Endozoicomonas montiporae]  clstr ali  44  5VHLSVQTDDFDPALEQARLS-DNAAVGGVVTFTGLVRDNNDHVSGLYLEHYPGMTESALQTIIDEASERWSLYAVSVIHRVGQLHPTDRIVFVGTASAHRQDAFAACDFIMDYLKTRAPFWKKETTPEGDRWIEERQSDKDAAQRWQ... 152
155 1.000e-80gi|503112490|ref|WP_013347223.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Ferrimonas balearica]  clstr ali  37  1.MIAVQTQDFSVADEYAKL-ADNPGCGAVVTFVGKVRDFGDGVSAMTLEHYPGMTEAVLHQIEAEARQRWPLDEVTIIHRVGELQLCDQIVFIGVSSAHRKAAFAACEFLIDFLKTRAPFWKKETSDDGTVWVDAKDADQQAAEQWQR.. 148
156 1.000e-80gi|653279354|ref|WP_027475777.1| molybdenum cofactor biosynthesis protein MoaE [Curvibacter gracilis]  clstr ali  40  6.RVAIQTADFDVSAELAALRAHDRRVGAVCSFVGTVRGGNEGVLSMELEHYPGMTERAIEAMIDQAHQRFDLYGARVVHRVGLLQPGEQIVLVAVTSAHRGQSFLGCEFLMDYLKTQAPFWKKEQTPQGAHWVDARVSDDAALARWGIEA 159
157 1.000e-80gi|646773965|gb|KDR43811.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia glathei]  clstr ali  42  6.RVRVQEADFDISTEVAALRAQNPKVGAVACFVGTVRDLNEGVETMELEHYPGMTEKSLEAIAAQARERWPGSDVLIVHRIGKLKPLDQIVLVATTAMHRADAFESCAFVMDYLKTQAPFWKKEKTEAGERWVDARESDDSALARWGVEA 156
158 1.000e-80gi|544667940|ref|WP_021101295.1| molybdenum cofactor biosynthesis protein MoaE [Litoreibacter arenae]  clstr ali  42  1MRVLVQEALFDAGAELNAFAKGDTDIGAVVSFTGVTRDVSGGLSRMLIEHYPGMTERALTQICEEAQTRWSLADVLVIHRFGTMEPGDNIMMVATASRHRADAFAAAEFLMDYLKSRAPFWKKEITADGSEWVAAKDSDEDALDRWS... 147
159 1.000e-80gi|521067945|ref|WP_020399896.1| hypothetical protein [Kordiimonas gwangyangensis]  clstr ali  40  3.SISVQADDFDITGEINALKADRVDIGAIVTFTGTVRDLDGSLTSMTLEHYPGMTERELQAVADEAEARWPLQACRVIHRYGTLSPGENIVLVITMSAHRHAAFQAADFLMDFLKSRAPFWKKEETGEGATWVDARESDELALKRWN... 148
160 1.000e-80gi|751601461|ref|WP_041069616.1| molybdenum cofactor biosynthesis protein MoaE [Thiolapillus brandeum]  clstr ali  42  5..IAIQTEIFDPAHEEQQLRQGNPRVGAVVSFLGLMRDDGDAVYAMTLEHYPGMTEKALDAIVDEAGQRWDLEGIRVIHRVGELLPEEPIVLVMTASRHRGEAFRACEFIIDYLKTRAPFWKKENTGDGERWVEARHSDKDAESRWD... 151
161 1.000e-80gi|499783477|ref|WP_011464211.1| molybdenum cofactor biosynthesis protein MoaE [Rhodoferax ferrireducens]  clstr ali  40  9.RVSIQTADFDLSTEVALLRAQDPRVGAVCSFIGTVRDRSGSISSMELEHYPGMTEKSIEAMMDAALKRFDIYGARVIHRVGLLQPLDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGIAA 161
162 1.000e-80gi|517848139|ref|WP_019018347.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas lutea]  clstr ali  46  1.MISVQTAPFDVGTEQQVLTRKRTDIGAVVSFTGLVRDFNEDVQALTLEHYPGMTEQALQDIVAEAEARWALQGIRLIHRVGRLEPGDPIVMVAVASAHRRHAFEACDFIMDYLKTRAPFWKKEHTVSGHYWVAERNTDIEDAKRWE... 148
163 1.000e-80gi|684596091|dbj|GAL37329.1| molybdenum cofactor biosynthesis protein MoaE [Vibrio maritimus]  clstr ali  41  85IQVSVQQQDFSVGAEYEALAEGSAS-GAIVTFTGKVRDMGDNVQGMSLEHYPGMTERALEKICDEAETRWMLNGIRVIHRVGDLDAGDQIVFVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTESTRWVESRESDAQAAERWQK.. 233
164 2.000e-80gi|334731119|gb|AEG93495.1| Candidate molybdopterin converting factor subunit 2 (MPT synthase subunit 2) [Ramlibacter tataouinensis TTB310]  clstr ali  40  6.RVVIQEQDFDLSAEVAALRGRDTGVGAVCCFVGTVRDRNDGVSTLELEHYPGMTEKAIEAMIDEAMRRFDIRAARVVHRIGPLQPQEQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEQTPTGARWVDARVSDDAALARWGIAS 156
165 2.000e-80gi|519023381|ref|WP_020179256.1| hypothetical protein [Methylopila sp. M107]  clstr ali  44  1MAIRIQTEPFDLGSEVAALTQGLTDQGAVVTFSGLCRDRGDGLVALTLEHYPGMTEDELARIEAEARSRWPLADALVVHRVGRILPGEPIVLVVTVSAHRKAAFEAAEFLMDYLKTSAPFWKSEETAEGASWVAAKQSDDDSAERWRRDG 153
166 2.000e-80gi|639200847|ref|WP_024539282.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas badia]  clstr ali  39  5..VSIQTEDFDVSREIARLRAEDARVGAVCCFVGTVRDRSGSVSSMELEHYPGMTEKSIAAMIDEARRRFDFYGVRVIHRVGLLQPEDQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEATPEGTQWVDARESDDAALRRWGIQA 154
167 2.000e-80gi|516488026|ref|WP_017876470.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium sp. CG3]  clstr ali  39  3.RVRVQTGDFDLSAEVARLRAANPKVGAVVSFVGTVRDLNEGVAEMELEHYPGMTEQSIEAIIEQAMRRWPLFDALVIHRVGPLKPMEQIVLVLTTAAHRGVAFAACEYIIDYLKTEAPFWKKEQTPDGARWVDARVSDEAALSKWARA. 152
168 2.000e-80gi|505131366|ref|WP_015318468.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium australicum]  clstr ali  52  8.TVRIQRQDFDVAAEIAALTQGRVDIGAVVTFSGLCRDEQGALSALELEHYPGMAEAEIGRIATEASERWPLQGLSVIHRHGKIAPGENIVLVVAASAHRQAAFEAADFLMDYLKSRAPFWKKEHRTDGSEWVEAKETDAQAAQRWKRP. 157
169 2.000e-80gi|489029126|ref|WP_002939523.1| molybdopterin biosynthesis protein MoaE [Thauera sp. 27]  clstr ali  43  5.KVCVQEDDFDVGAEIAALSQERADVGAVASFVGLVRDVNDGVSAMTLEHYPGMTERALEEIVIEARARWSVLDACVIHRHGRLMPAERIVFVGVASAHRGDAFAACEFIMDYLKTRAPFWKREETPDGGRWVDAREADDSAAARWS... 152
170 2.000e-80gi|654770236|ref|WP_028224749.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia ferrariae]  clstr ali  42  1MLVRVQTEDFDLTTEVAQLRARNPAIGAVACFVGTVRDLNDGVATMELEHYPGMTEKALEGIAVEAQRRWPGIEVLIVHRVGKLAPLDQIVLVATTAMHRGDAFASCEFVMDYLKSEAPFWKKEETEHGARWVDARATDDAALARWGIAS 152
171 2.000e-80gi|947808352|ref|WP_056469806.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobacter sp. Root404]  clstr ali  42  5.RVVVQTADFDLGAEVAALRADDPAVGAVASFIGTVRDRNDGVSAMELEHYPGMTERAIEAMIDEALRRFEIRGARVIHRVGLLQPQDQIMMVAVTSAHRGQAFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARSSDDAAIARWGIQA 155
172 2.000e-80gi|515593072|ref|WP_017025711.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio rumoiensis]  clstr ali  39  6.MVSVQFDDFDIGLEYQHLSQG-TQAGAVVTFVGKVRDMGDSVTGLSLEHYPGMTERSLIQICEQAKSRWPLLNIRVIHRVGDLDLGDQIVFVGVSSAHRNAAFEACEFVMDYLKTQAPFWKKERTTDDVRWVESRDSDAKAADRWK... 152
173 3.000e-80gi|1011627801|ref|WP_062478180.1| hypothetical protein [Lacimicrobium alkaliphilum]  clstr ali  40  11..IAVQTDDFSLAAEYEKLSANNSSDGAVVTFAGLVRDVNQGITSLTLEHYPAMTEKALQEIVREARLRWQLGRVRVIHRVGKLALSEQIVFVGVSSRHRGDAFAACEFIMDYLKTRAPFWKKEQTENGEHWVEAKTSDQQKAQQWK... 157
174 3.000e-80gi|667762739|ref|WP_031383803.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas zincidurans]  clstr ali  44  1.MIRVQHECFDVGAEQATLVAQRNDIGAVVCFTGLVRDFNEDVTALSLEHYPGMTESALGEIVAEAGRRWSLNGVRLIHRVGRLEPGDPIVLVAVASAHRQAAFDACLFIMDYLKTRAPFWKKEHTAHGDYWVAERDTDRQAAERWR... 148
175 3.000e-80gi|654786581|ref|WP_028240598.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas azotifigens]  clstr ali  43  1MGIRVQPQAFDAGVELGALHAANLGVGAVAVFVGYVRDFNDGVAGMFLEHAPGMTEKALERIVAEAQARWPLLGVEVIHRVGELEPGAPIVFVGVTSAHRDAAFDACRFVMDYLKTRAPFWKKEDTPDGPRWVEGRTSDQQAVERWQR.. 150
176 3.000e-80gi|1006552134|ref|WP_061800138.1| molybdenum cofactor biosynthesis protein MoaE [Serratia ficaria]  clstr ali  42  5.RIRVGEAPFSVGDEYQWL-AQCDDDGAVVTFTGKVRNHGDDVSALTLEHYPGMTEKALAEIVTQARGRWPLQRVTVIHRIGALFPGDEIVFVGVTSAHRSMAFAANEFIMDYLKTRAPFWKREATGQGDRWVDARDSDRQAAERWHQAA 154
177 3.000e-80gi|749554405|ref|WP_040187068.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas salina]  clstr ali  44  1.MIRVQQRVFDAGDEQRALLEARSDIGAVVSFTGLVRDFNERVQALTLEHYPGMTEAALGDIVEQAQSRWPLQGVTLIHRIGRLAPADPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHTASGDYWVSERDGDHDAARRWEMSS 151
178 3.000e-80gi|522194885|ref|WP_020702352.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium AB_14]  clstr ali  36  9..VRIQTEDFDLSTELARLRAANPKVGAIVNFVGTVRDLNEGVAEMELEHYAGMTEQSILAIIEQARQRWPVFGALVIHRVGPLKPLEQIVLVAVTSAHRGEAFAACEYIIDFLKTEAPFWKKEQTPAGARWVDARVSDDVALKKWSIE. 157
179 3.000e-80gi|655955223|ref|WP_028998106.1| molybdenum cofactor biosynthesis protein MoaE [Azohydromonas australica]  clstr ali  42  7.RVLIQTDDFDLGTEVQRLRAGDPGVGAVVSFVGTVREEGAGVSLMELEHYPGMTESAIEAMVDEAFERFDIRAARVIHRVGALKPLDQIVFVAVTSAHRGQAFQACEFLMDYLKTQAPFWKKEHTPQGARWVDARVADDQALARWGIAA 157
180 3.000e-80gi|947671301|ref|WP_056333906.1| molybdenum cofactor biosynthesis protein MoaE [Massilia sp. Leaf139]  clstr ali  41  8..VRVQTEDFDLGQELARLRANDARVGAVVSFVGTVRDMNEGVSEMELEHYPGMTERALQEIVELARARWPLYNALVIHRVGPLAPLAQIVLVAVSAAHRGEAFAACEFIIDYLKTDAPFWKKEQTPEGARWVDARITDDSAKAKWS... 154
181 3.000e-80gi|916829835|ref|WP_051436891.1| molybdenum cofactor biosynthesis protein MoaE [Methylophilaceae bacterium 11]  clstr ali  36  15..VKVQIEDFDVGEVLASVRRDHPQIGAIVSFVGLVRDMNDSVTTLTLEHYPEMTEKSLQAIVDQAQQRWDIMDAVVIHRVGTLKPLDQIVLVVISSAHRQAAFSACEFVMDYLKTQAPFWKKETNNESERWVEAKSSDDQAQARWQ... 161
182 4.000e-80gi|740842020|ref|WP_038627273.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. PSNIH2]  clstr ali  45  4.RIRVGQPPFSVAEEYQWLSASN-DDGAVVTFTGKVRNHGDNVSALTLEHYPGMTEKALAEIVEEARARWPLHLVSVIHRVGELFPGDEIVFVGVSAAHRGAAFEAAGFIMDYLKTRAPFWKREATPQGDRWVEARDSDRQAAGRWD... 150
183 4.000e-80gi|648566472|ref|WP_026258223.1| molybdenum cofactor biosynthesis protein MoaE [Endozoicomonas elysicola]  clstr ali  43  5..ISIQVEDFNLGHEYERLE-GNKSSGAIVTFTGTVRDMGDEVGGLFLEHYPGMTEKALQEIIDEAMERWELQVVRVIHRIGQMHPGDRIVFVGVVSAHRKEAFAACEFIMDYLKTRAPFWKKETTPEGDRWVDERESDQEAADRW.... 149
184 4.000e-80gi|551359546|ref|WP_022978893.1| molybdenum cofactor biosynthesis protein MoaE [Ideonella sp. B508-1]  clstr ali  40  9.RVRIQTADFDLGQEVASLRADDGGVGAVVSFLGTVRDQAGEVSAMELEHYPGMTEKAIEAMIDAAHARFDIRAARVIHRVGPLRPCDQIVLVVVSSAHRGEAFQACEFLMDYLKTQAPFWKKETTAEGARWVDARVADDQALARWGIAS 161
185 4.000e-80gi|635568773|emb|CDQ36355.1| Molybdopterin synthase catalytic subunit [Virgibacillus halodenitrificans]  clstr ali  47  2IDVRVQAPVFDVGEEQRQLLAGRRDIGAVVTFTGLVRDFNEDVQALSLEHYPGMTEAALRDIAEQATSRWPLDGIRIVHRVGRLSPSDPIVMVMVASAHRRAAFDACDFLMDYLKTRAPFWKKEHTASGTYWVSARDSDVRDADRWEEA. 152
186 4.000e-80gi|937510238|ref|WP_054597438.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas fluorescens]  clstr ali  44  1MTVQVQTELFNLNELNSRLHAKDPGVGAVATFVGYVRDQGEKVSSLFLEHYPGMTEQSLQRIVDQANDRWPLQRVNIVHRVGLLNVGDPIVFVGVASEHRQAAFDACAFLMDYLKTRAPFWKREETGSGDRWVCGRESDRLAARRWE... 149
187 4.000e-80 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  41  5.RVLIQTQDFDVSAELAALRAGDARVGAVCCFVGTVRDRNEGVSAMELEHYPGMTEKSIEAIIERATERFGIHAAKVIHRIGPLQPMDQIVFVGVTSAHRGMSFQACEFIMDYLKSEAPFWKKEQTPEGARWVDARVSDEEALARWQ... 152
188 4.000e-80gi|930063912|ref|WP_054166054.1| molybdenum cofactor biosynthesis protein MoaE [alpha proteobacterium AAP38]  clstr ali  41  1MTVRVQRDDFDIGAELAALSDGDTGIGGVCSFTGLVRDLPGTVRALTLEHYPGMTERQLEAIEAEARERWPLSACLIIHRYGRMEPGERIVLVACASAHREAAFDACRFIMDWLKTKAPFWKLEETGDGQRWVDARHSDQNAADRWSE.. 156
189 5.000e-80gi|505449036|ref|WP_015636138.1| molybdopterin synthase catalytic subunit MoaE [Pseudomonas protegens]  clstr ali  44  1MSIQVQTQALSLDQLNAGLQAGDASVGGVVTFVGYVRDLGEAVHSLFLEHYPGMTERSLQRIVEQAQARWPLNRVSLVHRVGLLQVGEPIVFVGVASAHRQAAFEACAFIMDYLKTRAPFWKREVTPAGERWIDGRESDRQAAERWGVE. 151
190 5.000e-80gi|543577454|ref|WP_021025925.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas sp. B-9]  clstr ali  41  5.HIAVQTADFDVSEELRLLRAADGRIGAVCSFVGTVRDRNAGVATMELEHYPGMTEKSIAQMVEAASQRFDIFGARIIHRVGLLAPGEQIVLVAVSSAHRGESFQACEFLMDYLKTEAPFWKKEDTPEGARWVDARVSDEAAMARWG... 152
191 5.000e-80gi|668681361|gb|KFB74337.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-91]  clstr ali  45  1.MVRVQAADFDPGAELAAMRLGKPQIGALASFVGLVRELNDGVSELTLEHYPGMTEKALEEIIAEARRRWTLIDVLLIHRVGRLLPTDQIVLVAVASAHRGEAFAACEFIMDYLKTRAPFWKREVTAAGARWVEARLADEQAAERWR... 148
192 6.000e-80gi|817101745|ref|WP_046475276.1| molybdenum cofactor biosynthesis protein MoaE [Candidatus Filomicrobium marinum]  clstr ali  40  1MAVRVQTDDFDVGAETKVLTKGRTDIGAVVTFTGTVRGNDTPISSMTLEHYPGMTETELERVEAEAAARWPLAASLIIHRYGTLKPGDNIVLVITASAHRQAAFQAAEFLMDYLKSRAPFWKKETDDEGGEWVDARESDDKAAARWQTPS 153
193 6.000e-80gi|738602681|ref|WP_036513139.1| hypothetical protein [Nitrincola nitratireducens]  clstr ali  40  2IRIRVQPEVFNAGQEIDAITHARSDIGAVVNFIGYVRDFNEDVVALTLEHYPGMTEQSLQEIAKSAQERWPLEAITIIHRIGRLTPGDPIVLVAVASAHRQAAFDACNFVMDYLKTQAPFWKKEHSRSGDYWVAARHSDSDAVRRWENA. 152
194 6.000e-80gi|648287459|ref|WP_026068608.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas smyrnensis]  clstr ali  46  3.RVRVQQQAFDAGEEQRRLIEARTDIGAVVGFTGLVRDFNERVQALSLEHYPGMTEAALEAIVDEAESRWPLQGVRVIHRIGRLAPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHTASGDYWVAERQTDHRDAERWEVSS 153
195 6.000e-80gi|736862803|ref|WP_034862641.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacteriaceae bacterium B14]  clstr ali  42  5.RISVQQAAFDVGEEYRWL-AECDDDGAIVTFTGKVRNHGDNVSALTLEHYPGMTEKAMENIVAEARQRWPLQRVTLIHRIGELFPGDEIVFVGTTSAHRSASFEAAEFMMDYLKTQAPFWKREAIPEGDRWVESRDSDQKAAERW.... 150
196 6.000e-80gi|652565514|ref|WP_026959003.1| hypothetical protein [Aliagarivorans taiwanensis]  clstr ali  41  1.MISVQKEDFDVAALYQALQQ-NPSSGAVVTFTGLVRDLGTAVNALFIEHYPGMTERALSDIVEQAKQRWPINDVAVVHRVGRLEVNQQIVFVGVNSAHRQAAFDACEFIMDYLKTSAPFWKKELSDQGEQWLEQRESDRVASKRWS... 147
197 7.000e-80gi|1001858641|gb|AMM25870.1| molybdenum cofactor biosynthesis protein MoaE [Variovorax sp. PAMC 28711]  clstr ali  41  5.RVLVQTADFDIGAEIATLRAAQPAVGAVCSFIGTVRDRNDGVASMELEHYPGMTEKAIDAMIDEAERRFGLLGVRVIHRVGLLQPQDQIMMVAVVSAHRAESFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARVADDAALARWGIDA 155
198 7.000e-80gi|738638373|ref|WP_036547769.1| molybdenum cofactor biosynthesis protein MoaE [Nitrincola lacisaponensis]  clstr ali  44  4..IRVQAQRFDCGVELEALSQQRTDVGAVASFIGYVRDFNEDVVALTLEHYPGMTEQQLRLIAEQAARRWPVLAATIIHRVGRMEPGDPIVLVAVASAHRQAAFDACNFIMDYLKTEAPFWKKEHTRTGDYWVSSRESDTLAAQRWEK.. 151
