current user: public




Query: ACL93483.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# E-value Template Links and tools%idFirst MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARALELEAYPGFTDAAITEIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPFWKKEHGPEGPRWIEPTARDRTDAQRWDQEALast
1 7.000e-86gi|676255171|dbj|BAP41417.1| molybdopterin converting factor, subunit 2 [Pseudomonas sp. StFLB209]  clstr ali  44  1MSVRVQAATFDPGAEVNALHAANRGVGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALGKIGDQARQRWPLLGVEVLHRVGNLEPGEPIVFVGVTSAHRQAAFEACEFIMDYLKTRAPFWKRETTPQGQRWVDGRSSDQQAADRWDTVG 152
2 2.000e-85gi|489554885|ref|WP_003459470.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas pseudoalcaligenes]  clstr ali  46  22MTIRVQAQPFDPGTELNALHAANLGIGAVVTFVGYVRDFNEGVGGMFLEHFPGMTEKALAKIADEARERWPLLGIEIIHRIGRLEPGEPIVFVGTSSAHRQAAFDACNFIMDYLKTRAPFWKKEDTSEGPRWVEGRCSDQSAAERWK... 170
3 3.000e-84gi|498172430|ref|WP_010486586.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. S9]  clstr ali  44  1MSIRVQPDAFDPGDELSRLHAQNLGVGAVVTFVGYVRDFNEGVGGMFLEHFPGMTEKALGKIVDEATQRWPLLKVELIHRIGRLEPGEPIVFVGTSSAHREAAFEACAFIMDYLKTRAPFWKKEDTADGPRWVEGRCSDQQAAQRWKQD. 151
4 2.000e-83gi|501027072|ref|WP_012079173.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium sp. Marseille]  clstr ali  41  1MPVRVQTENFDVSHEVAALRAHSPQVGAVVTFIGTVRDMNDGVAEMELEHYPGMTEKALQNIVEQAKARWPIFDALVIHRIGPLLPLEQIVLVAVTSAHRGEAFSACEFIIDYLKTDAPFWKKEQTPQGARWVDARTTDDTALAKWKQPS 152
5 2.000e-83gi|497209655|ref|WP_009523917.1| molybdenum cofactor biosynthesis protein MoaE [Ralstonia sp. PBA]  clstr ali  43  1MPIRVQTEDFDLGREIAALRAGSPQVGAVASFIGTVRDINDGVSAMELEHYPGMTEKALEQIVAAARQRWEIIDALVIHRVGPLRPLDQIVLVAVTSAHRGEAFAACEFIMDYLKSEAPFWKKEQTPAGARWVDARVSDDAALKRWGIE. 151
6 3.000e-83gi|654858854|ref|WP_028311182.1| molybdenum cofactor biosynthesis protein MoaE [Derxia gummosa]  clstr ali  46  1MPVRVQTEDFDLGAEIAALRAGDPCVGAVATFLGTVRDANGEVRELVLEHYPGMTEKSLEAICAEARGRWDLLDILVIHRVGPLRPTDQIVLVAVTSAHRGEAFAACEFVMDYLKTRAPFWKKERTPDGERWVEARDSDDSAADRW.... 151
7 7.000e-83gi|515698157|ref|WP_017130757.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas agarici]  clstr ali  44  1MAIRVQTEAFDPGLEVNALHAANLGIGAVVSFVGYVRDFNDGVAQMFLEHYPGMTERALNKIVVQAQERWPLLGLEVVHRVGSLEPGEPIVFVGVTSAHRQAAFDACNFVMDYLKTQAPFWKKETTADGSRWVEGRASDQTAAGRWK... 149