199 7.000e-80gi|668679905|gb|KFB73423.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-91]  clstr ali  43  1MMVRVQEADFDVGAELAALRRDRPQIGALASFVGVVRADSDGVSEMTLEHYPGMTEKALAAMVGEAGRRWKLIDAIVIHRVGRLLPGDQIVLVAVAGAHRGEAFAACEFLIDYLKTRAPFWKREVTPQGARWVAARASDDQAAERWR... 149
200 7.000e-80gi|500089284|ref|WP_011765297.1| molybdenum cofactor biosynthesis protein MoaE [Azoarcus sp. BH72]  clstr ali  45  1MSISVQEEDFDVGAEIDALTAGRVDVGAVASFVGLVRDEGSGVSAMTLEHYPGMTEQALADIVAEAEARWRLNAVRVIHRYGRLVPGNRIVFVAVAGAHRGEAFAACEFIMDYLKTRAPFWKREETPQGARWVDAREGDAAAAARWGTGG 152
201 8.000e-80gi|504058685|ref|WP_014292679.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Oceanimonas sp. GK1]  clstr ali  39  1.MIRVQTEDFCLATEYAALSQSH-QTGAVVTFVGKVREMNQGVSGMTLEHYPGMTEHALAQIVSEAQGRWPLLECRVIHRVGALELGDQIVFVGVASAHREAAFAACHFIMDYLKTRAPFWKKERTADGERWVDAKDSDTDAARKW.... 146
202 9.000e-80gi|1011622530|ref|WP_062472978.1| molybdenum cofactor biosynthesis protein MoaE [Variovorax boronicumulans]  clstr ali  40  6.RVSIQTADFDAGAEIAALRAADARVGAVCSFIGTVRDRNDGIASMELEHYPGMTEKAIEAMIDEAHRRFDILGARVIHRVGLLQPLDQIMMVAVVSAHRGQSFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARVTDDEALARWGIAA 156
203 9.000e-80gi|652944086|ref|WP_027197566.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia sprentiae]  clstr ali  41  1MPVRVQTEDFDLSAEVAALRARNPKIGALACFVGTVRDVNEGVETMELEHYPGMTEKSLEAIVERARERWRGIEVLIVHRVGKLYPLDQIVLVATTAAHRGDAFASCEFVMDYLKTEAPFWKKEKTDAGERWVDARVTDDAALARWRTEA 152
204 9.000e-80gi|364565467|gb|EHM43193.1| molybdopterin converting factor, subunit 2 [Hafnia alvei ATCC 51873]  clstr ali  42  7.RIRVGQENFSVGDEYQWLSQC-EDDGAVVTFTGKVRNHGDNVSALTLEHYPGMTEKALGEIVAEARERWPLQRISLIHRVGAMYPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATEQGDRWVDARDSDHQAAKRW.... 152
205 9.000e-80gi|495895919|ref|WP_008620498.1| molybdopterin converting factor, large subunit [Magnetospirillum caucaseum]  clstr ali  42  1MAIRVQREDFDPGAELERFSSGRTDVGGICLFVGLVRDYGAAVNAMTLEHYPGMTERQLEAIEAEARGRWPLDDALVIHRYGKLEPGERIVLVAASSAHRDAAFEACRFLIDWLKTKAPFWKVEHTPEGDAWVDAKESDDAAASRWDR.. 155
206 1.000e-79gi|495124258|ref|WP_007849071.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. CF316]  clstr ali  41  8.SVSIQTEDFDLSAEVAALRHGDRRVGAVCAFVGTVRDDGDDVASLELEHYPGMTEKSIAAMVDAAFGRFELFGVRVIHRVGLLQPLDQIVLVAVTSAHRGQSFEACEFLMDYLKTQAPFWKKEVTPAGARWVDARVSDDAALARWCIAA 158
207 1.000e-79gi|666638908|ref|WP_031356458.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia sordidicola]  clstr ali  43  3.RVRVQEADFDLSTEVAALRADNPKVGAVACFVGTVRDLNEGVQAMELEHYPGMTEKALEGIAAQARERWPGSDVLIVHRVGKLLPLDQIVLVVTTAMHRAQAFESCAFVMDYLKTQAPFWKKETTEHGEKWVDARESDDAALSRWD... 150
208 1.000e-79gi|746337945|ref|WP_039383330.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. PSNIH1]  clstr ali  42  4.RIRVGPEPFDTGAEYRLLAADDRD-GAIVTFTGKVRNHGADVAALTLEHYPGMTEKALAEIAEAARQRWPLQQITVIHRVGELFPGDEIVLVGVSSAHRGSAFAAAEFIMDYLKTRAPFWKREATPEGDRWVDARDSDHQAAARWE... 150
209 1.000e-79gi|922032402|ref|WP_053310202.1| molybdopterin synthase catalytic subunit [Vibrio alginolyticus]  clstr ali  40  4.RVSVQQDDFSVDAEYQYLSEG-TAAGAVVTFIGKVRDMGDNVIGLSLEHYPGMTEKSLSEICDQAELRWPLQKIRVIHRVGDMDIGEQIVFVGVTSAHRGSAFEACEFIMDYLKTKAPFWKKERTTHETRWVDSRDSDAKAAARWQR.. 151
210 1.000e-79gi|515590231|ref|WP_017022891.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Aliivibrio logei]  clstr ali  39  1.MISVQEHDFNVGDEYTLLAEG-TASGAVVTFIGKVRDMGDDVTGLSLEHYPGMTEKSLNDIVAQSKERWPLLKVKVIHRVGDLELGDQIVFVGVSSAHRGAAFESCEFIMDYLKTNAPFWKKERTTKEVRWVESRDTDKSAAQRWEK.. 148
211 1.000e-79gi|260072594|gb|ACX30493.1| molybdenum cofactor biosynthesis protein E [uncultured SUP05 cluster bacterium]  clstr ali  37  3.KINIQKKDFDLTLEVNLARGDDSDIGAVVSFVGTVRDLDDPIQKMTLEHYPGMTEKALESIATQAQGRWPLGNITIIHRVGDLDINDQIVLVVTTSKHRKSAFEACEFIMDYLKTQAPFWKKEHTTNESKWVEAKDNDNDAASRW.... 148
212 1.000e-79gi|124259515|gb|ABM94509.1| molybdopterin synthase subunit MoaE [Methylibium petroleiphilum PM1]  clstr ali  41  11.RVTIQTEDFDLSSEVAALRAHQRGVGAVASFVGTVRDRNDGVSRMELEHYPGMTERAIEAMIDAAFARFDLLGARVIHRIGPLEVGEQIVLVVVSSAHRGQAFQACEFLMDYLKTQAPFWKKEQTPQGARWVDARVADDDALRRWGIAA 161
213 1.000e-79gi|516372172|ref|WP_017762205.1| molybdenum cofactor biosynthesis protein MoaE [Pseudacidovorax intermedius]  clstr ali  41  6.RVRIQTEDFDLSTEVALLRAGNAGVGAVCAFIGTVRDHSDGVAAMELEHYPGMTESSIEAMIDEAHRRFDILGARVVHRVGPLQPTDQIMMVAVVSAHRGQSFEACEFLMDYLKTQAPFWKKESTPDGARWVDARVSDDRALSRWG... 153
214 1.000e-79gi|656256926|ref|WP_029203241.1| molybdopterin synthase catalytic subunit [Vibrio genomosp. F6]  clstr ali  38  4.RVSVQYDDFSIADEYEILAKG-TSAGAVVTFVGKVRDMGDNVIGLRLEHYPGMTEKSLAEICDQAEARWPLLGVRVIHRVGDLDIGDQIVYVGVSSAHRGASFEACEFIMDYLKTSAPFWKKERTTQESRWVESRDSDAKAAERWEN.. 151
215 2.000e-79gi|749452890|dbj|GAM65877.1| molybdenum cofactor biosynthesis protein moaE [Vibrio sp. JCM 19232]  clstr ali  39  3.KILVQTEDFNLANEYELLGQDS-GVGAVVTFVGKVRDFGDNVIGLHLQHYPGMTEKSLQEIAVQARDRWPLDKVTIVHRVGDLNISDQIVFVGVSSAHRDAAFASCEFIMDYLKTKAPFWKKERLNEGSRWLDARESDEESATRWDER. 151
216 2.000e-79gi|739091001|ref|WP_036961964.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Providencia alcalifaciens]  clstr ali  41  5.HIAVQTENFSVGEQYSWLAQDSDSDGAVVTFTGKVRNHGDSVAALTLEHYPGMTEKALSDIVMQSRERWSLQRVSVIHRIGTLQPGEEIVFVGVTSAHRNAAFQAAEFIMDYLKTKAPFWKKESLPDNERWVEAKESDEASANRW.... 152
217 2.000e-79gi|780040524|ref|WP_045447937.1| molybdenum cofactor biosynthesis protein MoaE [Tepidicaulis marinus]  clstr ali  44  1MSISVQLEDFDIKAETEKVTAGRTDIGALVTFTGLARDHAGTVEAMELEHYPGMTERELERIEKEAHERWQLQASRIIHRYGPLHPGEQIVLVITASAHRKDAFEAAEFLMDWLKTKAPFWKKETGPSGTHWVDAKVSDDEAAARWQK.. 150
218 2.000e-79gi|652911636|ref|WP_027165586.1| molybdopterin synthase catalytic subunit [Mesorhizobium sp. WSM3224]  clstr ali  49  9..IRIQREDFDVAAEIAGLTRGRADIGAVVTFSGLCRDEQGALSALELEHYPGMAEAEIGRIAAEAVERWPLQGLTVIHRHGKIAPGENIVLVVAASSHRQAAFEAANFLMDYLKSRAPFWKKEHLADGSQWVEAKEADDHAADRWTKP. 157
219 2.000e-79gi|737638296|ref|WP_035608329.1| molybdenum cofactor biosynthesis protein MoaE [Hylemonella gracilis]  clstr ali  40  5.RVSIQTCDFNVATEIAALRARDARVGAVCSFIGTVRDRNGGVSAMELEHYPGMTEQAIEGMIDEAQRRFDIYAARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPQGARWVDARVSDDEALARWGISA 160
220 2.000e-79gi|947774388|ref|WP_056436170.1| molybdenum cofactor biosynthesis protein MoaE [Massilia sp. Root335]  clstr ali  41  11..IRVESADFDVSTELARLRAGDARVGAVVSFVGTVRDMNDGVAELELEHYPGMTERALHDIVEQARGRWPLYGVVVVHRIGPMRPLDQIVLVACTAAHRGEAFAACEFIMDYLKTDAPFWKKEQTPNGARWVDARVTDDTARAKW.... 156
221 2.000e-79gi|497445209|ref|WP_009759407.1| molybdenum cofactor biosynthesis protein MoaE [Roseibium sp. TrichSKD4]  clstr ali  44  6.SVRVQAENFDLTEETAKLTAGRFDIGAVVTFTGLCRDEGGQLSALELEHYPGMAEAEISRIAERAAERWPITGLTVIHRFGKIAPGENIVLVIAASPHRQAAFDAANFLMDFLKTRAPFWKKEHLKSGQDWVDAKDLDEQALTRWEQA. 155
222 2.000e-79gi|119449975|gb|EAW31211.1| Molybdopterin biosynthesis MoaE [marine gamma proteobacterium HTCC2143]  clstr ali  40  6MSVSVQQQDFDVSAELRRLRDQSAQVGAVASFVGVVRDINDSVSVLELEHYPGMTEQSIADIIIMAGERWQLVGARVIHRVGKLLPTDQIVLVAVTSRHRGDAFAACEFIMDYLKTRAPFWKKEQTEEGARWLDARSADQAAVDRWEQS. 156
223 2.000e-79gi|654835318|ref|WP_028288036.1| molybdenum cofactor biosynthesis protein MoaE [Pseudooceanicola nanhaiensis]  clstr ali  45  1MRVVVQSEPFDLGALTAGFAAGRSDMGAVVSFTGIVRDTDGRLDRMEIEHYPGMTERAIATIAEEAQARWSLGDVLVIHRHGTLRPGELIMMVATCSPHRGDAFAAAEFLMDYLKSRAPFWKKELTADGAAWVAAKPEDEDALSRWTR.. 148
224 2.000e-79gi|497224573|ref|WP_009538835.1| molybdenum cofactor biosynthesis protein MoaE [Caenispirillum salinarum]  clstr ali  46  1MAVRVQREDFDVGAEMAAFCAGDTSVGAVASFVGLVRADSGAVSAMTLEHYPGMTERQLEAIEADARERWPLHDVLVVHRYGRMEPGERIVLVLTASSHRQAAFDACAFLMDWLKTKAPFWKLEETPNGGRWVDARESDDAAAARWGGD. 154
225 2.000e-79gi|558558187|ref|WP_023489228.1| molybdopterin synthase catalytic subunit [Serratia sp. DD3]  clstr ali  43  5.RIRVGAAPFSVGEEYPWLAECN-DDGAVVTFTGKVRNHGDQVSALSLEHYPGMTEKALGEIVAQARSRWSLQRVTVIHRVGDLFPGDEIVFVGVSGAHRSEAFDAAEFIMDYLKTRAPFWKREATGQGERWVEARDSDQQAAKRW.... 150
226 2.000e-79gi|764529776|ref|WP_044408203.1| molybdenum cofactor biosynthesis protein MoaE [Thioalkalimicrobium microaerophilum]  clstr ali  41  9..VRVQQDDFDLTTEVNWLRNEHADVGAVVAFVGTVRDEGDDIQQLELEHYPGMTEKALEAIRQQAHQRWSLESSLIIHRIGKMQPKDQIVLVAVASRHRENAFEASHFIMDYLKTNAPFWKKEWTPEGERWVDARLSDEQAIQRWLKD. 157
227 2.000e-79gi|928870188|ref|WP_053909012.1| molybdenum cofactor biosynthesis protein MoaE [Moellerella wisconsensis]  clstr ali  40  5.HISVQMDNFSLAEQYEWLSRCDSD-GAVVTFTGKVRNHGDEVSLLTLEHYPGMTEKALNNIVEEARKRWPLQRVSVIHRVGTLAPGDEIVFVGVTSSHRSAAFEAAEFIMDFLKTKAPFWKKEKLPTNERWIEAKDSDKQSAERWK... 151
228 3.000e-79JCVI_PEP_1096690520567 /source_dna_id=JCVI_ORF_1096690520566 /offset=0 /translation_table=11 /length=169 /full_length=169  ali  41  6.SVQIQYEDFDLCREVAQLRQPDPGVGAVVSFLGTVRDRDEGISSLELEHYPGMTESAIQAMIDQARSRFDIRAVRIIHRIGVLNPQDQIVLVAVASAHRGQAFDACEFLMDYLKTQAPFWKKQSSPEGAAWVDARQSDDTAAHRWGLPG 157
229 3.000e-79gi|739592374|ref|WP_037449967.1| molybdenum cofactor biosynthesis protein MoaE [Skermanella stibiiresistens]  clstr ali  40  1MAIRVQREDFDVGAELAALTENNHGIGGVTSFVGLVREMGGGPSAMTLEHYPGMTERQLAEIEAEASRRWKLDATLIIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTRAPFWKLEETAKGSHWVEAKEGDDIAASRWAE.. 148
230 3.000e-79gi|914669474|ref|WP_050660099.1| hypothetical protein [Gallaecimonas pentaromativorans]  clstr ali  36  4.HIGVQTEDFSLAEQYALLCQQNRQDGAVVTFVGLVRDMNQGVTGLTLEHYPAMTNKVLADIVVQARARWPLGRVRLIHRVGPLDLGDQIVFVGVSAGHRGDAFAACEFIMDFLKTQAPFWKKERSTQGEYWVEARQQDQHKAGRWGDKS 154
231 3.000e-79gi|500118386|ref|WP_011794391.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax citrulli]  clstr ali  40  18.RVSIQPQDFDVSAELAALRARDGRVGAVCCFVGTVRDDGDAVAAMELEHYPGMTEKSIEAMVDEALGRFDIFGARVVHRVGLLAPQDQIVMVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPLGARWVDARVSDDAALARWGIVS 168
232 4.000e-79gi|504592137|ref|WP_014779239.1| molybdenum cofactor biosynthesis protein MoaE [Thiocystis violascens]  clstr ali  44  3.RVQIQTEPFDIAAEQESLWHGNPRVGALVTFVGLMRDEGVAVSRMTLEHYPGMTEKALAEIAEEANARWKLEGVTIVHRLGKLEPQDPIVFVGVASHHRGDAFRACEFLIDYLKTRAPFWKKEQTEQGERWVESKVSDDVAARRW.... 149
233 4.000e-79gi|495318206|ref|WP_008042953.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Reinekea blandensis]  clstr ali  38  4..IRVQQDDFSVQREYDGLCRENTDDGAVVFFVGRVRDEGDTVTGMFLEHYPGMTEKTLQSIADEARHRWPLNRIRIVHRVGALNPSDQIVFVGVSSPHRGAAFDGAQYIMDFLKTRAPFWKKESTPEGDRWVDARSSDTEQENRW.... 149
234 4.000e-79gi|932308937|ref|WP_054310957.1| molybdopterin synthase catalytic subunit [Mesorhizobium sp. 1M-11]  clstr ali  52  8.KISIQAQDFDIAAEIATLGAGRTDIGAVVTFSGLCRDEDGMLAALELEHYPGMAEAEIRRIAADAVGRWPLQGVTVIHRHGRIRPGENIVLVVTASAHRRAAFEAADFLMDYLKSRAPFWKKEHRADGTEWVEAKESDEQAATRWR... 155
235 4.000e-79gi|495142255|ref|WP_007867062.1| molybdenum cofactor biosynthesis protein MoaE [Polaromonas sp. CF318]  clstr ali  42  5.RVLITTDDFNLADEVAALRAGDKRVGAVCTFTGTVRDRNDGVSSMELEHYPGMTEKAIEAMIDEAMARFDIFGARVVHRVGLLQPLDQVVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVADDAALAKWGITA 155
236 4.000e-79gi|800967408|ref|WP_045994198.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. S2151]  clstr ali  42  1.MIRVQHETFDAGHEQRRMLEHRTDIGAVVSFTGLVRDFNEDVTALTLEHYPGMTEASLSEIEAEARQRWPLDEVTLIHRIGRLEPGDPIVLVVVASAHRRAAFEACEFLMDHLKTRAPFWKKEHTESGDYWVSERRQDHDDAKRWEVAS 151
237 4.000e-79gi|827202572|ref|WP_047194785.1| molybdenum cofactor biosynthesis protein MoaE [[Polyangium] brachysporum]  clstr ali  41  5.RVRIQSADFDLSTEVAALRAADRGVGAVVSFVGTVRDHSDGVATMELEHYPGMTEKAIDGMIDQAFARFRIRAARVVHRVGRLQPADQIVLVAVASAHRADAFQACEFLMDYLKTQAPFWKKEQTPDGARWVDARTSDDAALARWG... 152
238 5.000e-79gi|653000583|ref|WP_027252786.1| molybdopterin synthase catalytic subunit [Photobacterium halotolerans]  clstr ali  36  4.KICVQAEDFSLALEYQALAEGN-QAGAVVTFVGKVRDMGESVSTLTLEHYPGMTEKSLLFIVEQAKSRWPVLAATVIHRVGQLTAGDQIVFVGVSSAHRGAAFQACEFIMDYLKTEAPFWKKEVREGETSWVDARETDQQARQRWHK.. 151
239 5.000e-79gi|835388006|ref|WP_047485654.1| molybdenum cofactor biosynthesis protein MoaE [Methylibium sp. CF059]  clstr ali  38  4VRVAIQTHDFDLSAEVAALRARDAGVGAIVSFVGTVRDDGKGVTRMELEHYPGMTERSIESMIDAAHARFDIRGVRVIHRVGPLQLQDQIVLVAVTSAHREQAFKACEFLMDYLKTQAPFWKKEHTPEGAHWVDARVGDDDALARWGITS 155
240 5.000e-79gi|497323402|ref|WP_009637615.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia sp. M24T3]  clstr ali  42  5.RIVVDAAPFSVGEEYQWL-AQSDSDGAVVTFTGKVRNHGDSVSALTLEHYPGMTEKALAEIVEEARQRWPLQRVSVYHRVGALFPGDEIVFVGVTSAHRGMAFDATEFIMDYLKTRAPFWKREATEQGDRWVESRESDKTAASRWSSSS 154
241 5.000e-79gi|40063018|gb|AAR37874.1| molybdopterin converting factor, subunit 2 [uncultured marine bacterium 560]  clstr ali  34  3.KIVVQTEDFDLTTEVAHTRSNNPQIGAIVSFIGTVRDHPGSISSMTLEHYPEMTEKSLKSIVTEARERWDLQNITIIHRIGKLKVNDQIVLVVTTSKHRQAAFESCHFIMDYLKTDAPFWKKESTEQKEEWVESRESDDEQKKRWQ... 149
242 5.000e-79gi|490543038|ref|WP_004408162.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio nigripulchritudo]  clstr ali  36  4..VSVQKEDFSLADEYDVLAQG-TSSGAVVTFVGKVRDMGDNVIGLSLEHYPGMTEKSLESLCEQAKQRWSIENIRVIHRVGDLDIGDQIVFVGVSSAHRGDAFNACEFVMDYLKTQAPFWKKERTTDSVRWVESRESDAAAASRWAEQG 152
243 5.000e-79gi|971094447|emb|CRI65042.1| Molybdopterin-converting factor subunit 2 (MPT synthase subunit 2) (Molybdopterin synthase subunit 2) (Molybdenum cofact  clstr ali  40  3.RIRVQRDLFDIAEEQKILSRDKPQVGAVVTFIGLMRDINEGVAAMTLEHYPGMTEKALGAIAEEAAQRWDLEDISILHRVGELRPQDPIVFVGVSSRHRGDAFSACEFLIDYLKTRAPFWKKEQTAQGERWVDARVTDDEAARRWAEVS 153
244 5.000e-79gi|750390290|ref|WP_040672200.1| molybdopterin synthase catalytic subunit [Nitratireductor indicus]  clstr ali  46  8.TVRVQQEDFDLSEEVAALTAGRRDVGAVVSFAGLCRDENGRLTALELEHYPGMAEAEISRIAAEALGRWPLTGLTVIHRFGKILPGGNIVLVVASSEHRRAAFEAADFLMDFLKSKAPFWKKEHTVDGTQWVTAKDSDEEDIKRWK... 155
245 5.000e-79gi|503463614|ref|WP_013698275.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Burkholderia]  clstr ali  44  5.RARVQTGDFEVGAELAALRARNPKIGAVACFVGTVRDEGETVAALELEHYPGMTEKALEAIADEAIARWPGIEVAIIHRVGRLLPLDQIVFVATVAAHRGDAFASCEFVMDYLKTEAPFWKKESTPSGERWVDARSSDDAALARWGLRS 155
246 5.000e-79gi|497236200|ref|WP_009550462.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderiales bacterium JOSHI_001]  clstr ali  42  4.RVRIQTEDFDLGTEVAAVRAGNPAVGAVAAFVGTVRDRNAGISAMELEHYPGMTEKAIEAMIDDAMRRFRVLGARVIHRVGPLKPLDQIVLVVVTSTHRGDAFQACEFLMDYLKTQAPFWKKETTPEGARWVDARVADDAALARWGITA 156
247 6.000e-79gi|492246237|ref|WP_005788105.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas synxantha]  clstr ali  47  1MPIQVQTELLDLGELTRSVHAEDPGVGAVATFVGYVRDQGDQVSALFLEHYPGMTERALQLIVDQAHERWPLQRVSIVHRVGPLKVGEPIVFVGVASQHRLDAFEACAFLMDYLKTRAPFWKREQTPAGERWVEGRESDRLAQERW.... 148
248 7.000e-79gi|503200500|ref|WP_013435161.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia rhizoxinica]  clstr ali  43  1MTVSVQARDFDVTTELARLRARNPRIGAVVSFVGTVRELSDGISALELEHYPGMTERALEAIVAEAERRWAGIDVCVVHRYGRLDAGEQIVLVAVAAAHRGDAFAACEFVMDYLKSNAPFWKKERTEQGERWVDARATDDAALARWGIAS 152
249 7.000e-79gi|928926989|ref|WP_053951916.1| molybdopterin synthase catalytic subunit [Candidatus Thioglobus autotrophica]  clstr ali  37  3.KIIVQKSDFDLTTEVTLARANDSDIGAVVSFVGTVRDEHSSIQSMTLEHYPGMTEKALNTIAEQAQKRWPLGNTTIIHRVGKLSINDQIVLVVTTSKHRKAAFEACEFIMDYLKTQAPFWKKEQTNEQSKWVEAKDSDTDQMDKW.... 148
250 7.000e-79gi|491575876|ref|WP_005433453.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Sutterella]  clstr ali  40  5.TIRVSEADFNPGEEIERLIESSPEAGGVASFVGVVRNRNDGVTHLTLEHYPAMTERALAGIVERARARWDVCGVTVIHRVGEMAVGEHIVLVVVTSAHRREAFEACEFIMDWLKTEAPFWKKERTPEGERWVDARESDEEARRRWGEAA 155
251 8.000e-79gi|970441097|ref|WP_058722276.1| molybdenum cofactor biosynthesis protein MoaE [Paucibacter sp. KCTC 42545]  clstr ali  38  9.RVRIQSEDFDLSQETLALRADDGGVGAVVSFVGTVRDQVGGLSQMELEHYPGMTEASIEAMVDEAFQRFNIRGARVIHRVGVLPACAQIVLVLVSSAHRGEAFQACEFLMDYLKTQAPFWKKETLASGARWVDARVTDDAALARWGIQS 159
252 8.000e-79gi|847180396|ref|WP_047964557.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus khoisanae]  clstr ali  41  5.RISVQREIFNVGDEYQWLSQCDED-GAVVTFTGKVRNHGDNVKALTLEHYPGMTEKMLRTIADEARQRWSLQRISIIHRVGELYPGDEIVFVGVTSSHRSMAFTAAEFIMDYLKTKAPFWKKESLTKGERWVETRKSDEDAANRW.... 150
253 8.000e-79gi|736915643|ref|WP_034913533.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia sp. 9145]  clstr ali  43  4.RIRVGQAPFDMAEEYRWLAACDED-GAVVTFTGKVRNHGDNVSALTLEHYPGMTEKALEEIVTEARTRWPMQRATVIHRIGELFPGDEIVMVGVSGAHRGSAFAAAEFIMDYLKTRAPFWKREATPEGERWVESRDSDRDAAARWQQ.. 151
254 9.000e-79gi|654496965|ref|WP_027966747.1| hypothetical protein [Halomonas halocynthiae]  clstr ali  44  1.MIDVQYETFDVGAEQRAMLAGRCDIGAVVSFTGLVRDINEDVQGLILEHYSGMTEKALNNIVCEAKARWPLQAVRIIHRIGHLVPSDPIVLVMVASAHRRDAFLACDFLMDYLKTRAPFWKKEQTASGDYWVAERDSDQQDAKRW.... 147
255 9.000e-79gi|836619754|ref|WP_047770239.1| MULTISPECIES: hypothetical protein [Xenorhabdus]  clstr ali  39  5.RISVQQETFSVGEEYQWLSQCDED-GAVVTFTGKVRNHGDSVKALTLEHYAGMTEKMLQKIVDEARQRWTLQRVSIIHRIGELSPGDEIVFVGVTSSHRNMAFMAAEFIMDYLKTKAPFWKKESLVEGERWVEARQSDQDAVSRWKNS. 153
256 1.000e-78gi|759662015|ref|WP_043379623.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas aquatica]  clstr ali  42  5.RVLIQHQDFDVSAELAALRAGDARVGAVCSFVGTVRDRNEGVSAMELEHYPGMTEKCIEAIIDRAVARFGIFGARVIHRIGPLQPLDQIVLVAVTSAHRGMSFQACEFIMDYLKSEAPFWKKEQIPEGARWVDARVSDEQALARWAQ.. 153
257 1.000e-78gi|499718234|ref|WP_011398968.1| molybdenum cofactor biosynthesis protein MoaE [Hahella chejuensis]  clstr ali  40  5IRIDVTTDDFDLGEETRRLTDGDTAVGAVCSFVGLVRDFSDDVKGLYLEHYPAMTEKSLTKIAKEAFQRWDLNGVRVIHRVGELWAGDQIVLVVTASAHRGDAFAACEFIMDYLKVQAPFWKKELTAEGEHWVEAKESDQVRAGEWSSE. 155
258 1.000e-78gi|740239006|ref|WP_038080109.1| molybdenum cofactor biosynthesis protein MoaE [Thioclava pacifica]  clstr ali  50  1MKISVQTEPFDLGTEMAGFGTGREDVGAVVSFTGIVRDDTGAMDALELEHYPGMTERAIAKIVGEAIERWKLADVIVIHRHGRLGVGEQIMMVATAARHRVAAFEAAEFLMDYLKSRAPFWKKEHGPEGTSWVAAKDEDEDALKRW.... 146
259 1.000e-78gi|495194158|ref|WP_007918948.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Pseudomonas]  clstr ali  43  1MAIRVQHKSFDVGQLTADLHARNPRVGAVVNFVGYVRDMGQSVNELFLEHYPGMTEKALEQIAEEARERWPLLGVEIVHRVGALSVSEPIVFVGVSSKHRHMAFEACAFIMDVLKTRAPFWKRETTPEGSHWVEGRESDRDAALRWS... 149
260 1.000e-78 GL0028585 [Complete] locus=scaffold64266_1:3615:4124:-  ali  39  1MKIAVQTEDFDVQAEVAALH-GSPKVGAVVMFLGTVRDEGDEVASMTLEHYPGMTEKALTAIVKEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSKWSKEA 151
261 1.000e-78gi|652656762|ref|WP_027016863.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas composti]  clstr ali  45  5.RVFIQTQDFDVSAELAALRAGDAGVGAACCFVGLVRDEGDEVASMELEHYPGMTEKSIEAIIDQAQARFGIHGARVIHRVGLLAPMEQIVLVAVTAAHRGKAFEACEYIMDYLKSLAPFWKKEQTPAGARWVDARVSDEQALERWS... 152
262 1.000e-78gi|981300972|ref|WP_059518161.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia sp. TSV85]  clstr ali  43  4..VRVQTSDFDVSTELAALRARNPKIGALACFVGTVRDLNDGIDAMELEHYPGMTEKALGAIAADALARWPGIDVAIVHRVGKLYPLDQIVLVATVAAHRGDAFASCEFVMDYLKSQAPFWKKEKTPAGERWVDARSADDAALARWGIAS 153
263 1.000e-78gi|335342349|gb|AEH33632.1| Molybdopterin converting factor, large subunit [Vibrio anguillarum 775]  clstr ali  40  5.RISVQISDFSVDAEYRDLSQG-TSAGAVVTFIGKVRDMGDNVIGLTLEHYPGMTEKALSDICDQAQARWPVQKIRVIHRIGDLDIGDQIVFVGVSSSHRGAAFEACEFVMDYLKAKAPFWKKERTTEQTRWVESRDSDAQAAQRW.... 150
264 1.000e-78gi|498913082|ref|WP_010848258.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus nematophila]  clstr ali  40  5.RIRVQRERFHVGDEYQWLSQCDED-GAVVTFTGKVRNHGDNVNALTLEHYPGMTEKMLQKIADEARQRWPVQRITIIHRIGELYPGDEIVFVGVTSSHRNMAFTAAEFMMDYLKTKAPFWKKESLAEGERWVEIKQHDQEAANRWQ... 151
265 1.000e-78gi|656025851|ref|WP_029065093.1| molybdopterin synthase catalytic subunit [Labrenzia sp. DG1229]  clstr ali  46  8.KVKVQTEDFDVRAESGLLTSGRKDVGALVSFTGLCRDEAGTLSALELEHYPGMAEGELTRIAEQAIERWPLTGLTVIHRHGKIPPGDNIVLVIAASSHRRAAFEAADFLMDYLKTRAPFWKKEHLAEGGTWVDAKTGDDKDAARW.... 154
266 1.000e-78gi|260219647|emb|CBA26492.1| Molybdopterin-converting factor subunit 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  40  10.RVRIQTEAFDLGLEISQLQAADPRVGAVCSFVGTVRDRNGSVQTLELEHYPGMTEKSIEAMVDAAFARFDIYGARVVHRVGVLQPTEGVVLVAVTSAHRGQSFQACEFIMDYLKTQAPFWKKETTPEGAHWVDARVSDDEALARWGITA 163
267 1.000e-78gi|640183665|ref|WP_024814445.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. JHL-3]  clstr ali  38  5.RVSIQTEDFDVSTEIAALRHENKGVGAVCSFVGTVRDDSDAVASMELEHYPGMTEKSIEAMVDEAMRRFDIFGARIIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEETAQGARWVDARVSDDAALARWGIDA 182
268 2.000e-78gi|947999149|ref|WP_056658615.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobacter sp. Root1221]  clstr ali  42  3.RVTVQAADFDLSTEVAALRRGDGGVGAVVSFVGTVRDAGQGVLRMELEHYPGMTEASIEAMIGAAEARFDLRAVRIIHRVGALEAGDQIVLVAVSSAHRGQAFQACEFLMDYLKTQAPFWKKEHTPEGAHWVDARTTDDEALRRWGLDS 153
269 2.000e-78gi|654527170|ref|WP_027995298.1| molybdenum cofactor biosynthesis protein MoaE [Simplicispira psychrophila]  clstr ali  38  5.HISIQIADFDVSAELAALRANDLGVGAVCCFVGTVRDRNGAVASMELEHYPGMTEKSIEAMAAEAFRRFDILGARVIHRVGLLAPPDQIVLVAVTSPHRGESFQACEFLMDYLKTQAPFWKKEQTAAGAHWVDARISDDAALARWGIHA 158
270 2.000e-78gi|500135329|ref|WP_011811334.1| molybdenum cofactor biosynthesis protein MoaE [Verminephrobacter eiseniae]  clstr ali  40  5.RVVIQTQDFDLSSEIAALRRDNRGVGAVCSFVGVVRDRGDAVLSIELEHYPGMTEKSIEAMVDEAVRRFDIVGARVIHRVGRLQPLEQIVLVAVASAHRGQGFQACEFLIDYLKTQAPFWKKEHTPQGVRWVDARVSDDAALARWGIMA 166
271 2.000e-78gi|938892295|ref|WP_054676897.1| molybdopterin synthase catalytic subunit [Photobacterium sp. JCM 19050]  clstr ali  41  1.MISVQEQDFSVAEEYERLSQG-TESGAIVTFVGKVRDEGDDVSGLTLEHYPGMTEKCLLEIVDEAKSRWPLGQVNVIHRVGAMAPGDQIVYVGVTSAHRKAAFEAAEFVMDYLKTRAPFWKKERLGNDDRWVEARESDNHAADKW.... 147
272 2.000e-78gi|915920236|ref|WP_050929284.1| molybdenum cofactor biosynthesis protein MoaE [Aestuariivita boseongensis]  clstr ali  50  1MRIVVQEQPFDLGAEASAFASGRSDMGAVVTFTGIVRDLAGDLDVMEIEHYPGMTEAALTDIANQAQGRWDLGDVLIIHRYGRMAPGDLIMMVATASPHRKDAFEAAEFLMDYLKSRAPFWKKEHTRGGASWVAAKDEDEEALDRW.... 147
273 2.000e-78gi|971868544|ref|WP_058937432.1| molybdenum cofactor biosynthesis protein MoaE [Roseateles depolymerans]  clstr ali  37  5.RVRIQTEDFDLSAETLSLRAEDGGVGAVVSFVGTVRDGADGVTLMELEHYPGMTEASIEAMVDEAFRRFDIRGARVIHRVGPLEARAQIVLVLVSSRHRGQAFQACEFLMDYLKTQAPFWKKEHGPQGAHWVDARVTDDEALARWG... 152
274 2.000e-78gi|739584323|ref|WP_037442135.1| molybdopterin synthase catalytic subunit [Shewanella mangrovi]  clstr ali  36  5.KILVQTEDFDVAAEYARIAEDNGD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTENVLQQITAEARERWPLNLVTIIHRVGTMHLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEASPDGRHWVDARDSDEQAAKAWDN.. 152
275 2.000e-78gi|836630984|ref|WP_047780703.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pragia fontium]  clstr ali  41  8.RITVSPAAFNVGDEYQWLSQCD-DDGAVVTFTGKVRNHGDSVSALTLEHYPGMTEKSLAEIIIAARQRWPLQRVNVIHRIGELFPGDEIVFVGVTSAHRSSAFEAAEFIMDYLKTKAPFWKREATQEGDRWVDSRESDKQAAERW.... 153
276 2.000e-78gi|927432505|emb|CRN09511.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bathymodiolus azoricus thioautotrophic gill symbiont]  clstr ali  36  3.KIVVQEKDFDLSTEVALAQANDGNIGAVVSFVGLVRDLNDPIQKMTLEHYPGMTEKALQSIVDKARNQWSIGNITIIHRVGDLAVNDQIVLVVTTSKHRKNAFDACEFIMDYLKTQAPFWKKEVSKEGGKWVEAKDSDQDRIK...... 146
277 2.000e-78gi|947215407|ref|WP_055978743.1| molybdopterin synthase catalytic subunit [Aminobacter sp. Root100]  clstr ali  46  8.MVRIQAADFDVAAEIARLTQGRADIGAVVTFTGLCRDEQGSLSALELEHYPGMAEAEIARIAGEAIARWPLSGITVIHRFGRIRPGENIVLVVAASTHRQAAFDGASFLMDYLKSRAPFWKKEHRIDGSEWVDARESDEIAAARW.... 154
278 2.000e-78gi|653036070|ref|WP_027287758.1| molybdenum cofactor biosynthesis protein MoaE [Rhodovibrio salinarum]  clstr ali  37  1.MIRVQREDFDVGTELAALTQDNPGVGGMCSFVGLVRDLEGRVTAMTLEHYPGMTEKMLERIDAEAHRRWPIEASLVIHRFGRMEPGERIVLVATASAHRQAAFDSCQFLIDWLKTKAPFWKLEETPDGGRWVDARDSDDTAASRWGSD. 160
279 2.000e-78gi|493661684|ref|WP_006613001.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium sp. ORS 285]  clstr ali  41  5VTVRVQHEDFDTAAEIAALGKGRTDIGAIVSFSGLCRDHETPISALTLEHYPGMAEAEIMRHAEQAMARWPLQGLTVIHRFGRITPGENIVLVVTASSHRQAAFEAAEFLMDYLKTNAPFWKREETADGGSWVEARSHDDAAAARWTK.. 154
280 2.000e-78gi|825366436|ref|WP_047143771.1| molybdopterin synthase catalytic subunit [Mesorhizobium sp. LC103]  clstr ali  42  8.TIRIQAEDFDVAAEIARLAEGRGDVGAVVTFSGLCRDENGTLAALELEHYPGMAEAEIGRIAAQAIERWPLTGLTAIHRHGKLRPGENIVLVVAASAHRQAAFEAASFMMDFLKTSAPFWKKEHRPDGESWVEAKDQDDLARRKWTES. 157
281 2.000e-78gi|659863794|ref|WP_029911117.1| molybdenum cofactor biosynthesis protein MoaE [Hydrogenovibrio marinus]  clstr ali  40  7..VKVQKEDFDLTTEINALRKGHKDIGAVVSFVGTVRDEGDDISVLELEHYPGMTEKALEAIRLQAHERWSLQSSMIIHRIGEMMPCDQIVLVAVSSRHREAAFEAAHFIMDYLKTNAPFWKKETFPNGDRWVDARVSDKEAEARWHQP. 156
282 3.000e-78gi|674642264|emb|CEA04345.1| molybdopterin biosynthesis MoaE protein [Pseudomonas sp. 12M76_air]  clstr ali  42  2ISIQVQTAPFDPGQVTNSVHAGDPAIGALVCFTGYVRDFNQTVTGLFLEHFPGMTEKSLRRIAEEATERWALQRVHVLHRVGQLGLAEPIVFVAAASRHREDAFQACAFIMDYLKTRAPFWKKEQTSTGNHWVEGKDSDLDAAHRWSQD. 152
283 3.000e-78JGI.Meta 7008186891 SRS065099_LANL_scaffold_75854__gene_134260 moaE protein [Human Supragingival plaque microbiome from visit number 2 of su  ali  42  5..IHVQTQDFDVGAELKRXXXXXREVGAVASFVGYVRDQGDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRPRAAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQ... 161
284 3.000e-78gi|496229439|ref|WP_008943474.1| molybdenum cofactor biosynthesis protein MoaE [Oceanibaculum indicum]  clstr ali  40  1.MIRVQREDFDIGAEIAALTDGNHAIGGVASFTGLVRDMAGGIGAMTLEHYPGMTEKALARIEAEAQERWPLQASLIIHRYGRLEPGDRIVLVVTASAHRQAAFDSAMFLMDYLKTQAPFWKLEETGEGAQWVDARESDDHALARW.... 147
285 3.000e-78 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  46  7.KIVVGPQPFSVGEEYPWL-AERDEDGAVVTFTGKVRNHGDSVNALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW.... 152
286 3.000e-78gi|754622917|ref|WP_042011017.1| molybdenum cofactor biosynthesis protein MoaE [Aeromonas fluvialis]  clstr ali  40  9.RILVQRGDFSLADEYARL-ATRADTGAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALIEIVAEARCRWPLQECTLIHRIGELMLGDQIVLVAVSSAHRDAAFDACHFIMDFLKTRAPFWKKELTAEGQRWVEAKESDNAAAARWQQPG 159
287 3.000e-78gi|972925882|gb|KUJ76374.1| molybdenum cofactor biosynthesis protein MoaE [Ruegeria sp. ZGT118]  clstr ali  48  1MRIAVQESSFDLGAEANAFAAGVAGCGAVVTFTGIVRDVAGDLDVMEIEHYPGMTEKAISKIAEEAKSRWSLGDVLVIHRYGRLAPGEQIMMVATAARHRKDAFEAAEYLMDYLKSRAPFWKKEFTSDGAEWVESKDEDEDALRRW.... 147