8 7.000e-83gi|491919901|ref|WP_005672414.1| molybdenum cofactor biosynthesis protein MoaE [Lautropia mirabilis]  clstr ali  42  8..IHVQTQDFDVGAELKRLQALTREVGAVASFVGYVRDSNDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRHRDAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQAG. 157
9 1.000e-82gi|495920852|ref|WP_008645431.1| molybdopterin synthase, large subunit [Cupriavidus sp. HMR-1]  clstr ali  46  1MAVRVQHEDFDLGAEVVALRAGNPGVGAVASFIGTVRDVSEGVSTMELEHYPGMTEKALETIEAAARERWPLLGVTIVHRVGLLQPLDQIVLVAVSSAHRGAAFAACEFIMDYLKSEAPFWKKEDTPEGARWVDARVSDDAALRRWGIES 152
10 1.000e-82gi|498494624|ref|WP_010795360.1| molybdopterin synthase catalytic subunit [Pseudomonas sp. HPB0071]  clstr ali  51  1MTIRVQAEAFDPGVETSAMHAANVGVGAVVTFIGYVRDFNDGVSGLYLEHFPGMTEKSLAKIAQEANSRWPLLKVDIIHRVGRLEPGEPIVFVGTASAHRQAAFEACAFIMDYLKTRAPFWKKEDTPQGPRWVEGKSSDISAAQRWK... 149
11 1.000e-82gi|503772213|ref|WP_014006289.1| molybdenum cofactor biosynthesis protein MoaE [Collimonas fungivorans]  clstr ali  36  3MPIRVQAEDFDFAAELAQLRLSNPKIGAVVSFLGTVRDLSDGVAQMELEHYPGMTEKALSAIIDQAKQRWEIFDALVIHRIGPLLPLDQIVLVAVSSAHRGDAFAACEYIIDYLKTEAPFWKKEHTEQGARWVDARSTDDEALAKWEQDA 154
12 1.000e-82gi|558878730|ref|WP_023534283.1| moaE family protein [Pseudomonas putida]  clstr ali  46  1MAVRVQEGAFDPGVETNALHAANVGVGAVVSFIGYVRDFNDGVAGMMLEHYPGMTEKALAKIVDEAQQRWPLLKVEVLHRVGYLAPGEPIVFVGVASAHRQASFEACNFIMDYLKTRAPFWKKETTGQGDRWVEGRQSDQDAAGRWGQSG 152
13 2.000e-82gi|516020402|ref|WP_017450985.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum rubrisubalbicans]  clstr ali  39  1MPVRVQTADFDLSTEVAQLRLSNPRVGAVVSFVGTVRDLNEGVSAMELEHYPVMTERALEQIVQQAKARWPIFEALVIHRVGPLQPCEQIVLVAVTSPHRGEAFAACEFIMDYLKTQAPFWKKEQTPQGARWVDARESDDTALAKWTQQ. 151
14 2.000e-82gi|490886456|ref|WP_004748425.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio tubiashii]  clstr ali  41  4.RVSVQFEDFSVGSEYEALAQG-TSAGAVVTFTGKVRDMNDNVTGLSLEHYPGMTEKALGEICNEAEQRWPLLNIRVIHRVGDLDIGDQIVFVGVSSAHRGAAFEACEFVMDYLKTKAPFWKKERTTESTRWVDSRDSDAKAAERWQQKS 153
15 3.000e-82gi|490764300|ref|WP_004626536.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Ralstonia]  clstr ali  44  1MSVRVQEADFDLGAEIAALRAGRPNIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALADIVSAAMQRWELIDALVIHRVGKLKPQDQIVLVAVASKHRGESFAACEFIMDYLKSEAPFWKKEQTPEGARWVDARVTDDKALARWG... 149
16 4.000e-82gi|612078241|gb|EZP37075.1| Molybdenum cofactor biosynthesis protein E [Janthinobacterium lividum]  clstr ali  40  4.TVRVQQADFDLSQEIAQLRAGNPKVGAVVGFVGTVRDMNEGVAAMELEHYPGMTEKSIETIVEQARGRWPLSGALVIHRVGPLLPQEQIVLVAVSSAHRGEAFAACEFIIDYLKTEAPFWKKEDTPEGARWVDARDSDETALDKWAAKA 154
17 4.000e-82gi|520810561|ref|WP_020298409.1| molybdopterin converting factor, subunit 2 [Pseudomonas sp. CF161]  clstr ali  44  1MAIRVQCAAFDPGAEVNALHAANVGVGAVVSFVGYVRDFNDGVAGMFLEHYPGMTEKALAKIAAEAQERWPLLRLEVLHRIGELLPGEPIVFVGVASAHRQAAFEACAFVMDYLKTRAPFWKKENTCDGPRWVQGRDSDHAAADRWK... 149
18 5.000e-82gi|495387736|ref|WP_008112439.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum sp. YR522]  clstr ali  40  1MPVRVQTADFDLSTEVARLRLANPGVGAVVTFLGTVRDLNEGVSTLELEHYPAMTERALQQIVDQARARWPIFDALVIHRVGPMQPQEQIVLVAVTAPHRGEAFAACEFIMDYLKTQAPFWKKEQTPDGARWVDARESDDIARDKW.... 148
19 6.000e-82gi|499462771|ref|WP_011149916.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio vulnificus]  clstr ali  39  4.RISVQVEDFDIAAEYAWLSQGSA-AGAIVTFVGKVRDMNDNVTGLSLEHYPGMTEKALGEICDQAEQRWPLLNVRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTETTRWVESRESDAQAAERWQS.. 151
20 8.000e-82gi|517970511|ref|WP_019140719.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum massiliense]  clstr ali  39  1MPIRVQTEDFDLSTEVARLRAGNPAIGAVASFIGTVRDVNDGVTGMELEHYPGMTEKALEAIVEQARQRWRVIDALVIHRVGPLKPLDQIVLVAVASAHRGDAFAACEFIMDFLKTQAPFWKKEQTAQGARWVDARVADDKALARWGENS 152
21 1.000e-81gi|512439510|ref|WP_016415330.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas anticariensis]  clstr ali  49  1.MIRVQHEPFDPGREQRALIQGRSDIGAVVSFTGLVRDFNEEVEALTLEHYPGMTESALTDIVKEAESRWPLQGVCVIHRVGRLTPGDPIVLVVVASAHRREAFEACDFIMDYLKTRAPFWKKEHTSSGHYWVAERASDQRDARRWEEP. 150
22 1.000e-81gi|501368777|ref|WP_012400343.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia phymatum]  clstr ali  40  1MTVRVQTEDFDLSTEVAALRAQNPKVGAVACFVGTVRDINEGVETMELEHYPGMTEKSLEAIVDAARERWPGTEVLIVHRVGKLQPLDQIVLVATTSKHRGNAFASCEFVMDYLKTQAPFWKKEKTESGERWVDARVADEQALARWGLES 152
23 1.000e-81gi|545467332|ref|WP_021703833.1| molybdopterin synthase catalytic subunit [Vibrio proteolyticus]  clstr ali  40  4.RVSVQQQDFSVGDEYQRL-ALGSAAGAVVTFVGKVRDMNDNVTGLSLEHYPGMTEKSLLNICDQAEQRWPLLHTRVIHRVGDLDIGDQIVFVGVVSAHRGAAFEACEFIMDYLKTQAPFWKKERTTNQTRWVESRDSDTQAAKRWQK.. 151