288 3.000e-78gi|960354431|ref|WP_058247466.1| molybdenum cofactor biosynthesis protein MoaE [Tropicibacter naphthalenivorans]  clstr ali  47  1MRIVVQEQPFDFGAEADKFANGRHDMGAIVTFTGVVRDVEGGLSTMEIEHYPGMTERALEKIAQEASQRWSLGDVLVIHRYGPMAPGDKIMMVATAARHRKDAFEAAEYLMDYLKSRAPFWKKEHTGKDAGWVAAKDEDEDALKRW.... 146
289 3.000e-78gi|640278743|ref|WP_024848524.1| molybdopterin synthase catalytic subunit [Aminobacter sp. J41]  clstr ali  44  9..VRVQAEDFDAAQEIARLTAGRTDIGAVVTFSGLCRDENGALSALELEHYPGMAEAEISRIANEATERWPLTGLTVIHRYGMMRPGDNIVLVVAASSHRQAAFEAASFLMDFLKTRAPFWKREHRADGTEWVAAKEEDDAAQARWR... 155
290 4.000e-78JCVI_PEP_1096695085025 /source_dna_id=JCVI_ORF_1096695085024 /offset=0 /translation_table=11 /length=206 /full_length=206  ali  41  47.RVLIQTADFDVSAEIDALRAQDLRVGAVCSFVGTVRDTQDEVQAMELEHYPGMTEKSIEAMIDEAHTRFDFYGARVVHRVGRLLPADQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGAHWVDARVSDDAALARWGIQA 202
291 4.000e-78gi|517238318|ref|WP_018427136.1| molybdenum cofactor biosynthesis protein MoaE [Hoeflea sp. 108]  clstr ali  45  8.MVRIQAADFDVAQEIGRLTAGRADVGAVVTFTGLCRDEAGTLSALELEHYPGMAEAEISRIAAEALERWPLSGMTAIHRFGRVRPGENIVLVVAASKHRQAAFEAASFLMDYLKSRAPFWKKEHRADGSAWVDAKESDEAAAARWARP. 157
292 4.000e-78gi|563834250|ref|WP_023800669.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium sp. L48C026A00]  clstr ali  48  8.TVRIQAEDFDVAAEIARMTQGRADIGAVVTFSGLCRDEAGRLAALELEHYPGMAEAEIGRIAAEAVQRWPLQGLTAIHRHGRIAPGENIVLVVAASAHRQAAFEAANFLMDYLKSRAPFWKKEHHTDGSEWVDAKEADDEAASRWKRA. 157
293 4.000e-78gi|502353039|ref|WP_012770224.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Dickeya chrysanthemi]  clstr ali  41  4.RIRVGQEPFSVGDEYAWL-ATSDMDGAVVTFTGKVRNHGDHVSALTLEHYPGMTEKALAEIVDDARQRWPIQRVSLIHRVGALFPGDEIVFVGVSGAHRQASFDAAQFIMDYLKTRAPFWKREATSDGDRWVDARDSDRQAAERWS... 150
294 4.000e-78gi|817131040|ref|WP_046503557.1| molybdenum cofactor biosynthesis protein MoaE [Kiloniella litopenaei]  clstr ali  41  1.MIRVQEKDFDVGQEIRNLTLGNHAIGGVASFLGLVRDIAEEISAMTLEHYPGMTEKMLAEIEAEANRRWELDASLIIHRYGRMEPGEQIVLVITCSKHRKAAFESCEFLMDYLKTKAPFWKLEETPEGGKWVDARDSDDTAASRW.... 147
295 4.000e-78gi|928978905|ref|WP_054003260.1| molybdenum cofactor biosynthesis protein MoaE [Shimia sp. SK013]  clstr ali  45  1MKIAVQSEPFDLGAEASAFASGHRDMGAIVTFTGVVRDLAGDLDRMVIEHYPGMTLKALEKIANEARERWSLGDVLVIHRYGDLAPGEMIMMVATASPHRKDAFEAAEFLMDYLKSRAPFWKKEITSDGADWVAAKDEDEDALNRW.... 147
296 4.000e-78gi|505301507|ref|WP_015488609.1| molybdenum cofactor biosynthesis protein E [Thalassolituus oleivorans]  clstr ali  36  3.SITVQTNDFNIADEYQALCGQNTEAGAIVFFSGLVRDRNEGVTGLFLEHYPGMTERSLEDIVKQARLRWPILQVRLIHRIGQLDINDQIVFVGVSSAHREAAFDACRFIMDFLKTEAPFWKKETRTDGHHWIESQTKDQEAKTRWNK.. 151
297 5.000e-78gi|740429516|ref|WP_038262025.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus cabanillasii]  clstr ali  42  5.RICVQKEMFNVGAEYQWLAQCDED-GAVVTFTGKVRNHGDDVRALILEHYPGMTENMLQKIADEARQRWRLQRINIIHRIGKLYPGDEIVFVGVTSTHRSMAFAAAEFLMDYLKTQAPFWKKEFLNDGERWVEAKESDREAASRW.... 150
298 5.000e-78gi|947514234|ref|WP_056178254.1| molybdenum cofactor biosynthesis protein MoaE [Pseudorhodoferax sp. Leaf267]  clstr ali  44  5.RVAIQTADFDLGAEVAALRAQDARIGAVCSFLGTVRDRAGAVTALELEHYPGMTERAIEAMVDEAFARFDIHAARVVHRVGPLLPLDQIVLVAVASAHRGVAFQACEFLMDYLKTQAPFWKKEQTAQGARWVDARVSDDQALARWGIAA 157
299 5.000e-78gi|1016464402|gb|KZD09681.1| molybdenum cofactor biosynthesis protein MoaE [Oceanibaculum pacificum]  clstr ali  40  1.MIRVQREDFDIGAEISALTAGNHAIGGVACFAGLVRDMGDDISAMTLEHYPGMTEKELARIEAEAQARWPLEASLIVHRYGRLGPGERIVLVVTASAHRQAAFDAAMFLMDFLKTKAPFWKLEDTGGDARWVDARESDESALERWRKPA 151
300 5.000e-78gi|779892449|ref|WP_045368148.1| molybdenum cofactor biosynthesis protein MoaE [Methyloceanibacter caenitepidi]  clstr ali  43  1.MIRVQEGDFNIGEEIEALRKDRTDIGAIVTFTGTVRDAAGEISTLTLEHYPGMTEKELARIEEEAHARWPLQASLIVHRVGTLLPGDNIVLVITASAHREAAFEAARFLMDYLKTSAPFWKRETGPQGEHWVEAKETDDQAAARWREE. 161
301 5.000e-78gi|496087141|ref|WP_008811648.1| molybdenum cofactor biosynthesis protein MoaE [Parasutterella excrementihominis]  clstr ali  39  1MKIAVQTEDFDVQAEVAALHA-SPKVGAVVMFLGTVRDEGDEVASMTLEHYPGMTEKALTAIVEEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSRWTK.. 149
302 6.000e-78gi|898313839|ref|WP_049583484.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photorhabdus luminescens]  clstr ali  41  5.RIFVGPENFNVEDEYQWLAQCDED-GAIVTFTGKVRNHGDNVGALRLEHYPGMTEKTLQRIVTEARSRWPLQRISVVHRVGTLSPGDQIVFVGVTGAHRHMAFEAAEFIMDYLKTQAPFWKKEFLPDGERWVESRESDQEAAKRWS... 151
303 6.000e-78gi|518257559|ref|WP_019427767.1| molybdenum cofactor biosynthesis protein MoaE [Limnohabitans sp. Rim28]  clstr ali  39  5..VTIQTEDFNVSQEIEVLRAQDLRVGAVCSFVGTVRDTRDEVQAMELEHYPGMTEKSIEAMIEQAHQRFDFYAARVVHRVGRLLPSDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPQGAQWVDARISDDAALARWGIQS 159
304 6.000e-78gi|518000315|ref|WP_019170523.1| molybdenum cofactor biosynthesis protein MoaE [Pseudaminobacter salicylatoxidans]  clstr ali  49  8..VRIQREDFDIQSEVARISDGRADIGAVVTFTGLCRDEAGRLSALELEHYPGMAEAEISRIAAEAVARWPLQGLTVIHRYGRIVPGENIVLVVAASAHRQAAFEAANFLMDYLKSRAPFWKKEHHADGTEWVEAREADDEALTRWRR.. 155
305 6.000e-78gi|900955332|gb|KMZ12944.1| Molybdenum cofactor biosynthesis protein MoaE [Candidatus Burkholderia humilis]  clstr ali  41  77.KIRVQEADFDISAEVAALRVDNPKVGEVACFVGTVRDLNEGVETMELEHYPGMTEKSLEAIAQQARERWRGSDVLIVHRVGKLKPLDQIVLVATTAMHRAEAFKSCAFVMDYLKTQAPFWKKEKTEAGERWVDARESDDAALTRW.... 223
306 6.000e-78gi|748185071|ref|WP_039756200.1| MULTISPECIES: hypothetical protein [Chromobacterium]  clstr ali  43  5.TVRVQPQRFSAGAEIDALS-SNPACGAVVSFSGLVRDYGDDVTALELEHYPGMTEKALEAIVAEARRRWPLQAATVIHRVGRLSLGEPIVLVVVASSHRRDAFAAAEFLMDYLKQDAPFWKKEILADGARWVEAKHSDAQAAERWQ... 152
307 6.000e-78gi|755106156|ref|WP_042456935.1| molybdenum cofactor biosynthesis protein MoaE [Rhodovulum sulfidophilum]  clstr ali  45  1MRIRVQAAPFDFGAECAVFSTGCGNAGAVVTFAGLVRDDG-GLARMELEHYPGMTERALETISAEAMTRFGLLDCLVIHRHGSLTPGETIMMVATAAPHRADAFAAAEFLMDYLKSRAPFWKKEFGTDGAAWVAARDADEDALARWSDS. 148
308 6.000e-78gi|835455899|ref|WP_047512005.1| molybdenum cofactor biosynthesis protein MoaE [Methylibium sp. CF468]  clstr ali  40  5.RVSIQTGDFDLGAEVARLRAGDGGVGAVVAFVGTVRDRSDGVIRMELEHYPGMTETSIDAMIDAALARFDIRAARVIHRVGVLDAQDQIVLVAVTSAHRGQAFQACEFLMDYLKTQAPFWKKEHTPQGARWVDARSHDDAALQRWGITS 155
309 7.000e-78gi|490355923|ref|WP_004235696.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Morganella morganii]  clstr ali  45  5.RIAVQTDNFSVGEEYQWL-AGCADDGAVVTFTGKVRNHGDNVAALSLEHYPGMTEKALADIVTQARERWELQRVTLIHRVGSLYPNDEIVFVGVSAAHRGMAFEAAEFLMDYLKTRAPFWKKETLPEGTRWVDARESDQKAADRW.... 151
310 8.000e-78 GL0075865 [Complete] locus=scaffold78862_2:131:589:+  ali  38  5.TIRVSPEDFSVDAEVARVREASPSAGAVVSFVGVVRNRNDGVSKMTLEHYPGMTEKALGKIVEKARERFHLEDVVVIHRVGDLSVGDQIVLCLVSASHRGEAFEGCEYIMDWLKTEAPFWKRETTPEGERWVDARESDDRAKARWG... 152
311 8.000e-78gi|950135948|ref|WP_057190781.1| molybdopterin synthase catalytic subunit [Bosea sp. Root483D1]  clstr ali  48  5..VRIQREDFDIGAEIAALTAGNPNIGAVVSFAGLCRDESGRLAALELEHYPGMAEAEIARVATEAAERWPLFGLLAIHRFGLIKPGEQIVLVIAASSHRREAFEAADFLMDYLKTRAPFWKREHLADGTGWVEAKADDDDSAKRWEQA. 153
312 8.000e-78gi|751631821|ref|WP_041099627.1| molybdenum cofactor biosynthesis protein MoaE [Sulfuritalea hydrogenivorans]  clstr ali  47  1MSVSVQEADFDAGAEIAALSAGRDDVGAVASFVGLVRGETAAVQAMTLEHYSGMTEKALDAIVTEARGRWNIYGVRVIHRVGRLLPGDRIVFVAVASAHRGEAFAACEFIMDYLKTRAPFWKKEETPEGGHWVDARESDDHAAGRWNR.. 170
313 8.000e-78gi|654646876|ref|WP_028107930.1| molybdopterin synthase catalytic subunit [Ferrimonas futtsuensis]  clstr ali  39  3...RVQTEDFNVGEEYAKL-ADNPACGAVVTFVGKVRDFGDGVTRMVLEHYPGMTQAVLTQIEQEARERWPLDQVTIIHRVGPLDLSDQIVFIGVSSAHRKAAFAACEYLIDFLKTRAPFWKKEVTEDQAQWVDAKDSDQQAAEMWREE. 149
314 9.000e-78gi|972373836|ref|WP_059027379.1| molybdenum cofactor biosynthesis protein MoaE [Type-B symbiont of Plautia stali]  clstr ali  40  5..IRVGAEPFNMANEYAWLSTSDAD-GAVVTFTGKVRNHGDSITALTLEHYPGMTEKALQDIVDEARSRWPLQHVSVIHRIGELFPGEEIVFVGVTSVQRCSAFAAAEFIMDYLKTRAPFWKREATEQGERWVDARDSDHQAAQRWN... 150
315 9.000e-78gi|703409091|ref|WP_033422832.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira halophila]  clstr ali  39  5..IRVQTDDFDLSHEVKALREGHKDIGAVVSFVGTVRDVNDDVAVLELEHYPGMTEKALENIRQKAHQRWPLQNSLIIHRVGEMRPCDQIVLVAVASRHREAAFEGAHFIMDFLKTHAPFWKKETLPDGTRWVDARLSDDEAKKKWLKAS 155
316 9.000e-78gi|557914694|ref|WP_023471537.1| molybdopterin synthase catalytic subunit [Betaproteobacteria bacterium MOLA814]  clstr ali  39  1MTVRIQTQDFDVSTELAALHANNLQVGAVCSFVGTVRPNAKDIHGMTLEHYPGMTEKAIEAMVVQAKARFDMFDAVVIHRVGELLAGDQIVLVAVTSTHRHESFQACEFLMDYLKTQAPFWKKEHTAAGAQWVDAREADDAALARWGINA 156
317 9.000e-78gi|639210112|ref|WP_024548263.1| MULTISPECIES: molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacteriaceae]  clstr ali  44  5.RILVGHAPFSVGDEYAWL-AACEEDGAVVTFTGKVRNHGDNVTALTLEHYPGMTEKALAEIVAEARARWPLTRVTLIHRVGELKSGEEIVFVGVTGAHRSAAFEAAEFMMDYLKTRAPFWKREATPDGDRWVDARDSDQQAAKRW.... 150
318 1.000e-77gi|766764746|ref|WP_044840383.1| hypothetical protein [Thalassomonas viridans]  clstr ali  38  1MSISIQTQDFNLADEVAALEQDNAADGAVVTFTGRVRNQNLGVSGLYLEHYPGMTEKSLEKILETARGRWDIGRVRVIHRIGQLDLGEQIVFVGVTSKHRRDAFAAAEFIMDYLKIQAPFWKKELTEQGEKWLDARQSDTAKAQQWDR.. 150
319 1.000e-77gi|499900579|ref|WP_011581313.1| molybdenum cofactor biosynthesis protein MoaE [Chelativorans sp. BNC1]  clstr ali  46  6.HIRVQAEDFDLAVEIDRLTDGRRDVGAVVTFTGKCRDEGGRLAALELEHYPGMAEAEMTRIARQAAERWQLSGLTVVHRYGKIRPGENIVLVVTASSHRKAALEAADFLMDYLKSRAPFWKKEHLTDAGQWVEAKAEDENALERWKK.. 154
320 1.000e-77gi|555038707|gb|ESL83022.1| molybdopterin synthase catalytic subunit [Enterobacter cloacae UCICRE 12]  clstr ali  44  18.RILVGPERFNVGTEYSWL-AERDEDGAVVTFTGKVRNHGDSVKALTLEHYPGMTEKSLAEIVDEARGRWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTKAPFWKREATPEGDRWVESRDSDKQAASRW.... 163
321 1.000e-77gi|488369995|ref|WP_002439380.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shimwellia blattae]  clstr ali  42  5.RIRVGHDGFSVGDEYQWLAQCDAD-GAVVTFTGKVRNHGDSVSALTLEHYPGMTEKALAEIVASARERWPLQRVSVIHRTGELWPGDEIVFVGVTGAHRGSAFEAAEYIMDYLKTRAPFWKREKTADGDRWVDARESDQQAASRW.... 150
322 1.000e-77gi|653009923|ref|WP_027262083.1| molybdenum cofactor biosynthesis protein MoaE [Sedimentitalea nanhaiensis]  clstr ali  46  1MRVKVQEAPFDVADEMRGF--GAPGTGAIVTFTGVVRNDSGNLTAMEIEHYPGMTEAALAQIATRAQERWQLGDVLVIHRHGRLIPGEQIMMVATASRHRKAAFEAADFLMDYLKSRAPFWKKEITADGAEWVAARDEDEAALDRWSPE. 148
323 1.000e-77gi|495279071|ref|WP_008003825.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. GM49]  clstr ali  39  1MTVRVQREVFDISQLIDSLQANDPGVGAVVNFVGYVRDQGEAVAGLFLEHYPGMTERSLQTIIDNARARWPLRAVEIVHRIGPLSISEPIVFVGVSSQHRQAAFEACAFITDYLKTDAPFWKREDVASGARWVDARDSDRSAVERW.... 148
324 1.000e-77gi|759942846|ref|WP_043627721.1| molybdenum cofactor biosynthesis protein MoaE [Chromobacterium piscinae]  clstr ali  45  5.HIRVQDEDFDVGAEVRRWSA-NPACGAVVSFTGLVRDYGDDVVALELEHYPGMTEKALADIVRDARQRWSLKGVTLIHRVGRLALGDNIVLVVTASSHRRDAFEAASFLMDYLKRQAPFWKCEILADGSRWVDAKASDETAAARWDQA. 154
325 1.000e-77gi|503874917|ref|WP_014108911.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Glaciecola nitratireducens]  clstr ali  36  8..ISVQEQDFDLALEYTQIRKHSDSDGAIVTFTGLVREERGNLKYMTLEHYPGMTEKSLMNICEQARERWPIGSIRIIHRIGKLPPDEQIVFVGVSSKHRKAAFAATEFMMDFLKTQAPFWKKELTTEGEFWVDAKSSDKHKANDW.... 153
326 1.000e-77gi|657937352|ref|WP_029638452.1| molybdenum cofactor biosynthesis protein MoaE [alpha proteobacterium Mf 1.05b.01]  clstr ali  43  1.MVRVQTEDFDPGAELDNLVAARTDVGASVSFVGHMRARNEDVETMTLEHYPGMAEKALSEIEAEAHKRWPLQASTIIHRVGPLKPGDRIVLVITASAHRQAAFEAAEFLMDWLKTKAPFWKKESGPEGDSWVSSRSTDEDAAQRWTASG 151
327 1.000e-77gi|495523072|ref|WP_008247717.1| molybdenum cofactor biosynthesis protein MoaE [gamma proteobacterium BDW918]  clstr ali  41  5..VRVGEADFDVGAECRALASHSRQSGAIVQFVGLMRDQGDDVLTMELEHYPGMTERCITEIVNRAQQRWPLFAVTVIHRVGVLQPQDQIVFVGVSAAHRLDAFQSCEFIMDYLKTEAPFWKKECTLNGERWVDARQTDQQARKRWQ... 152
328 1.000e-77gi|640486253|ref|WP_024926198.1| MULTISPECIES: molybdopterin synthase catalytic subunit [Mesorhizobium]  clstr ali  50  8.KIKIQAQDFDIAAEIGELTAGRADIGAVVTFSGLCRDEAGALVALELEHYPGMAEAEIGRIAVEAIGRWPLQGLTVIHRHGRIRPGENIVLVVTASAHRLAAFEAANFLMDYLKSRAPFWKKEHRADGSDWVEAKDSDEAAAARWR... 155
329 1.000e-77gi|760067607|ref|WP_043750448.1| molybdenum cofactor biosynthesis protein MoaE [Pseudooceanicola atlanticus]  clstr ali  51  1MRIVVQEAPFDLGAETSRFAEGHKDQGAIVTFTGLVR-EDGGMARMEIEHYPGMTERAITKIAEEAVTRWSLGDTLVIHRFGPMQPGEAIMMVATAAPHRKDAFEAAEFLMDYLKSRAPFWKKEIGPDGSDWVAAKDEDEDALDRW.... 145
330 2.000e-77gi|931447893|gb|KPK31975.1| molybdenum cofactor biosynthesis protein MoaE [Betaproteobacteria bacterium SG8_40]  clstr ali  46  1MPVRVQHEDFDVGAEIAKLREGNPAIGAVASFVGIVRDEGDAVATLTLEHYPGMTEKSLEEIVAQARQRWDIYDALVVHRVGTLKPLDQIVLVVVTSAHRGESFEACEFLMDYLKTRAPFWKKEVTPEGARWV................. 135
331 2.000e-77gi|506315285|ref|WP_015835060.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photorhabdus asymbiotica]  clstr ali  40  5.RIFVGLENFNVGDEYEWLSQCDED-GAIVTFTGKVRNHGDRVSGLRLEHYPGMTEKVLRNIVVEARSRWPLQRISIIHRVGALYPGDEIVFVGVTSAHRSMAFDAAEFIMDYLKTKAPFWKKEFLPDGERWVESRESDQEAARRW.... 150