24 1.000e-81gi|446272232|ref|WP_000350087.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio albensis]  clstr ali  42  4.RVSVQTEDFSVAQEYEALAQGS-QAGAVVTFVGKVRDMNDNVVGLHLEHYPGMTEKSLLEICDMAQERWPLQRVRIIHRIGDMLSGDQIVLVGVTSAHRNAAFAACEFIMDYLKTRAPFWKKELTTEASRWIDSRDSDHQAAQRWEQQ. 152
25 2.000e-81gi|515528283|ref|WP_016961500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio norvegicus]  clstr ali  40  1.MISVQHEDFSLAEEYQRL-NDSDSDGAIVTFIGKVRDMNDNVTGLTLEHYPGMTEKSLNEIVLQAKQRWPLTHIRVIHRVGALNIGDQIVFVGVTSAHRNAAFEACEFIMDYLKTRAPFWKKERLNDDERWVEARESDDTAANRW.... 146
26 2.000e-81gi|545464537|ref|WP_021701145.1| molybdopterin synthase catalytic subunit [Pseudomonas alcaligenes]  clstr ali  49  1MAVRVQVEAFDPGVEVNALHAANLGIGAVATFIGYVRDYNDGVRGMFLEHYPGMTEKALAGIIGEAEQRWPLLRVEVLHRVGRLQPGEPIVFVGIASAHRQAAFDACNFIMDYLKTRAPFWKKEDTPEGARWVEGRDSDQDAAARWSR.. 150
27 2.000e-81gi|694864374|gb|KGK08794.1| molybdopterin synthase catalytic subunit [Vibrio navarrensis]  clstr ali  40  4.RVSVQLEDFDLATEYAQLAQGSA-AGAVVTFVGKVRDMNDKVIGLSLEHYPGMTEKSLSEICDQAQTRWPLLSVRVIHRVGDLALGDQIVLVGVSSAHRSAAFEACEFIMDFLKTKAPFWKKEITTDQTRWVESRESDNKAAQRWHS.. 151
28 2.000e-81gi|662313958|gb|KEQ19228.1| hypothetical protein GZ78_04370 [Endozoicomonas numazuensis]  clstr ali  44  1.MISIQQEDFDPGSEQDQLSS-NCGTGALVTFTGLVRDENDDVGGLYLEHYPGMTEKALQAIIDEAAERWPLQAIKVIHRVGQLHPGDRIVFVGVASAHRKAAFEICEFVMDYLKTRAPFWKKETTAEGDRWVDARESDEEAAKRWGQE. 149
29 2.000e-81gi|496497410|ref|WP_009205946.1| molybdenum cofactor biosynthesis protein MoaE [Sulfuricella denitrificans]  clstr ali  40  1MEVRIQTEDFDLGAEILNLRRGNPGIGAVASFVGLVRDLNHSVTEMTLEHYPGMTEKALAEIMGEAKQRWNIIGALVIHRIGPLKPTDQIVLVAVSSAHRGDAFAACEFIMDYLKTRAPFWKKEQTEAGAHWVDARESDETAAQRWTAP. 151
30 2.000e-81gi|499934847|ref|WP_011615581.1| molybdenum cofactor biosynthesis protein MoaE [Cupriavidus necator]  clstr ali  47  1MSVRVQREDFDLGAEVAALRAGNPAVGAVASFIGTVRDVSDGVSAMELEHYPGMTEKALAQIEAAACARWALLGVTIIHRVGPMQPLDQIVMVAVASAHRGNAFAACEFIMDYLKSEAPFWKKEDTPEGARWVDARVTDEAALQRWGIAS 152
31 2.000e-81gi|552548479|ref|WP_023006460.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. PBN3]  clstr ali  48  1.MIRVQQAPFDAGEEQRALLAGRTDIGAVVSFTGLVRDFNEEVAALTLEHYPGMTEAALAAIVDEARERWPLDGVSVIHRVGRLAPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHASDGDYWVSERDSDHADARRWE... 148
32 2.000e-81gi|515276746|ref|WP_016835080.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum lusitanum]  clstr ali  38  1MPIRVQTADFDLSAEIAALRLNNPKVGAVVSFVGTVRDLNDGVQEMELEHYPGMTEKALGQIVIDAKARWEIFDALVIHRVGPLQPLEQIVLVAVTAKHRGVAFAACEFIMDYLKTQAPFWKKERTPEGARWVDARESDDQALSKWQAD. 151
33 3.000e-81gi|519012700|ref|WP_020168575.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Methylotenera]  clstr ali  38  1MSIQVQTEDFDVGLLLNQLRLANPSAGALVSFVGQVRDMNDGVNTLTLEHYPGMTETALAAIETQAHARWNLIDTLVIHRVGTLKPLDQIVLVAVLSAHRGEAFKACEFIMDYLKTQAPFWKKEITPTGERWVDAKLSDDESLEKWSK.. 150
34 3.000e-81gi|489535383|ref|WP_003440110.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Pseudomonas]  clstr ali  44  1MTVRVQAAAFDPGAQVNALHAANLGVGAVVSFVGYVRDFNDGVAGMFLEHYPGMTEKALDKIVLEAEQRWPLLRLEVLHRVGALEPGEPIVFVGVASAHRQAAFDACAFVMDYLKTRAPFWKKEQTGDGPRWVEGRVSDEEAADRWKK.. 150
35 3.000e-81gi|504003220|ref|WP_014237214.1| molybdenum cofactor biosynthesis protein MoaE [Azospira oryzae]  clstr ali  42  1MSVRVQQEDFDLSAEVAALRAGQPGVGAVAAFVGLVRDMNEGVSEMALEHYPGMTEKALEAIVAEARARWDILGARIIHRVGTLQPCDQIVLVAVSSAHRGEAFAACEFIMDYLKTRAPFWKREVTPAGARWVDARETDDSAAARWEKGG 152
36 3.000e-81gi|653577431|ref|WP_027591052.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. RL]  clstr ali  46  1MSVRVQTASFDPGAELNALHAAQLGIGAVVGFVGYVRDYNDGVAGMYLEHYPGMTEKALAKIVTEAEARWPLLQVEVLHRVGALTPGEPIVFVGTASAHRQAAFAACDFIMDYLKTRAPFWKREDTAEGARWVEGRDSDQQAAARWDQ.. 150
37 3.000e-81gi|546180324|ref|WP_021821045.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. BJGMM-B45]  clstr ali  45  1.MIKVQYEPFDAGQEQQSLLAGRTDIGAVVSFTGLVRDFNEDVEALTLEHYPGMTEASLVQIADEAHQRWSLSGLTLIHRVGRLAPGDPIVLVIVASEHRRAAYEACEFLMDYLKTRAPFWKKEHTASGDYWVSEREQDHADAQRWEVG. 150
38 3.000e-81gi|490372462|ref|WP_004252066.1| molybdopterin biosynthesis MoaE protein [Thauera sp. 63]  clstr ali  43  10.SVSVQQADFDVGGEIAALSEGRRDVGAIASFVGLVRDLNDGVSAMTLEHYPGMTEKALEEIVEQARQRWSLQGVRVIHRFGRLEPADRIVFVGVASPHRGEAFAACEFIMDYLKTRAPFWKCEETPGGARWVDARESDDSAAARWQ... 157
39 3.000e-81gi|498503125|ref|WP_010803823.1| molybdopterin converting factor large subunit [Pandoraea sp. SD6-2]  clstr ali  39  1MPIRVQTEDFDLSEEIRQLRAGDLRVGAVASFVGTVRDLNDGVSRMTLEHYPGMTEKALEAIVVQARERWRLFDALVIHRYGDLGPGDQIVLVAVTSAHRGDAFAACEFIMDYLKTEAPFWKKESTPQGERWVDARETDTAARDRW.... 148
40 4.000e-81gi|645567635|gb|KDP84409.1| molybdenum cofactor biosynthesis protein MoaE [Cupriavidus sp. SK-3]  clstr ali  46  1MSVRVQREDFDLGAEVAALRHGQPGVGAVASFIGTVRDMNDGVSAMELEHYPGMTEKALARIEAVARERWELLGVTIVHRVGPLLPLDQIVLVAVASAHRGNAFAACEFIMDYLKSEAPFWKKEQTPEGARWVDARVTDESALARWGIRS 152