332 2.000e-77gi|946980900|ref|WP_055897831.1| molybdenum cofactor biosynthesis protein MoaE [Ramlibacter sp. Leaf400]  clstr ali  37  5.RVSIQAADFDVSAELEALRRQDHRVGAVCSFVGTVRTANQGVLSMELEHYPGMTEKAIEAMIDEAHRRFDIFAARVVHRVGLLMPGDQIVLAAVTSAHRGQSFQSCEFLMDYLKTQAPFWKKERTPQGEQWVDARVSDDQALARWGIRA 157
333 2.000e-77gi|498123029|ref|WP_010437185.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio cyclitrophicus]  clstr ali  38  10.RVVVTAEDFSVGDEYDYLAQG-TAAGAVVTFVGKVRDMGDNVIGLSLEHYPGMTEKSLSEICDQAEARWPIEKMRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFVMDFLKTKAPFWKKERTTETTRWVDSRDSDAKAAERWEK.. 157
334 2.000e-77gi|518485731|ref|WP_019655938.1| molybdenum cofactor biosynthesis protein MoaE [Variovorax paradoxus]  clstr ali  40  5.RVSIQTNDFDLSREVAALRAGDKRVGAVCSFIGTVRDDGNTITSMELEHYPGMTEKAIEAMIDEAHRRFDILGARVIHRVGLLQPEDQIMMVAVVSAHRGQSFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGISA 183
335 2.000e-77gi|589606701|gb|EXI78356.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-92]  clstr ali  44  1MRISVQEGDFDVGAELAALRQGNPQIGAVASFVGLVRDSNDGVAEMSLEHYPGMTEKALAEIVEEACRRWAIIDALVIHRVGRLLPSEQIVLVAVAGAHRGEAFAACEFIMDYLKTRAPFWKREVTPSGARWVDARAADDQAAERWQEPG 152
336 2.000e-77gi|651235346|ref|WP_026375424.1| molybdopterin synthase catalytic subunit [Aestuariibacter salexigens]  clstr ali  37  1.MISIQREDFNVGDEYELLRKTSRSEGAVVTFVGLVRDVNDSVTALELEHYPGMTEKVLNELCDEARQRWVLGAIRIIHRVGKLQANDQIVFVGVSSRHRQDAFDAAQFVMDVLKTQAPFWKKEHGVNSAKWVEVRETDMLALQRWQNP. 150
337 2.000e-77gi|652803819|ref|WP_027099890.1| molybdenum cofactor biosynthesis protein MoaE [Comamonadaceae bacterium URHA0028]  clstr ali  40  5.RVAIQHEDFDVSAELAQLRAADHRVGAVCSFVGTVRAAAKPVLDMELEHYPGMTEKAIEAMVDEAQRRFDIFAARVVHRVGLLGPGEQIVFVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKERTPEGEHWVDARISDDAALARWGIQG 157
338 2.000e-77gi|916711696|ref|WP_051318787.1| molybdenum cofactor biosynthesis protein MoaE [Chitinimonas koreensis]  clstr ali  49  1MSVAVQAADFDLGAEHAALCDGDRGIGAVVAFVGCVRDLNADVVALELEHYPGMTETALIRIAEEAAVRWPLNGVRIVHRVGRLHPGEQIVLVLTASAHRHAAYEANTFVMDYLKTRAPFWKKEWTPDGPRWVDARASDVGAAARWHQ.. 150
339 2.000e-77gi|947669400|ref|WP_056332005.1| molybdopterin synthase catalytic subunit [Rhizobium sp. Root482]  clstr ali  45  6VTVRVQPEDFDLAAEVQALSAGRRDIGAVVSFIGLCRDEAGTLDALELEHYPGMAQAEISRISEEAATRFGLSAVCAIHRHGKIVPGENIVLVLTASPHRQAAFDGANFIMDFLKTSAPFWKKEHRTDGSHWVSAKDADDTARERWSK.. 155
340 2.000e-77gi|527114691|ref|WP_020914948.1| molybdenum cofactor biosynthesis protein E [Shewanella piezotolerans]  clstr ali  37  1.MIRVQTTDFSVPDEYQLISQDNGD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLNQIEAQARERWPLNHVTIIHRVGKMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGEEGASWVEARDSDEQAADVWNKK. 149
341 2.000e-77gi|752541296|ref|WP_041212740.1| molybdenum cofactor biosynthesis protein MoaE [Aeromonas caviae]  clstr ali  39  9.RILVQRADFSLADEYARL-AARQNTGAIVSFVGKVRDFNQGVKGLALEHYPGMTEKALAGIVAEARSRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMDFLKTRAPFWKKELTADGQRWVEARASDDAALARWQQ.. 157
342 2.000e-77gi|739612922|ref|WP_037469903.1| molybdopterin synthase catalytic subunit [Shewanella marina]  clstr ali  39  1.MIRVQTQDFDVPTEYAAIAADNSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLEQIEAQARERWPLTHVTIIHRVGTMGLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLEAGQQGQAWVEAKDSDDQAAAMWQQK. 149
343 2.000e-77gi|495816664|ref|WP_008541243.1| molybdenum cofactor biosynthesis protein MoaE [Sutterella parvirubra]  clstr ali  41  6.TIRVGEAPFDAGAETAALYAGDPSVGGVATFVGVVRNRNDGVAKLTLEHYPAMTEKALAGIVKRARARWTLGAVTVIHRVGPLDVSDPIVFVGVAAEHRGEAFAACEFIMDWLKTEAPFWKKEATPEGERWVDARESDDKAKARWGE.. 154
344 2.000e-77gi|640622574|ref|WP_025050600.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter noctilucae]  clstr ali  47  1MRISVQESPFDLGKETAGFSAGRKDMGALVTFTGVVRDLGDPLQALEIEHYPGMTEAALTEIAEQAMARFSLGDALVIHRYGRLVPGEMIMMVATAAPHRNDAFDGAEFLMDYLKSRAPFWKREITATGADWVASKAEDEAALDRW.... 147
345 2.000e-77gi|492544729|ref|WP_005880959.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacter formigenes]  clstr ali  39  1MSIRIQTEDFDLSAELDRLRSDHRDIGAVVSFVGTVRDDDDGILSMELEHYPGMTEAALEEIESRARQRWDILDSIIIHRVGVLKPADQIVLVAVASRHRGEAFRACEYMIDALKTQAPFWKKEQTAKGGRWVKAKDSDESALKKW.... 149
346 2.000e-77gi|551321236|ref|WP_022940996.1| molybdenum cofactor biosynthesis protein MoaE [Psychromonas hadalis]  clstr ali  36  1.MIKVQSENFNQQIEYDRLRQAS-HTGAVVTFTGLVRDQGEQISALTLEHYPAMTEKALADIVKQAQSRWSLIDTTVIHRVGELQLLDQIVFVGVASLHRGDAFAACEFIMDYLKTQAPFWKKETNSQGEYWVDARESDQSALNKWHK.. 149
347 2.000e-77gi|914775819|ref|WP_050718541.1| molybdenum cofactor biosynthesis protein MoaE [Aeromonas tecta]  clstr ali  41  9.RILVQRADFSLGVEYERL-AARHDTGAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALADIVAQARSRWPLQECTLIHRIGELLLGDQIVLVAVSSAHRDAAFEACHFIMDFLKTRAPFWKKELTAEGQRWVEAKESDNAAAARWSPAS 159
348 3.000e-77gi|84666971|gb|EAQ13442.1| molybdopterin converting factor, subunit 2 [Rhodobacterales bacterium HTCC2654]  clstr ali  47  3.MIRVQSEPFSLGDEAEAFAKGRTDTGAVVTFTGIVRDTG-GMARMEIEHYPGMTEKAISGIVDQAMDRWSLDDALVIHRYGSLAPGERIMMVATASRHRVAAFEAAEFLMDYLKSRAPFWKKEFGPDGAEWVAAKDEDEDALSRW.... 146
349 3.000e-77gi|653031915|ref|WP_027283677.1| molybdenum cofactor biosynthesis protein MoaE [Rubritepida flocculans]  clstr ali  43  3.SIRVQEAPFDVAAEMAALTAGRTDIGALASFTGICRVD-DGLAAMVLEHYPAMTERALARIAEQAMARWPLTGCTVIHRVGRLTPGEPIVLVLTASAHRQAALEACAFLMDWLKTKAPFWKREEPREGPRWVEARESDEDAAARWTRTA 151
350 3.000e-77JCVI_PEP_1096665653177 /source_dna_id=JCVI_ORF_1096665653176 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  38  5MSVRITEDDFDIALEHEKLK--SRDAGAIVTFTGTVRDNGGGLNAMTLEHYPGMTESEIEMIIDQAKARWPLVNVTVIHRVGRMLPTENIVFVGCSSAHRGAAFDGANFIMDFLKTKAPFWKLEDGPNGAKWVDARDSDSKALDRWN... 151
351 3.000e-77gi|670455687|ref|WP_031404486.1| molybdenum cofactor biosynthesis protein MoaE [Thiomonas sp. FB-Cd]  clstr ali  42  7.TIRIQHEVFDTCEELRKMRAGRTDIGALASFEGICRDHNQAVQALELEHYPGMTEQSILRMVREAHERWPLQAATVIHRIGRLQPGDPIVFVAVACAHRHAAFEACAFLMDYLKTQAPFWKKETTAQGTQWVDAREADDAALARWGIEA 163
352 3.000e-77gi|497966771|ref|WP_010280927.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pectobacterium carotovorum]  clstr ali  44  5.RIRVGEENFNVGDEYQWLAQCDED-GAVVTFTGKVRNHNKDVSALTLEHYPGMTEKALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDKQAAQRW.... 150
353 3.000e-77gi|518446484|ref|WP_019616691.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ossibalaenae]  clstr ali  34  1.MIKVQSEDFNQQVEYDRLRKD-PSVGAVVTFSGLVRDQGEQVSSLTLEHYPGMTESSLAEIVKQAESRWNIIDCTVIHRIGELQLLDQIVFVGIASLHRQDAFAACEFIMDYLKTQAPFWKKETNAQQEYWVDARESDQEALNKWTGK. 150
354 3.000e-77gi|493221343|ref|WP_006201583.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium amorphae]  clstr ali  46  9..VRIQREDFDVAAEIARLSEGRADIGAVVTFSGLCRDEQGRLSALELEHYPGMAEAEIARIASEAIERWPLHGLTVIHRHGKVRPGGNIVLVVTASAHRQAAFEAANFLMDYLKSRAPFWKKEHHADGSAWVDAKEIDDKAAGRWKAPS 158
355 3.000e-77gi|893086759|emb|CNT65782.1| molybdopterin converting factor subunit 2 [Salmonella enterica subsp. enterica serovar Bovismorbificans]  clstr ali  46  91.RIVVGPAPFSVGEEYSWL-AARDEDGAVVTFTGKVRNHGDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGDRWVEARDSDQQLAKRW.... 236
356 3.000e-77gi|316949019|gb|ADU68494.1| molybdopterin biosynthesis MoaE protein [Pantoea sp. At-9b]  clstr ali  43  5.RIRVGSAAFNVAEEYAWLSA-HDSDGAVVTFSGKVRNHGDSVAALTLEHYPGMTEKALTEIVEEARQRWALQQVSVIHRVGELFPGEEIVFVGVSSAHRSSAFAAAEFIMDYLKTRAPFWKREATAHGDRWVDARDSDHQAAERWK... 151
357 4.000e-77gi|492601959|ref|WP_005900411.1| molybdopterin converting factor subunit 2 [Aeromonas molluscorum]  clstr ali  39  11.RILIQREDFCLADEYARL-ATRPDSGAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALADIVAQARGRWPLQECTLIHRIGELRLGDQIVLVGVSSAHRDAAFDACHFIMDFLKTRAPFWKKELIAEGQRWVEAKESDNDAASRW.... 157
358 4.000e-77gi|21959932|gb|AAM86570.1|AE013903_7 molybdopterin converting factor, subunit 2 [Yersinia pestis KIM10+]  clstr ali  44  7.RIRVGAEAFSVGDEYTWLSQCDED-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALTEIIADARSRWSLQRVSVIHRVGPLFPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATVEGERWVESRDSDHIAAKRW.... 152
359 4.000e-77JCVI_PEP_1096684895653 /source_dna_id=JCVI_ORF_1096684895652 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  41  9.RILVQRDDFSLADEYARL-AARQDTGAVVSFVGKVRDFNQGVKGLALEHYPGMTEKALTDIVAEARSRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMDFLKTRAPFWKKELTAEGQRWVEAKESDNTAAARWQ... 156
360 4.000e-77 GL0114486 [Complete] locus=scaffold55408_6:969:1421:-  ali  43  5.RILVGHERFNVGTEYDWL-AGRDEDGAVVTFTGKVRNHGDSVKALTLEHYPGMTEKSLAAIVEEARGRWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTKAPFWKREATPEGERWVESRDSDKHAASRW.... 150
361 4.000e-77gi|496226493|ref|WP_008940528.1| molybdenum cofactor biosynthesis protein E [Marinobacter santoriniensis]  clstr ali  37  1.MISVQTDDFDPSAEYQSLRDSGSGTGAIVTFTGLVRDSGDDVQGLYLEHYPGMTEQVIQGLIDEASQRWDVRRARVIHRVGPLALRDQIVFVGVCSAHRGDAFKACEFIMDALKTSAPFWKKEITAEGEHWVEQKSGDRARSSRWE... 148
362 4.000e-77gi|738539538|ref|WP_036487908.1| molybdopterin synthase catalytic subunit [Nesiotobacter exalbescens]  clstr ali  48  7.KISVSASNFDVAAELEHLKAGRTDIGALVTFTGLCRDENGSLAALELEHYPGMAEAELQRLATSALERWPLTGLTIIHRVGRIRPGENIVLVVTASAHRRAAFEAADFLMDFLKTQAPFWKKEHPASGNEWVEAKSTDDTDAARW.... 153
363 4.000e-77gi|496340546|ref|WP_009049724.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas chlororaphis]  clstr ali  43  1MTVHVQAEVLDLDRLHREVHGGDPSIGAVVTFVGYVRDLGDQVGSLFLEHYPGMTERALQRIVDEANQRWPLQRVRVVHRVGLLQVAEPIVFVGVASAHRQAAFAACAFLMDYLKTRAPFWKREQTLSGERWVEGRESDQLAASRW.... 148
364 4.000e-77gi|822638173|ref|WP_047011999.1| molybdenum cofactor biosynthesis protein MoaE [Spongiibacter sp. IMCC21906]  clstr ali  42  3IFVSVQKEDFDVAVLSRALRASSNEVGALATFVGCMRGKGQPLTEMFLEHYPGMTERSIRNIVEEACQRWPLFACSVVHRIGHLSPGDHIVFVGVASAHRGDAFQACEYIMDFLKSKAPFWKKEISHDGSHWVDARVSDDEALQRW.... 151
365 4.000e-77gi|1020951522|gb|KZM49647.1| molybdopterin synthase catalytic subunit [Labrenzia sp. OB1]  clstr ali  49  7..VRIQAADFDVAAETLRLTAGRKDVGALVTFTGLCRDEAGTLDALELEHYPGMAEAELTRIAEEATGRWPLTGLSVIHRFGKIAPGENIVLVVTASAHRRAAFEAADFLMDFLKTRAPFWKKEHLVSGAAWVDTRAGDEKDAARWSSS. 155
366 4.000e-77gi|759380321|ref|WP_043107013.1| molybdenum cofactor biosynthesis protein MoaE [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  42  4.RIAVQTEPFDLAEETARLSAGDATIGAVASFVGLVRGHNRDITTLILEHYPGMTEKALSRIVDAAAERWPLQAVTVIHRVGELRLGEPIVLVLTASAHRQAAFESCQFIMDILKTEAPFWKKERLPDGERWVDARESDSEAAARWLRD. 158
367 4.000e-77gi|521079600|ref|WP_020410507.1| hypothetical protein [Hahella ganghwensis]  clstr ali  36  5IHIEISQRDFDLGTEVKRLVGDDNGIGASCSFVGYVRDFSERVVGLELEHYPGMTEKSLQKIAEEACDRWEIEGITVIHRIGRMMLGEQIVLVVTTSAHRAEAFAACEFVMDYLKVDAPFWKKELTNDGDHWVEARDKDSERAEKWQID. 155
368 4.000e-77gi|737360510|ref|WP_035342704.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Dickeya sp. DW 0440]  clstr ali  42  4.RIQVGEAPFSVGDEYAWLADGDSE-GAVVTFTGKVRNHGDSVSALTLEHYPGMTEKALAQIVEEARLRWSLARVSVIHRIGALYPGDEIVFVGVSGAHRHAAFDAAQFIMDYLKTRAPFWKREATPQGDRWVDARDSDHHAATRW.... 149
369 4.000e-77gi|491640764|ref|WP_005498293.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella benthica]  clstr ali  40  8..VRVQTEDFSVSDEYA-LIAGDNSDGAVVTFVGKVRDFNDGVSDLTLEHYPGMTEAVLNQIALEARERWPLNNVTIIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDKGANWVEAKDADDQAANMWEKQ. 155
370 5.000e-77gi|755039728|ref|WP_042392256.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Escherichia vulneris]  clstr ali  44  5.RIRVGHDPFSVGEEYTWL-AERDEDGAVVTFTGKVRNHGDSVRALTLEHYPGMTEKTLADIVQQARDRWPLGRITVVHRIGELWPGDEIVFVGVTSVHRGSAFAAGEYIMDYLKTRAPFWKREATEEGDRWVEARESDQQAAKRW.... 150
371 5.000e-77gi|948052575|ref|WP_056711578.1| molybdopterin synthase catalytic subunit [Bosea sp. Leaf344]  clstr ali  45  4.TIRIQREDFDLSAEVERLTAARSHIGAVVSFTGLCRDEGGRLQALELEHYPGMAEAEIGRVAQAALERWPLSGLTAIHRFGLVRPGEQIVLVVATSAHRRAAFEAADFMMDYLKTRAPFWKREHLLDGTVWVEARQEDDDAASRWG... 151
372 6.000e-77gi|522079907|ref|WP_020591116.1| hypothetical protein [Kiloniella laminariae]  clstr ali  39  1.MIRVQSEDFDLALEVRKLTEGNPAIGAVTAFIGLVRDIAGDISSMTLEHYPGMTEKMLREIETEAHQRWELDASLIIHRYGQLAPGDQIVLVVTCSKHRQAAFESCEFLMDFLKTKAPFWKLEQTPEGGKWVDARDGDTEATERWLKS. 150
373 6.000e-77gi|499954843|ref|WP_011635577.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella frigidimarina]  clstr ali  37  8IVVRVHTEDFSVADEYALL-ACDKQDGAVVNFVGKVRDFNDGVTDLTLEHYPGMTESVLLQISQQACERWPLNKVTIIHRVGRLSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDTGAKWVEARDSDQQAAKMWQK.. 156
374 6.000e-77gi|494185546|ref|WP_007118937.1| molybdenum cofactor biosynthesis protein MoaE [Oceanibulbus indolifex]  clstr ali  46  1MRVLVQEAPFDLAEETARFAKGEGGSGAIVTFTGVVRDNGGTLSAMEIEHYPGMTEKALCEIAEQAMARFELQDALVIHRYGRLVPGEQIMMVASAARHRRSAFEAAEFLMDYLKSRAPFWKREITAEGEAWVAAKDEDEAALERW.... 147
375 6.000e-77gi|947613671|ref|WP_056276818.1| molybdenum cofactor biosynthesis protein MoaE [Hydrogenophaga sp. Root209]  clstr ali  38  4.RVSIQTEDFDLSAEVALLRKADKGVGAVCSFIGTVRDDGEEVLAMELEHYPGMTEKSIEAMIDAAHQRFDIFGARVIHRVGLLQPLDQIVLVVVTSAHRGQSFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGIAA 182
376 6.000e-77gi|496205718|ref|WP_008925054.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. aB]  clstr ali  43  5..IRVGPAPFDMAEAYRWLAACDED-GAVVTFTGKVRNHGDNVAALMLEHYPGMTEKALQEIVDAARERWPLQRVTVIHRVGELFPGDEIVLVGVTSAHRSSAFSAAEFIMDYLKTRAPFWKREATEQGDRWVDARDSDHQAAQRWD... 150
377 6.000e-77gi|635596009|dbj|BAO81166.1| molybdopterin converting factor, large subunit [Comamonadaceae bacterium A1]  clstr ali  44  9VQVRIQTEDFDLSAEVAALHAADARVGAVAVFVGTVRDEGQALDCLELEHYPGMTERAIEDMVEQARQRFEIFGARVLHRVGRLGLGEQIVLVAVTAAHRGQAFQACEFLMDYLKTQAPFWKKEHGATGSRWVDARTSDDAALAKWGIAA 160
378 7.000e-77gi|545478845|ref|WP_021714905.1| molybdopterin synthase catalytic subunit [Vibrio ezurae]  clstr ali  37  3.RVVVQEEDFDLSKEYARLGE-SPSIGAVVTFVGKVRDFGDNVLGLHLQHYPQMTEKALHEICTLARSRWPLDKVTVIHRVGDLDIADQIVLVGVSSAHREAAFSACEFIMDYLKTKAPFWKKERLSNASRWIESRESDQESMQRW.... 148
379 7.000e-77gi|655972127|ref|WP_029014713.1| molybdenum cofactor biosynthesis protein MoaE [Niveispirillum irakense]  clstr ali  43  1MAVRVQEADFDLGAELRALVAGNHAIGGLCSFVGLVRDLAGTVKALTLQHYPGMTEKQLAAIEAEARTRWPLADCLIIHRHGKMEPGEQIVLVACASAHREAAFEACQFLMDWLKTKAPFWKLEDTENGDRWVESRTADAQAAARWTDQ. 156
380 8.000e-77gi|503132351|ref|WP_013367012.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacter lignolyticus]  clstr ali  45  5.RIIVDTAAFDVGAEYRWL-AGRDEDGAVVTFTGKVRNHGDSVKALTLEHYPGMTEKALAEIVEEARSRWPLGRVTLIHRIGEMWPGEEIVFVGVTSAHRSSAFAAGEFVMDYLKTRAPFWKREATPEGERWVDARDSDREAAERWQ... 151
381 8.000e-77gi|930037964|ref|WP_054141517.1| molybdopterin synthase catalytic subunit [Bosea sp. AAP35]  clstr ali  44  6.TIRIQSEDFDLAAEIAALSEGRRDIGAVVSFTGLCRDEGGTLAALELEHYPGMAQAEIARVADEAAARWPLMGLLAIHRYGLVKPGEQIVLVIATSAHRRAAFEAADFMMDYLKTRAPFWKREHLADGTTWVEAKREDDDAASRWEETA 156
382 9.000e-77gi|944173853|ref|WP_055662734.1| molybdenum cofactor biosynthesis protein MoaE [Jannaschia seosinensis]  clstr ali  42  15.RIVVTEADFDLGAEAARLEAGS-DTGAVVTFTGRVRDVSGGLRRMTIEHYPGMTEKALRTIAEEAAERWPLSGVTIVHRHGALSPGDRIMMVGTASRHRDAAFAAASFLMDYLKSRAPFWKKEETADGMGWVAAREADEAALDRWRDR. 161
383 9.000e-77gi|589830241|gb|EXJ12661.1| Molybdopterin synthase catalytic subunit [Nitrincola nitratireducens]  clstr ali  36  14ITSRIQTQCFDISYEIEALHQGRTDIGALVSFLGYVRDFNEDVIALTLEHYPEMTEQALDEIQLNATQRWPLLGTRVIHRVGRLEPTDPIVLVLAVSSHRQHAFDACSFIIDQLKTQAPFWKKEHTASGDYWVSARYSDEHAAKRWN... 162
384 1.000e-76gi|739623946|ref|WP_037480404.1| molybdenum cofactor biosynthesis protein MoaE [Sphaerotilus natans]  clstr ali  42  9.RVAIQTEDFDLSAEVAALRAGDGAVGAVTTFIGTVRDRHAGVSAMELEHYPGMTERAIEAMIDEALRRFDIRAARVVHRVGPLAIGDQIVLVAVSSMHRGESFQACEFLMDWLKSEAPFWKKETTAEGARWVDARVSDERALARWGIAS 165
385 1.000e-76gi|559225838|ref|WP_023581223.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Proteus hauseri]  clstr ali  38  6.RIAVQTENFSVGDEYQWLSECDSD-GAVVTFTGKVRNHGDEVSTLTLEHYPGMTEKALNDIVSEARGRWPLQRVSVIHRVGTLHIGEEIVFVGVTSSHRNSAFESAEFIMDFLKTRAPFWKKELSENKDRWVDARQSDYDSAERWE... 153
386 1.000e-76gi|516541971|ref|WP_017929596.1| hypothetical protein [Loktanella hongkongensis]  clstr ali  47  1MKIRVQEAPFDAGAELDAFAHGRHEVGAVVSFTGIVRDRDGGLVHMQIEHYPGMTEKAITAIAETAKARWDLADLVVIHRFGTLPVGQPIMMVATAAPHRRAAFEAAEYLMDYLKSRAPFWKKEVTQAGEHWVEATPEDEDALSRW.... 146
387 1.000e-76gi|974223103|gb|KUO63953.1| hypothetical protein APF80_16185 [Alphaproteobacteria bacterium BRH_c36]  clstr ali  45  1MAVRVEHKDFDIGAEIAALTGGRTDIGAVVTFTGTVRGSAGDITSMTLEHYPGMTEAELARVEAEANARWPLSATLIVHRIGELHPGDNIVLVITASAHRHAAFEAAEFLMDYLKSRAPFWKKEARPDGARWVDARETDTEAMQRWKSSA 153
388 1.000e-76gi|639052987|ref|WP_024459735.1| hypothetical protein [Marinimicrobium sp. LS-A18]  clstr ali  36  1.MISVQTAPFDVAHEYAQLTADDVDAGAAVFFVGRVRSHNDGVTGMTLEHYPGMTEKALEQILADARQRWSLGRVRVIHRVGSLVLGEAIVFVGVTSAHRDASFEAAEFIMDYLKNRAPFWKREDTEDGSVWVDARDKDLRALARWS... 148
389 1.000e-76gi|736772711|ref|WP_034776126.1| molybdopterin synthase catalytic subunit [Idiomarina salinarum]  clstr ali  40  4.RIQVQTTDFELSEEYQRLR-DNPACGAVVTFTGLVRELQGNLTGMTLEHYPGMTESALTDICQQAAQRWELGSITVIHRVGSLGLNDQIVFVGVAAAHRQAAFMAAEFIMDYLKTRAPFWKQEHTTAGSYWVDAKTKDQLAAARWHTS. 151
390 1.000e-76gi|499634993|ref|WP_011315727.1| molybdenum cofactor biosynthesis protein MoaE [Nitrobacter winogradskyi]  clstr ali  42  5ITIRLQEADFDLAHEVAALSRGRTDIGAVVTFSGICRGDEDGIAALTLEHYPGMAEAEIARHAEEAVSRWPLTGITVIHRYGRIVPGENIVLVVTASSHREAAFQGAEFLMDYLKTKAPFWKREEGASGSGWVDAHDRDDTAAARWAKP. 155
391 1.000e-76gi|500094461|ref|WP_011770468.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ingrahamii]  clstr ali  36  1.MIRVQTEDFNQQREYDRLREQS-SVGAVVTFTGLVRDFNQGVASLTLEHYPLMTEKSLAQIVMQAKQRWNILACTLIHRVGELKISEQIVFVGIATAHRQDAFAACEYIMDYLKTEAPFWKKECNSQGSYWVDARESDRSALNKWS... 148
392 1.000e-76gi|655016851|ref|WP_028465818.1| molybdenum cofactor biosynthesis protein MoaE [Nisaea denitrificans]  clstr ali  36  1.MIRVQKEDFDLATELSALSAGNHNIGGITSFVGQVRDMADGVGAMTLEHYPGMTEKMLEQIDAEANKRWPLEASLIIHRYGRMEPGEQIVLVACASPHREAAFEACHFLIDWLKTKAPFWKLEEKDSGAAWVDARESDADATAKWDK.. 149
393 1.000e-76gi|760164300|ref|WP_043845184.1| molybdenum cofactor biosynthesis protein MoaE [Roseivivax atlanticus]  clstr ali  53  1MRIVVQEAPFDYGAECDGFATGRTDVGAVVTFAGLVRSDAD-LDRMEIEHYPGMTESALTAIAEEAARRWSLQDVLVIHRVGPMRPGERIMMVATAAPHRRDAFEAADYLMDYLKSRAPFWKKEHGPQGESWVEAKATDEDALSRW.... 145
394 2.000e-76gi|860487511|ref|WP_048438855.1| molybdenum cofactor biosynthesis protein MoaE [Caenimonas sp. SL110]  clstr ali  40  4.RVSIQAQDFNLADEVVALRSGDKRVGAVCSFIGTVRDRNDGVSSMELEHYPGMTEQAIEAMIDQAHERFDIFGARVIHRIGLLAPLDQIVLVAVTSAHRGESFRACEFLMDYLKTQAPFWKKEQTPAGARWVDARVADDAALAKWGIA. 153
395 2.000e-76gi|947580760|ref|WP_056244202.1| molybdopterin synthase catalytic subunit [Mesorhizobium sp. Root552]  clstr ali  45  11..VRIQAEDFDLAAEVAKLTAGRTDIGAIVTFSGLCRDESGRLAALELEHYPGMAQAEITRIATEASERWPLQGLAAIHRYGKISPGDNIVLVVAASTHRQAAFEAASFVMDFLKSKAPFWKKEHQADGSEWVDAKEADEDALARWKR.. 158
396 2.000e-76gi|800930514|ref|WP_045959016.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus poinarii]  clstr ali  40  5.RINVQREVFHVGEEYQWLSQGDEE-GAIVTFTGKVRHHGDSVHSLTLEHYPGMTEKQLQNIVDEARQRWPLQRVSVIHRVGELYPGDEIVFVGVTSSHRHRAFMAAEFIMDYLKTQAPFWKKESLAEGERWVETRQSDQEAINRWS... 153
397 2.000e-76gi|495525255|ref|WP_008249900.1| molybdenum cofactor biosynthesis protein MoaE [Limnobacter sp. MED105]  clstr ali  43  5.KVLVQEADFDVTEEIRWLRQGLPEIGAVATFIGTVRDENSAVSAMTLEHYPGMTEKALENILQVADARFDITSAMIIHRVGPLYPEDQIVFAAATSEHRQQAFLACEFMMDYLKTEAPFWKKEDTPEGSRWVSARDSDDSAKERWEQA. 154
398 2.000e-76gi|494467368|ref|WP_007256868.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola granulosus]  clstr ali  46  1MSVRVQPEPFDAGAELNAFAARASGAGAVVTFTGLVRDISGGLAHMEIEHYPGMTERAISSIVAEATERFGLDAALVIHRHGRLAPAEPIMMVATAARHRGSAFEAAVFLMDYLKSRAPFWKKEVTADGAEWVAARDEDEAALSRW.... 146
399 2.000e-76gi|504388739|ref|WP_014575841.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter adhaerens]  clstr ali  36  1.MISVQSDDFDVAAEYAALRDSGAGTGAIATFTGLVRDSGDGVTGLYLEHYPGMTEQVIQGLIDDASKRWDVRKARVIHRVGRLALCDQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITSDGEHWVEQKESDRARSEDWK... 148
400 2.000e-76gi|941922920|gb|ALK92411.1| Molybdopterin synthase catalytic subunit [Limnohabitans sp. 103DPR2]  clstr ali  37  4.RVVIQTEDFNVAEVLAALRANDLRVGAVCSFVGTVRDTRDEVVSMTLEHYPGMTESSIEAMIEEAHQRFDFYQAKVIHRVGDLKPADQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEETPEGAQWVDARVSDDQALARWGIKS 159
401 2.000e-76gi|970993452|ref|WP_058861974.1| molybdenum cofactor biosynthesis protein MoaE [Ponticoccus sp. SJ5A-1]  clstr ali  48  1MRIVVQQAPFDFGAEADRFAAGRTDLGAVVTFTGVVRDADGDLQRMEIEHYPGMTEKALEAIAQEAATRWSLGEVLVIHRHGPLQAGERIMMVATAARHRKAAFEAADFLMDYLKSRAPFWKKEHGADGAGWVAARDEDEAALRRW.... 146
402 2.000e-76 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  42  5.RIVVSPARFSVSEEYPWL-AERDEDGAVVTFTGKVRNHGDSVKALTLEHYPGMTEKSLAEIVELARERWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTRAPFWKREATPDGERWVDARDSDRQAAERW.... 150
403 2.000e-76gi|340385693|ref|XP_003391343.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Amphimedon queenslandica]  clstr ali  40  4.SIRIQQEPFDAGSIIEDTGRNTPKTGAVAAFVGRMRDINAGIAQMTLEHYPGMTERAIENICQEASKRWELLDIRVVHRIGPLKPLDTIVLVAVASPHRQNAFLACEFIMDFLKTRAPFWKKETTEDGAEWVESRTSDELAAERWHEKS 155
404 2.000e-76gi|950207243|ref|WP_057252660.1| MULTISPECIES: molybdopterin synthase catalytic subunit [Sinorhizobium/Ensifer group]  clstr ali  44  7..VRVQREDFDLNTEVAKLSAGRADVGAVVTFSGLCRDEAGTLAALELEHYPGMAEAEIERICHEAVERFSLQAATAIHRYGKIMPGDNIVLVVAASRHRQAAFDGANFIMDFLKTSAPFWKKEHLGDGTTWVSAKDADDTARDRWSTK. 155
405 2.000e-76gi|589087158|gb|AHK43914.1| putative molybdopterin converting factor subunit [Ensifer adhaerens OV14]  clstr ali  45  9VTVRVQREDFDLSAEVSKLSSGRPDIGAVVTFSGLCRDEAGTLTALELEHYPGMAEAEIERICRLAVERFGLQAATAIHRYGKINPGENIVLVITASPHRQAAFDGANFIMDFLKTSAPFWKKEHSSDGTAWVSAKDADDTARDRWKR.. 158
406 2.000e-76gi|488369113|ref|WP_002438498.1| MULTISPECIES: molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacteriaceae]  clstr ali  44  5.RIRVGHEGFSVGDEYQWL-ASCDEDGAVVTFTGKVRNHGESVSAMTLEHYPGMTEKALAEIVAEARQRWALQRVSVIHRIGELWPGDEIVFVGVTGAHRSQAFEAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDHQAAERW.... 150
407 2.000e-76gi|517138569|ref|WP_018327387.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobium giardinii]  clstr ali  43  6VTVRVQRDDFDLAAEVRALSASRHDIGAVVTFSGLCRDEAGTLSALELEHYPGMAEAEIARICRQAIDRFGLQAATAIHRYGKILPGENIVLVVTASPHRQAAFDGANFIMDFLKTSAPFWKKEHATDGSAWVSAKDADDGARDRWSKS. 156
408 2.000e-76gi|495335242|ref|WP_008059979.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. GM78]  clstr ali  38  1MTVRVQYKTFDTGQLIDRLRANDPGVGAVVNFVGYVRDQGEEVTSLFLEHYPGMTERSLQKIIDNAKTRWPLKAVEIVHRIGQLSVSDPIVFVGVSSQHRQAAFDACAFIMDYLKTDAAFWKREDVASRARWVDARDSDRSAAGRWE... 149
409 2.000e-76gi|501284337|ref|WP_012327355.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella woodyi]  clstr ali  39  7.KVRVQTQDFSVPEEYA-LIADDNSDGAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLNQIATEARERWPLNKVTIIHRVGTMSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGETGKSWVEAKDADEQAAKMWDRS. 155
410 2.000e-76gi|666602493|emb|CDH29830.1| molybdopterin converting factor, subunit 2 [Xenorhabdus bovienii str. Jollieti]  clstr ali  41  10....VQRERFNVGDEYQWLSQCD-DDGAVVTFTGKVRNLGDSVKALTLEHYPGMTEKMLQVIIDEARQRWPLQRISVIHRIGELYPGEEIVFVGVTSAHRSMAFTAAEFIMDYLKTRAPFWKKESLVEGERWVATRESDQEAAGRW.... 152
411 2.000e-76gi|829958249|ref|WP_047371187.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Kluyvera intermedia]  clstr ali  41  5.RIVVDHAAFNVGEEYQWLSE-RDEDGAVVTFTGKVRNHGDNVSALTLEHYPGMTEKTLAGIVEEARERWPLGNVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDFLKTRAPFWKREATAQGDRWVEARDSDKQAAQRW.... 150
412 3.000e-76gi|500085621|ref|WP_011761634.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella amazonensis]  clstr ali  37  5.RILVQTADFSVPEEYQRIAADN-QDGAVVTFVGKVRDFNEGVSDLTLEHYPGMTEKVLDQIADQARERWPLNHLTIIHRVGTMHLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLETSDKGQGWVEARDADDQAAKAWEQ.. 152
413 3.000e-76gi|493339868|ref|WP_006296783.1| molybdenum cofactor biosynthesis protein MoaE [Hylemonella gracilis]  clstr ali  40  5.RVSIQTNDFNVAAEIAALRARDARVGAVCSFIGTVRDRNEGVSAMELEHYPGMTEQAIEGMIDEALQRFDIYAARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPQGARWVDARVSDDEALARWGISA 184
414 3.000e-76gi|944508923|ref|WP_055727401.1| molybdopterin synthase catalytic subunit [Bosea thiooxidans]  clstr ali  48  5..IRIQREDFDLSAEIAALSAGRADIGAVVSFIGLCRDEQGRLSALELEHYPGMAEAEIGRVAAEAAARWPLMGLVAVHRYGPIRPGEQIVLVLAASAHRRAAFEAADFMMDYLKTRAPFWKREHRSDGTGWVEAKTDDDDAAKRWEQA. 153
415 3.000e-76gi|821559355|ref|WP_046866361.1| molybdopterin synthase catalytic subunit [Microvirga sp. JC119]  clstr ali  46  4.KIRIQSEDFEPGTEIAELTMGRSDIGAVVSFTGLCRDEGGRLAALELEHYPGMAEAEIARVADEAERRWPLSGLTIIHRFGRILPGQNIVLVVTASGHRRAAFESGEFLMDYLKTRAPFWKREHLAGGEVWVEAKDADEAATERW.... 150
416 3.000e-76gi|495406572|ref|WP_008131271.1| molybdenum cofactor biosynthesis protein MoaE [Pseudoalteromonas sp. BSi20480]  clstr ali  41  3ISINVQTQDFSVGKQHDALCSNNKSDGAVVTFTGLVREFGDNVIALELEHYPGMTEQLLQSIAEQAQTRWQLARISIIHRVGYLALGEQIVFVGVTSRHRQAAFEGAQFIMDYLKNHATFWKKEHFKDSSNWVEFKQSDKQALNKWQ... 151
417 4.000e-76gi|946946548|ref|WP_055868384.1| molybdenum cofactor biosynthesis protein MoaE [Methylophilus sp. Leaf414]  clstr ali  40  4.KISVQPEDFDTGAELQQLKAATPRAGALVNFIGMVRDLDGKLDEMVIEHYPGMTEAALQRIAEQACQRWPLLGIRLIHRVGSLAAQSQIVLVATTSLHRQAAFEACAFMMDYLKTEAPFWKKEIGDFGERWVEARATDEHAKQQWQK.. 152
418 4.000e-76gi|972719965|emb|CUU23402.1| Molybdopterin-converting factor subunit 2 [Erwinia gerundensis]  clstr ali  42  4.RIRVEQATFAMAEEYHWLAADDED-GAVVTFTGKVRNHGDDVAALSLEHYPGMTEKALAEIVDTARGRWPLGRVTVIHRVGEMFPGDEIVLVGVSSAHRGDAFAAAEFIMDYLKTRAPFWKREKTPEGERWVDARDSDQQAAARW.... 149
419 4.000e-76JCVI_PEP_1096685142461 /source_dna_id=JCVI_ORF_1096685142460 /offset=0 /translation_table=11 /length=156 /full_length=156  ali  38  7..VRVQTVDFNVTDEYHQLAQDNSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTERVLEQIVAEARERWPLNKVTVIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDKGKNWVEAKDADEQAAQLWQHK. 154
420 4.000e-76gi|654565557|ref|WP_028032838.1| molybdopterin synthase catalytic subunit [Chelativorans sp. J32]  clstr ali  47  6.HIRVQAGDFDLAAEVNRLSAGRKDVGAVVTFTGRCRDEDGRLAALELEHYPGMAEAEIARIAREAADRWSLSGLTVIHRYGRIEPGENIVLVVTASSHRKAALEAADFLMDYLKSRAPFWKKEHPATAARWVEAKAEDEDALARWKK.. 155
421 4.000e-76gi|1000085645|gb|KXJ53433.1| molybdopterin synthase catalytic subunit [Colwellia sp. Phe_37]  clstr ali  35  1.MIKVQQSDFVVADEYRYL-ANDNQDGAVVTFVGKVRDFNEGVQGLSLEHYPGMTEKVLNDIEKKAREHWPLNKVTIIHRFGDLTLGEQIVFIGVTSPHRKAAFAACEFLIDFLKTQAPFWKKELTSEGSVWLDAKNSDDDASQQWQEK. 149
422 4.000e-76gi|497824569|ref|WP_010138725.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola sp. S124]  clstr ali  47  7..IRVQSAPFDPGAELSAFTAARAGCGAVVSFTGLVRDLSGGLSAMEIEHYPGMTEKALAGIAADASGRWDLGPVLILHRYGRLGAEEPIMMVATASRHRRAAFEAADFLMDYLKSRAPFWKKESTDAGASWVAAKDEDEDALSRWR... 153
423 4.000e-76JCVI_PEP_1096669731989 /source_dna_id=JCVI_ORF_1096669731988 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  40  1.MISVQTEDFNVAAEYTALRHQAGDAGAIVLFTGLVRDGSDRTQRLFLEHYPGMTEKQLEAISQQASKRWPLLGVRILHRVGELYPGDQIVLVATASRHRQAAFESADFIMDFLKSRAPFWKKQTSQSESRWIESRESDIDALKRWQE.. 157
424 4.000e-76gi|737491949|ref|WP_035471632.1| molybdenum cofactor biosynthesis protein MoaE [Gammaproteobacteria bacterium MFB021]  clstr ali  42  3IDIRVQQAAFDAATMQQRLTAGRRDIGALVSFTGLVRDINEDVEALTLEHFPGMTEPALETIARDAGARWPLTGVGVVHRVGRLTPGDPIVLVMVTSAHRRAAFEACDFIMDRLKTRAPFWKKEHTASGDYWVSERQSDHDDAGRWERA. 153
425 4.000e-76gi|655389901|ref|WP_028793795.1| molybdenum cofactor biosynthesis protein MoaE [Thalassobaculum salexigens]  clstr ali  42  1MAVRVQEEDFDIGRELAALTAGNHAIGGLGVFVGLVRDIAGGVSAMSLEHYPGMTERQLEEIEREAHARWPLDASLIIHRVGDLAPGDNIVLVACASAHRQAALDATGFLIDWLKTRAPFWKREDTPDGARWVDAREADDTAAARWG... 149
426 4.000e-76gi|764090167|gb|KJD20359.1| molybdenum cofactor biosynthesis protein E [Halomonas meridiana]  clstr ali  45  11IAVEVQSAPFSMAYGYESALRQRTDIGAIVTFTGLVRDFNEDVTGLTLEHYPGMTERTLTQIAEQAWQRWALQAVRVIHRVGDLSPGDPIVRVLVASAHRRDAFEACDFIMDYLKTQAPFWKKEHSKQGAYWVKERHTDQQDAERW.... 158
427 5.000e-76gi|948009360|ref|WP_056668818.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. Leaf160]  clstr ali  42  7.RVSIQTADFDVXXXXXXXXXXXXXVGAVCSFVGVVRDRSDGVASMELEHYPGMTEKSIEAMIDEALARFDIFGARVIHRVGLLAPLDQIVLVAVSSAHRGASFEACEFLMDYLKTQAPFWKKEATPEGARWVDARVSDDAALARWGIRA 157
428 5.000e-76gi|544803740|ref|WP_021220895.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas alcaligenes]  clstr ali  46  1MGIRVQATAFDPGTELNALHAANVGVGAVVGFVGYVRDFNEGVSGMFLEHYPGMTEKALEKIAEEARQRWPLLKVDILHRIGRLEPGEPIVFVGTASAHRQAAFDACNFIMDYLKTRAPFWKKEDTAEGPRWVEGRCSDQAAAQRWEGD. 151
429 5.000e-76gi|983362783|ref|WP_060541962.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. Leaf48]  clstr ali  39  1MTVRVQYKAFDSGQLIDSLRANDPSVGAVVNFIGYVRDINAGVASLFLEHYPGMTERSLQKIIDNAKARWPLKAVQIVHRIGQLSVTDPVVFVGVSSQHRHAAFEACAFIMDYLKTDAPLWKREDTGVGARWVDARDSDRSAAERW.... 148
430 5.000e-76gi|640440327|ref|WP_024901232.1| molybdenum cofactor biosynthesis protein MoaE [Paraburkholderia andropogonis]  clstr ali  39  1MRIVVQEADFDTGQELTALRVAHPGAGAVVAFVGAVRDISGGVDMLELEHYPGMTERALADIVAQAARRWPFQGVTVIHRYGPLRPTDQIVLVAVASAHRGEAFSACEFIMDYLKTEAPFWKKEGTGGARRWVDARETDDHARSRWGGGG 153
431 5.000e-76gi|655493052|ref|WP_028874459.1| molybdenum cofactor biosynthesis protein MoaE [Tepidiphilus margaritifer]  clstr ali  41  3.TVRVQVEDFDAGAEGERLQRVSPEVGAVVSFVGTVR--GGEVRAMTLEHYPGMTEKSLEALVEEARRRWSLVAATVIHRVGRLMPGERIVFVGVASRHRSEAFAACEFLIDRLKTEAPFWKKEETNDSTRWVEAKEGDEARARRW.... 145
432 5.000e-76gi|495494509|ref|WP_008219168.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera nanhaiensis]  clstr ali  41  3IFVAVQSDDFCVASEYNELRRQS-GCGAIVTFSGLVRELSDNLHSMTLEHYPGMTEQALTAIAEQAQQRWQLGAVHLIHRVGTLKPHEQIVFVGIASPHRAAAFAACEFIMDYLKNRAPLWKKEHTSNGDYWVEAKTSDQHALTRWD... 149
433 6.000e-76gi|497287652|ref|WP_009601869.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio caribbeanicus]  clstr ali  40  3IKVSVQVEDFSVSYEHQCLSEGS-HSGAVVTFCGNVRDMGDCIKGLTLEHYPGMTEKIINHICSEAISRWSIEKIRVVHRVGELNVGEQIVFVGVASGHRREAFSACEFIMDNLKTRAPFWKKERTTDSTRWIDARSSDSDAVLRWDK.. 151
434 6.000e-76JCVI_PEP_1096671195973 /source_dna_id=JCVI_ORF_1096671195972 /offset=0 /translation_table=11 /length=172 /full_length=172  ali  44  26.RIIVSHDRFKVGDEYPWL-AERDEDGAVVTFTGKVRNHGDSVKALTLEHYPGMTEKSLAEIVEQARERWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTRAPFWKREATPEGERWVDARDSDREAAERW.... 171
435 6.000e-76gi|750622316|ref|WP_040904184.1| molybdopterin synthase catalytic subunit [Vibrio metschnikovii]  clstr ali  40  4.RVSVQTADFSLADEYAVLAQDSA-AGAVVTFVGKVRDLGDDVIGLRLEHYPGMTEKALSHLCDQAQQRWPLQQVRIIHRVGDLDVGAQIVFVGVASAHRGASFAACEFIMDSLKTQAPFWKKERTTHSERWIESRESDHQAAKRW.... 149
436 6.000e-76gi|657349872|ref|WP_029406552.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira sp. Milos-T2]  clstr ali  39  7..VKIQEEDFDLTSEVAALRKGHKDIGAVVSFVGTVRDEGDEVSILELEHYPEMTEKALEKIRLEAHQRWELESSLIIHRIGKMYPTDQIVLVAVSSRHRENAFYASHFIMDYLKTNAPFWKKETFPDGERWVDARVTDKEAEKRWMK.. 155
437 6.000e-76gi|495149543|ref|WP_007874350.1| molybdopterin (MPT) converting factor, subunit 2 [Ochrobactrum sp. CDB2]  clstr ali  43  11..VSVRSEDFDVAEEIHKLGEGRKDIGAIVTFTGLCRDEGGKLSALELEHYPGMAEAEIRRIVDEAISRWPLSGISIIHRYGLVKPGENIVLVVTASAHRQAAFEAASFLMDFMKTGAPFWKREHLIDGGTWVESKAEDDQSRERWQK.. 158
438 6.000e-76gi|495460069|ref|WP_008184761.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae bacterium HTCC2150]  clstr ali  42  1MGVRVQTDPFNAGAELKTFSSVQTNAGAVVTFTGIVRDLPDPLAFMEIEHYPGMTEKALEKICDTAIERWKLADALVIHRYGKLTAGEDIMMVATASKHRKDAFEAAEFLMDYLKSRAPFWKKEHAKDGADWVAQRSEDEDALNRW.... 147
439 6.000e-76gi|948147439|ref|WP_056805737.1| molybdopterin synthase catalytic subunit [Bosea sp. Root381]  clstr ali  46  19.TIRIQRENFDLATEVAALSAGRRDIGAVVSFTGLCRDEGGTLRALELEHYPGMAEAEIARVAIEAATRWPLTGLTAIHRFGLVEPGEQIVLVIATSTHRRAAFEAADFMMDYLKTRAPFWKREHLADGTTWVEAKQEDDDAALRWS... 166
440 7.000e-76gi|503341713|ref|WP_013576374.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rahnella sp. Y9602]  clstr ali  43  5.KIVVDAAPFSVGDEYNWLAQSDAD-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALAEIVAKARTRWPLQRVSVYHRVGPMYPGDEIVFVGVTSAHRGMAFEANEFIMDHLKTRAPFWKREATEEGDRWVDARDSDKQAAARW.... 150
441 7.000e-76gi|737269409|ref|WP_035253309.1| molybdenum cofactor biosynthesis protein MoaE [Actibacterium atlanticum]  clstr ali  44  1MAVQVQKEAFDVGAEVNCFTAGCKDAGAVVSFTGIVRNNADGLQRMQIEHYPGMTEKALAGIEAQARDRWPLQDVLIIHRHGDLAPGEVIMMVATASKHRMAAFEAAEFLMDYLKSRAPFWKQEFTAQGSDWVAAKDVDEDALKRW.... 147
442 7.000e-76gi|742477089|ref|WP_038932142.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium japonicum]  clstr ali  40  15VTIRIQQDDFDIAREIAILTGSRTDIGAVVSFSGICRGDEDSIAALTLEHYPGMAEEEIKRHADEATSRWPLNGVTIIHRVGRFMPGQNIVLVLTASQHRQAAFQAAEFLMDYLKTSAPFWKKEESATGTGWVEAHARDDEAAARWTRS. 165
443 8.000e-76gi|654633724|ref|WP_028097821.1| molybdenum cofactor biosynthesis protein MoaE [Dongia sp. URHE0060]  clstr ali  41  1MTVRVQTEDFDIGAELEQLSTGNHQVGGVASFVGLVRDIAGASSSMTLEHYPGMTEKRLAAIETEAQRRWPLAAVLIIHRYGRLEPGDRIVLVATASSHREAALESCAFLIDWLKTEAPFWKLEEGPEGPRWVEAKGSDDDRKAAWKKK. 153
444 8.000e-76gi|496387197|ref|WP_009096187.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. GFAJ-1]  clstr ali  43  8IAVEVQAAPFSMDYGYESTLQQRTDIGAIVSFTGLVRDFNEDVTGLTLEHYPGMTERTLAEIGEQAWERWSLQAVRIIHRVGHLSPGDPIVRVLVASAHRRDAFNACDFIMDYLKTQAPFWKKEHSREGAYWVKERDSDQQDADRWSSS. 158
445 8.000e-76gi|655851676|ref|WP_028958654.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter sp. 20_GPM-1509m]  clstr ali  49  1MRITVQEAAFDLGAETNAFAAGHTDMGAIVTFTGVVRDLDDPLVAMEIEHYPGMTEAALTDIATRAQERWHLGDVLVIHRYGRMAPGEAIMMVATAAPHRRDAFEAAEYLMDFLKSRAPFWKREITANGAEWVEAKDTDEDALSRW.... 148
446 8.000e-76gi|951418463|ref|WP_057791738.1| molybdenum cofactor biosynthesis protein MoaE [Roseovarius atlanticus]  clstr ali  42  1MDIRVQDAAFDLGAEVNGFAARQTGMGAVVSFTGIVRDIAPGLEAMQIEHYPGMTEKALAGIAEEAQRRWSLGDVLVIHRFGALQPDEMIMMVATSSPHRADAFQAAEFLMDYLKSRAPFWKKEVTREGADWVDAKDEDEDALGRW.... 146
447 8.000e-76gi|960423082|ref|WP_058315002.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Thalassobius]  clstr ali  43  1MRIVVQEAPFDLGAESDAFAAQHEGMGAVVTFTGIVRNNAEGLQSMQIEHYSGMTEKALTKIAEEAIKRWDLGDVLVIHRYGNLKPGERIMMVATASKHRADAFQAADFLMDFLKSRAPFWKKEITSNSAEWVAAKDDDEDALKRW.... 147
448 8.000e-76gi|947445046|ref|WP_056109490.1| MULTISPECIES: molybdopterin synthase catalytic subunit [Mesorhizobium]  clstr ali  47  8.SVRIQAEDFDLAAEMARVAAGRKDIGAIVTFSGLCRDEAGALAALELEHYPGMAEAEIGRIAMEAMARWPLQGLTAIHRYGKVRPGENIVLVIAASAHRQAAFEAASFLMDYLKSRAPFWKKEHRADGTQWIDAKEADERATARWDRTS 158
449 9.000e-76gi|490450177|ref|WP_004321067.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Thauera]  clstr ali  44  12..VSVQHEDFDVGGEIARLGEGRRDVGAVASFVGLVRDANDGVRAMTLEHYPGMTERALEEIVEQAKARWSLLSVRVIHRYGRLEPADRIVFVGVTSAHRGEAFAACEFIMDYLKTRAPFWKCEETPQGARWVDARESDD.......... 151
450 9.000e-76gi|494065601|ref|WP_007007671.1| molybdenum cofactor biosynthesis protein MoaE [Nitratireductor aquibiodomus]  clstr ali  49  9..VRVQAGDFDLATEARRLTDGRRDVGAVVSFTGLCRDEDGRLEALELEHYPGMAEAEIGRIADEAAQRWPLSGLTVIHRFGRIAPGENIVLVVAASAHRRAAFEAADFLMDYLKSRAPFWKKEHAAGETEWVEAKDRDQEDMKRWER.. 156
451 9.000e-76gi|654396465|ref|WP_027872543.1| molybdenum cofactor biosynthesis protein MoaE [Spongiibacter marinus]  clstr ali  40  1MKVLVQVEDFDAGAEVAQLR--STASGAIVQFVGVMRDQGDTVASMHLEHYPGMTESSIERILVEASERWSLLGCTVIHRVGTVLPGEQIVLVAVSAAHRHAAFQACEFVMDYLKTQAPFWKKEQLHNGERWVDARESDDRAAARW.... 147
452 9.000e-76gi|960420109|ref|WP_058312042.1| molybdenum cofactor biosynthesis protein MoaE [Phaeobacter sp. CECT 7735]  clstr ali  41  1MRIVVQSAPFDFGAEAQGFASGHKDMGAIVTFTGVVRDEGDTLDRMVIEHYPGMTEKALEKIATEAMSRWGLGDALVIHRFGELRPGDMIMMVATAAPHRVDAFDAAEYLMDYLKSRAPFWKQEFTSDGGAWVAAKDEDEDALKRW.... 147
453 1.000e-75gi|941808894|ref|WP_055188084.1| molybdenum cofactor biosynthesis protein MoaE [Aliiroseovarius crassostreae]  clstr ali  42  1MTVRVQNEEFDPSDELRGFGRGRSDVGAVVSFTGVVRDDDGSLDRMEIEHYPGMTEKAIAAMVDQASGRWQLADCLVIHRHGPMRPGDQIMMVATAAKHRVAAFEAAEFLMDYLKSRAPFWKKEFTRAGATWVDAKVNDEEALKRWSE.. 149
454 1.000e-75gi|517747006|ref|WP_018917214.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas zhanjiangensis]  clstr ali  45  3IRVYVQATPFALADGYEQVLAQRTDIGAVVSFTGLVRDFNEDVTGLTLEHYPGMTERTLESIGEQAWQRWSLQAVYIVHRVGYLTPGDPIVRVLVASAHRREAFEACDFIMDFLKTQAPFWKKEHSGQGEYWVKERTTDTQDAARW.... 150
455 1.000e-75gi|654384980|ref|WP_027863695.1| molybdenum cofactor biosynthesis protein MoaE [Massilia alkalitolerans]  clstr ali  42  1MPVRVQHEDFDLSTEIAALRAGQPGVGAVVAFVGTVREMNDAVSHMELEHYPGMTEAALEAIAQEASRRWPVADILVIHRIGALRGCDQIVLAAVAARHRGEAFAACEFVMDYLKTRAPFWKKEMRADGAHWVEARASDEAGMAKWHAGA 152
456 1.000e-75gi|916620401|ref|WP_051227492.1| hypothetical protein [Oceanospirillum beijerinckii]  clstr ali  46  2............GQISADISEGRTDIGAIVSFTGLVRDFNEDVTALTLEHYPGMTESALDNIIQQACERWPLQDVRVIHRVGRLTPGDPIVLVVTASAHRLAAFDACAFIMDYLKTQAPFWKKENTDYGDYWVSARESDQNAAARW.... 137
457 1.000e-75gi|653445069|ref|WP_027536993.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium sp. URHA0002]  clstr ali  41  5VTIRIQQADFDIGHEIAALTRSRTDVGAVVTFSGICRGNGEPIAALTLEHYPGMAEAEIQRHADEAMARWPLTGLTVIHRVGRITPGENIVVVLAASQHRQAAFQAAEFLMDYLKANAPFWKREESQNGTNWIEARGHDETAAKRWTKS. 155
458 1.000e-75 GL0111328 [Complete] locus=scaffold55032_4:6961:7416:+  ali  32  1VKISVQTEDFDVQKEYGELKA-NPHAGAVVMFVGNVRDINEGIEKMSLEHYPGMTEKSLTKIVKEAQERWHIQDATVIHRVGDLEINDQIVFVGVSGGHRGECFDACEFIIDYLKTEAPFWKKETIDGKGKWVDARESDDEAMSKWN... 148
459 1.000e-75gi|445565580|gb|ELY21689.1| Molybdopterin biosynthesis MoaE [Halomonas titanicae BH1]  clstr ali  48  9IKVTIQAAPFPMDYGYDDALAGRSDIGAVVSFTGLVRDFNEDVTGLTLEHYPGMTERTLTEIGEQAWQRWSLQAVRIIHRVGYLGPGDPIVRVLVASAHRREAFEACDFIMDYLKTQAPFWKKEHSAQGEYWVKERHSDQQDAARWE... 157
460 1.000e-75gi|517744099|ref|WP_018914307.1| hypothetical protein [Thiomonas sp. FB-6]  clstr ali  41  4..VRIQTEAFDAGAESRRLRAGRIDIGALVVFEGICRDHAEGVQSLELEHYPEMTRASIERMVGQARVRWPLQGAVVVHRVGLLHPGDPIVLVVVASSHRHDAFEACAFLMDYLKTQAPLWKKEATPQGAQWVDAREADDEALARWGIES 154
461 1.000e-75gi|797171377|ref|WP_045845888.1| molybdenum cofactor biosynthesis protein MoaE [Aquitalea magnusonii]  clstr ali  43  5.TVRIQHEVFDCSAEIARLSA-NPACGAVVSFSGLVRDYGDDIAALELEHYPGMTERSLHAIIQQARERWQLQAATIIHRVGRLALGEAIVLVVTASSHRKDAFAAAEFLMDFLKTEAPFWKKEIQQDGSYWVEAKASDQHAAGRWQ... 152
462 1.000e-75gi|1012314284|gb|AMS32314.1| molybdenum cofactor biosynthesis protein MoaE [Betaproteobacteria bacterium UKL13-2]  clstr ali  35  3.TIRVQHDDFDLSAEQALVRARHRDVGAITSFVGVVRDINDGISTMTLEHYPSMTETALKKIVDDAARRWNVIDATVIHRVGELAPRDQIVLVLVASRHRGHAFEACEFIMDFLKTDAPFWKKEVTQDGAKWVDARATDDDARQRWE... 150
463 2.000e-75gi|902714674|ref|WP_049630103.1| hypothetical protein [Cellvibrio sp. pealriver]  clstr ali  38  4.SISVQKHDFDVGQEYAALVANNTTAGAIVFFVGRVRDFSDGVEKLSLEHYPGMTEKVLEQILEVAIQRWSLVSARIVHRVGDLLLGDQIVFVGVSSAHREHAFQAADFLMDFLKTQAPFWKKESTAQGIVWVEAKRKDEEASKRWKEE. 153
464 2.000e-75gi|655488886|ref|WP_028870385.1| molybdenum cofactor biosynthesis protein MoaE [Psychromonas arctica]  clstr ali  36  1.MISVQELDFNQQVEYDRL-KSTTKIGAIVTFTGLVRDEGQGVSDLALEHYPGMTEKCLQDIVQQAQQRWNIIDFTIIHRVGQLTISDQIVFVGIASQHRGDAFAACEFIMDYLKTQAPFWKKETMANGEKWVDAREHDQHALTKWQ... 148
465 2.000e-75gi|493994900|ref|WP_006937573.1| molybdenum cofactor biosynthesis protein MoaE [Labrenzia aggregata]  clstr ali  50  7..VRVQAEDFDLQAESLRLTEGRKDVGALVTFTGLCRDEAGTLAALELEHYPGMAEAELTRIAGEAAARWPLTGLTVIHRFGKIAPGHNIVLVIAASSHRRAAFEAADFLMDYLKTRAPFWKKEHPAEGGAWVEAKTEDDTDAARW.... 152
466 2.000e-75gi|499148425|ref|WP_010861753.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Plesiomonas shigelloides]  clstr ali  39  7.RIRVSEDDFDIAAEYTWLNQDD-SCGAVVTFTGKVRNHSGSVNGLHLEHYPAMTDKALNDIISEARARWPLGRVSLIHRVGELGSGEQIVYVGVSSGHRLAAFAAAEFIMDYLKVRAPFWKKEQMPDGARWVEAKTSDQEAARRWQSE. 155
467 2.000e-75gi|499889404|ref|WP_011570138.1| molybdenum cofactor biosynthesis protein MoaE [Roseobacter denitrificans]  clstr ali  45  1MRVVVQDAPFDFGHEAQAFARGHTSMGAIVTFTGVVRDTNEPLEAMEIEHYPGMTEAALTDIAEQAISRWSLGNALVIHRHGRLVPGEMIMMVATAARHRKDAFEAAEFLMDYLKSRAPFWKREITSQGASWVAARDEDEAALERW.... 147
468 2.000e-75gi|655005413|ref|WP_028454567.1| hypothetical protein [Chitinilyticum litopenaei]  clstr ali  38  3VTIRVQEADFSLADEYALL-AGRPEVGAVVAFVGLVRDVPGRLAGMTLEHYPGMTEKQLGKIVAQAGERWPLSAVTVIHRVGELKLSDQIVLLLTASAHRDAAYAASQFIMDWLKNDAPFWKKETTGEGAAWVEAKDSDAKALARWQQ.. 149
469 2.000e-75gi|548225197|ref|WP_022444148.1| molybdopterin biosynthesis protein MoaE [Sutterellaceae bacterium ND3]  clstr ali  41  5.KVIVRHEDFDVSREMEELRKGSGSAGAMVAFTGVVRNQGDDIFALTLEHYPGMTESAITAIADKARARWELDDIVVIHRVGRLEVGDQIVLCLVTSAHRGEAFEACEYIMDWLKTEAPFWKKEETPSGSRWVDARESDEKAKARWQ... 152
470 2.000e-75gi|914208236|ref|WP_050524652.1| molybdenum cofactor biosynthesis protein MoaE [Pseudorhodobacter wandonensis]  clstr ali  44  1MRITIQSEPFDMGAESNAFATSAKGAGAIVTFTGITRDNAGDLQVMEIEHYPGMTERALTDIAETAMQRWQLDDCLIIHRYGRLAPQDPIMMVATASRHRADAFAAAEYLMDYLKSRAPFWKKEIAKSGASWVAARDVDEAALKRW.... 147
471 2.000e-75gi|654531879|ref|WP_027999968.1| molybdopterin synthase catalytic subunit [Sinorhizobium arboris]  clstr ali  45  5ITVRVQRDNFDIAAEVSALCRGRTDIGAVVTFSGLCRDEAGALSALELEHYPGMAEAEMERICREAIERFRLQAATAIHRFGRMAPGENIVLVITASPHRQAAFDGANFIMDFLKTSAPFWKKEHHADGSAWVSAKDADDAARGRWTR.. 154
472 2.000e-75gi|516742628|ref|WP_018077462.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  48  1MKIVIQCEAFDLGAEVDAMRRGRTGIGAIASFIGLARDEGSGVHAMTLEHYPGMTEKALAALVDEANSRWTLLDVTVIHRIGRLLPGDPIVLVAVASQHRGEAFAACEFIMDYLKTQAPFWKKEATPEGERWV................. 135
473 2.000e-75gi|518928701|ref|WP_020084576.1| hypothetical protein [Hyphomicrobium zavarzinii]  clstr ali  42  1MAVRVQREAFDVAEEIRLLTDRRTDVGGIVTFTGLVRGEAGGLQTLTLEHYPGMTELELGRIDDEARERFGLTGSLVVHRFGELKPGDPIVLVITLSAHRRAAFEAAEFLMDYLKSRAPFWKKESFADGETWVDERASDGAALARWTGAS 153
474 2.000e-75gi|655038671|ref|WP_028487428.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira chilensis]  clstr ali  38  6.HIKIQQEDFDLSTEIARLREGHADIGAVVSFVGTVRDEGDDVAVLELEHYPGMTEKALEKIRLEAHERWALESSVIIHRIGKMYPTDQIVLVAVSSRHRENAFYASHFIMDYLKTNAPFWKKETLPNGERWVDARLSDKDAEKRWK... 154
475 2.000e-75gi|764485988|ref|WP_044387971.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter excellens]  clstr ali  38  1.MVSIQTEDFDVGAEYEALRGSGSGTGAVATFSGLVRDSGDGVTGLFLEHYPGMTEQVIQGLIESASQRWDVRQARVIHRVGRLALSDQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITGDTEHWVEQKESDLDRSQAWE... 148
476 2.000e-75gi|563755296|ref|WP_023786748.1| molybdenum cofactor biosynthesis protein MoaE [Hyphomicrobium nitrativorans]  clstr ali  43  1MAVRVQHEPFDAVAEVEALTRGRIDVGGIVTFTGLVRGDGRPLISLTLEHYPGMTEAELGRIEVEARKRFDLVDCVVVHRVGELTPGEGIVLVVALSRHRQAAFEAAEFLMDYLKTRAPFWKKETFADGANWVDARDSDSRAEARWGGES 153
477 2.000e-75gi|739348746|ref|WP_037210950.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae]  clstr ali  44  1MAVRVQHEPFDFGAEANAFAAGRSDAGAVVTFTGIVRDLAGDLDRMEIEHYPGMTERALGGIEAEARARWDLRDCLIIHRFGTMVPGDMIMMVATASPHRADAFQAAEFLMDYLKSRAPFWKKEYTRDGALWVDSKDADEAALGRWAK.. 149
478 2.000e-75gi|738978042|ref|WP_036861398.1| hypothetical protein [Porticoccus hydrocarbonoclasticus]  clstr ali  39  1MTVAVQAADFDTGQEIRQLQADRTDVGGIAIFTGQVRDTGDPLGFMHLEHYPGMTEASLQQTAEQAEQRWALIDIRIVHRIGDLLPGDQIVFVGVSSIHREAAFNACEFIMDHLKTHAPFWKKEYYRDGSKWVDAKQTDQQRYARWHQ.. 150
479 3.000e-75gi|52307131|gb|AAU37631.1| MoaE protein [Mannheimia succiniciproducens MBEL55E]  clstr ali  35  15IKIAVQEAEFDQNSEYRWLSQSD-SVGASVIFVGKVRDLGDEVSSLYLEHYPAMTEKALNEIVDEAKSRWDIQRVVVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTKAPFWKKEKTDKGERWIESRDSDQQAAEKW.... 161
480 3.000e-75gi|759465015|ref|WP_043186340.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas rhizosphaerae]  clstr ali  46  1MSVRVQHEPFDPGSELNALHQANTGVGAVVGFVGYVRDFNDGVRGMLLEHYPGMTEKALDKIVFEAAQRWPLLRLEILHRVGALEPGEPIVFVGVASAHRQAAFQACDFVMDYLKTRAPFWKKENTEDGPRWVQGRESDEQAAQRWE... 149
481 3.000e-75gi|916635325|ref|WP_051242416.1| molybdopterin synthase catalytic subunit [Stappia stellulata]  clstr ali  43  21ITVRIQLEDFDTAREIERLSETGANVGAVVSFTGLCRDENGRLSALELEHYPGMAEAEIGRIARDAAARWPITGLTAIHRHGRIAPGENIVLVVAASRHRAAAFQAADFLMDYLKTRAPFWKKEHLRDGGSWVDAREADTRAADRWSR.. 170
482 3.000e-75gi|1011752814|ref|WP_062576274.1| MULTISPECIES: molybdopterin synthase catalytic subunit [Rhizobium]  clstr ali  46  8..VRVQRDDFDLAHEVQALSAGRHDIGAIVTFSGLCRDEAGTLSALELEHYPGMAEAEITRICNEAVQRFGLQAVTAIHRYGTIASGENIVLVCAASPHRQAAFDGANFIMDFLKTSAPFWKKEHAADGSEWVSAKDADDSARDRWTKE. 156
483 3.000e-75gi|800981930|ref|WP_046008205.1| hypothetical protein [Oleispira antarctica]  clstr ali  34  1.MISVQNEDFDFANEYQQLRKRSLQSGAIVMFVGLVRDFSDNVSSMTLEHYPGMTENVLNGIAQQAEQRWPLDGVRIIHRVGELHAADQIVLVGVSSAHRIAAYEASQFIMDILKTEAPFWKKESTQDGERWVDAKNSDSQQAADWHTP. 155
484 3.000e-75JCVI_PEP_1096666532085 /source_dna_id=JCVI_ORF_1096666532084 /offset=0 /translation_table=11 /length=179 /full_length=179  ali  35  28.RLRIQTEDFDLATEYQFLRQPSSSVGAVVTFTGLVRDFEGSIDSLSLQHYPGMTEKLLQEIVDQANSRWNLIGTTVIHRVGKLLPCDQIVFVGVASQHRADAFEAAQFIMDYLKTKATFWKKVDQDGQQHWVESKDSDQAASQRWTTD. 177
485 3.000e-75gi|653085499|ref|WP_027335875.1| molybdenum cofactor biosynthesis protein E [Halomonas sp. HL-48]  clstr ali  45  3ITIRVQAAPFDMAFGYEDSIAGRTDIGGIVSFTGLVRDFNEDVTGLTLEHYPGMTEATLQQIAEQAGERWSLNAVTIIHRVGYMRPGDAIVRVLVASAHRREAFEACDFIMDWLKTQAPFWKKEHGRQGDYWVKERRSDIDDAARW.... 150
486 3.000e-75gi|940690750|ref|WP_055024181.1| molybdopterin synthase catalytic subunit [Shewanella sp. P1-14-1]  clstr ali  39  13..VRVQTADFNVADEYAAIAADNSD-GAVVTFAGKVRDFNDGVTDLTLEHYPGMTETVLVQLAEQAYERWPLNYVTIIHRVGRMELGEQIVFIGVTSMHRKAAFAACEFLIDFLKTKAPFWKLEAGEEGNNWVEARDSDEQAASMWN... 158
487 3.000e-75gi|754662736|ref|WP_042044812.1| molybdenum cofactor biosynthesis protein MoaE [Aeromonas simiae]  clstr ali  39  7..IVVQREDFSLAAEYERL-AARRDSGAIVTFVGKVRDFNQGVAGLSLEHYPGMTEKALAAIVREAEVRWPLQACTLIHRVGDLLLGDQIVLVAVSSAHREAAFAACHFIMDYLKTRAPFWKRELSHDGRRWVEAKESDNEAAARWQE.. 154
488 3.000e-75gi|491950460|ref|WP_005687384.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus influenzae]  clstr ali  36  4IQISVQEQPFDQNAVYQWLSAQH-SVGATVIFVGKVRDLGDTVSSLYLEHYPAMTEKALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALEKW.... 150
489 3.000e-75gi|944192999|ref|WP_055674560.1| molybdopterin synthase catalytic subunit [Labrenzia alba]  clstr ali  46  6.TVKVQREDFDATEEASRLTSGRKDVGALVSFVGLCRDEAGTLNALELEHYPGMAEAELGRIASEAIECWPLTGLTVIHRYGKIAPGKNIVLVIAASAHRRAAFEAADFLMDFLKTRAPFWKKEHLNSGSSWVDARADDEEDATRWSN.. 154
490 3.000e-75gi|499220366|ref|WP_010917906.1| molybdopterin synthase catalytic subunit [Caulobacter vibrioides]  clstr ali  100  1MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARALELEAYPGFTDAAITEIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPFWKKEHGPEGPRWIEPTARDRTDAQRWDQEA 150
491 4.000e-75gi|550980096|ref|WP_022728204.1| molybdenum cofactor biosynthesis protein MoaE [Fodinicurvata sediminis]  clstr ali  39  1MTVRIQEEDFDPGSELEKLTGGQTAIGGVTSFIGLVRDMAGDVTGMTLEHYPGMTEKMLERIEAEAHERWPLNASLIIHRVGPLEAGDRIVMVATASAHRQATFDSCHFLIDWLKTKAPFWKAERTREGQEWVEARESDDEASERWNR.. 151
492 4.000e-75gi|505310883|ref|WP_015497985.1| molybdopterin-converting factor subunit MoaE [Octadecabacter antarcticus]  clstr ali  41  1.MIRVQAMPFDPGGELNVFSASVAGAGAIVSFTGVVRDVAGGLSGMEIEHYPGMTEKALSAIRGEAMQRWDLADALVIHRIGQLEAHESIMMVATASQHRKSAFEAAEFLMDYLKSRAPFWKKEITLDGSDWVDSKAEDEDALSRW.... 145
493 4.000e-75 GL0013392 [Complete] locus=scaffold79696_1:5117:5572:-  ali  36  6.KIRVSHDDFDVSEEIAALEREGRNAGAVVTFTGVVRSD-DGVTAMHLEHYPEMTEKSLAQIVEKARARWNIEDVVIIHRVGELKAGDRIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKEVTAQGGRWVDARESDEIAKNRWGK.. 151
494 5.000e-75gi|1011876689|ref|WP_062693521.1| molybdopterin synthase catalytic subunit [Rhizobium sp. Leaf341]  clstr ali  45  14ITVRVQPGDFDTAAEIDALSAGRTDIGAVVTFSGLCREEKGQLAALELEHYPGMAEAEIRRICETAVARFDLQGATAIHRFGRIAPGDRIVLVIVASTHRQAAFDGASFIMDYLKTAAPFWKKEHLKDGTAWVSAKDTDDTARDRWS... 162
495 5.000e-75gi|738648272|ref|WP_036557128.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola sp. MCTG156(1a)]  clstr ali  42  1MSVRVDSAPFDAGAELNRFAAAQTGAGAVVSFTGIVRDVAGGLRAMEIEHYPGMTEKAIAAMVETALERFGLTGALVIHRYGRLMADDPIMMVATAAPHRKDAFAAAEFLMDYLKSRAPFWKKEVTGDGTGWVASKDEDEEALGRWGRE. 149
496 5.000e-75gi|653063604|ref|WP_027314919.1| molybdopterin synthase catalytic subunit [Microvirga flocculans]  clstr ali  45  4.TIRIQAEPFDTAAETASLTGGRADIGAVVAFTGLCRDEGGRLAALELEHYPGMAEAEIGRIAAQAETRWPLLGLTIVHRFGRILPGDEIVLVLAASAHRQAAFEAAAFLMDYLKTHAPFWKREHLKDGTVWVEAKEADDRATERWGHA. 153
497 5.000e-75JCVI_PEP_1096676808227 /source_dna_id=JCVI_ORF_1096676808226 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  45  7..ISIQAEPFSLADESAALARSTGDVGAVATFTGYCRSEGGRLSALELEHYPGMAEEEIQRVVDEAVTRWPLMAVRVIHRFGRMTPGDEIVFVGTVSTHRREAFAACEFLMDYLKTRAPFWKKEYLADGGEWVEAKAADDVATLRWAKP. 155
498 5.000e-75gi|902771076|ref|WP_049642173.1| molybdenum cofactor biosynthesis protein MoaE [Candidatus Rhodobacter lobularis]  clstr ali  46  1MVVRVQAEPFDVGAELAAFAAGRQDVGAEVSFSGVVRDDG-GLAAMEIEHYPGMTEKALAKIEAEAVARWDLKASLVIHRYGRLEPGEKIMMVATAAGHRAEAFEAAQFLMDYLKSRAPFWKKETGADGASWVAAKDADEDALERW.... 145
499 5.000e-75gi|497409224|ref|WP_009723422.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. TD01]  clstr ali  43  11IAVRVQEEPFKMDDGYESLLRKRTDIGAIVTFTGLVRDFNEDVIGLTLEHYPGMTERTLTQIGEQAYQRWALQAVQIIHRIGDLTPGDPIVRVLVASAHRRDAFQACDFIMDFLKTQAPFWKKEHSRQGAYWVKERHTDQQAAERW.... 158
500 6.000e-75gi|654839605|ref|WP_028292258.1| hypothetical protein [Oceanobacter kriegii]  clstr ali  39  9.RIQVQTADFSVDEEYQRLCCDNAADGAVVFFVGRVRDQGDQVSLLELEHYPGMTEKALQGIVDDARSRWQLGRVSVVHRVGPMNIEEQIVFVGVSSPHRGNAFEAAEYIMDYLKSRAPFWKKERILDEERWVDARDSDSAALERWE... 162
501 6.000e-75gi|736854384|ref|WP_034854222.1| molybdopterin synthase catalytic subunit [Ensifer sojae]  clstr ali  47  5ITVRVQREDFDLGTEISALCRGRADIGAVVTFSGLCRNEAGALNALELEHYPGMAEAEINRICRVAVTRFGLQGATAIHRFGRIAPGENIVLVIAASPHRQSAFDGANFIMDFLKTSAPFWKKEHRADGSEWVSARDADDAARGRWARE. 155
502 6.000e-75gi|1011938189|ref|WP_062746476.1| molybdenum cofactor biosynthesis protein MoaE [Erwinia persicina]  clstr ali  41  6.RIRVGCAPFSMSDEYQWLAASDLD-GAVVTFTGKVRNHGDNVRALRLEHYPGMTEKALAEIVDEARQRWPVQRMTVVHRIGELFPGDEIVLVGVSGAHRGAAFSAAEFIMDQLKTRAPFWKQEATPEGDRWVDSRDSDRQAADRWK... 152
503 6.000e-75gi|880954033|ref|WP_048690449.1| hypothetical protein [Gammaproteobacteria bacterium Q1]  clstr ali  34  1.MIKVQAEDFIVADEYNKLIKDNQQDGAVVFFVGMVRDFNQNITSLTLEHYPAMTEKSLAQLEVQAKQKWQLGRVSIVHRFGRLELGEQIVFVGVTSMHRKSAFEAAEFIMDTLKTTAPFWKKEQTTDSEHWVEAKQSDTEQAQKWQE.. 149
504 7.000e-75gi|738292378|ref|WP_036246125.1| molybdenum cofactor biosynthesis protein MoaE [Massilia sp. BSC265]  clstr ali  40  1MQVRVQREDFDLSTEIAELRAGQRDIGAVLAFVGTVREMNGAVSHMELEHYPGMTEAALKAIAIEASQRWSITDILVIHRIGSLQACDQIVLTAVAARHRGEAFAACEFVMDYLKTKAPFWKKETTERGAQWVEARASDEASLAKWHTTA 152
505 7.000e-75gi|499813836|ref|WP_011494570.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella denitrificans]  clstr ali  35  5VKIAVQEADFDHAQEYARIAQDN-NDGAVVTFCGKVRDFNEGITRLTLEHYPGMTESVLAQICQQALQRWSINHLTVIHRVGSLDLGEQIVFIGVSSAHRGDAFAACEYLIDFLKTKAPFWKLEATHQGERWLDARDTDEVAANTWQQ.. 153
506 7.000e-75gi|947606046|ref|WP_056269212.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Pelomonas]  clstr ali  38  5.RVCIQSEDFDLSREAATLRIADGGVGAVVAFVGTVREHGAAVSAMELEHYPGMTEAAIETMVDEALARFDIRAAKVIHRVGTLQARDQIVLVLVSSAHRGQAFQACEFLMDYLKTQAPFWKKEHTPGGAHWVDARVTDDEALARWGIAA 155
507 7.000e-75gi|931420295|gb|KPK06688.1| molybdenum cofactor biosynthesis protein MoaE [Betaproteobacteria bacterium SG8_39]  clstr ali  42  1MKIAIQREDFDAGAEARALSAGNPAVGAVASFVGLVRDRNDGVATMTLEHYPGMTEKAIARIVDEARGRWQVIDCTVIHRIGELSPAEQIVLVAVASGHRGDAFAACEFIMDFLKTQAPFWKKEATPDGARWV................. 135
508 7.000e-75gi|914672626|ref|WP_050663172.1| molybdenum cofactor biosynthesis protein MoaE [Roseovarius tolerans]  clstr ali  44  1MDIRVQEAPFDLGVEANAFAARQSGMGAVVTFTGIVRDLGGDLSAMEIEHYPGMTEKALHAIADEAANRWQIGDALILHRHGRLAPDEMIMMVATASRHRADAFQAAEFLMDFLKSRAPFWKKEVTDAGADWVAARTEDEDALTRW.... 146
509 8.000e-75JCVI_PEP_1096678544949 /source_dna_id=JCVI_ORF_1096678544948 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  36  5..VLIQNADFDFAYEYQSLLDNNNKDGAVVCFVGLVRDYNQGVSGLTLEHYPGMTEKALRDIVIKAKKRWPVGQVRVIHRIGELKLSEQIVFVGVTSKHREAAFAANQFIMDYLKNDAPFWKKEQTNKGDRWVEAEKKDLDAKNRWDHTS 154