41 5.000e-81gi|503556070|ref|WP_013790146.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas fulva]  clstr ali  44  1MGIRVQQAVFDPGLETNAVHAANTGVGAVACFVGYVRDFNDGVAGMFLEHFPGMTEKALAGIESQARERWPLLGVEVIHRVGRLEPGEPIVFVGVASAHRQAAFQACEFIMDYLKTRAPFWKKEDTPSGPRWVEGRDSDQASARRWQADS 152
42 5.000e-81gi|515577318|ref|WP_017010076.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio calviensis]  clstr ali  40  1.MISVQRDDFSVAEEYQWL-NDNASDGAVVTFVGKVRDMNDNVTGLTLEHYPGMTEKSLEEICNDAKTRWPLGKVRVIHRVGALNLGDQIVFVGVSSAHRKAAFDACEFIMDFLKTRAPFWKKEKLVDDERWIEARDSDDEAANRW.... 146
43 7.000e-81gi|499607723|ref|WP_011288457.1| molybdenum cofactor biosynthesis protein MoaE [Dechloromonas aromatica]  clstr ali  43  1MTVRVQGADFDVGAELAALRAGDARVGALASFLGLVRDLNDGVSEMTLEHYPGMTEKALEEIVAEARGRWELYDALVIHRVGPLKPCEQIVLVAVTSAHRGEAFAACEFIMDYLKTRAPFWKREATPDGGRWVDARETDDSAAARWQK.. 150
44 7.000e-81JCVI_PEP_1096690715751 /source_dna_id=JCVI_ORF_1096690715750 /offset=0 /translation_table=11 /length=183 /full_length=183  ali  43  10MSVRVQEADFDLGAEIAALRAGRPNIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALAGIVSAAMQRWELIDALVIHRVGKLKPQDQIVLVAVASKHRGESFAACEFIMDYLKSEAPFWKKEQTPQGARWVDARVTDDKALVRWGIAS 161
45 8.000e-81gi|653585552|ref|WP_027598488.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. MOIL14HWK12:I2]  clstr ali  46  1MAIRVQAAAFDPGQELNALHAANTGIGAVVGFVGYVRDFNDGVGGLFLEHFPGMTEKALARIVEEAKQRWPLLGVDILHRVGRLEPGEPIVFVGTASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGPRWVEGRASDQDAAGRWAKE. 151
46 9.000e-81gi|488498503|ref|WP_002541945.1| Molybdenum cofactor biosynthesis protein MoaE [Grimontia sp. AK16]  clstr ali  40  1.MISVQEQDFSVADEYQRL-NDHAGDGAIVTFIGKVRDMNDNVTGLTLEHYPGMTEKSLAEIVEQAKSRWPLTHVRVIHRVGALDIGDQIVFVGVSSAHRGAAFEACEFVMDYLKTKAPFWKKERLTDQERWIEARDSDEDAAKRW.... 146
47 9.000e-81gi|505234450|ref|WP_015421552.1| molybdopterin biosynthesis protein MoaE [beta proteobacterium CB]  clstr ali  39  6..IRIQEQDFDLTSEVKALRKDDPRVGAVVTFVGTVRDMNDGVKGMTLEHYPGMTEKSLEVIIKQARSRWDLYKTLVIHRVGPLLPEDQIVLVAVTSAHRGEAFAACEFIMDYLKTAAPFWKKEDTPEGSKWVDARVTDDAAMARWN... 152
48 1.000e-80gi|506312188|ref|WP_015831963.1| molybdenum cofactor biosynthesis protein MoaE [Methylotenera mobilis]  clstr ali  40  1MTVRVQTADFDIGAEINQLRQARKNVGAVVSFVGLVRDLNDGVSQLTLEHYPGMTEKSLAAIIEQAKNRWSIMDALIVHRVGTLQPSDQIVLVIVTSAHRGDAFSACEFMMDYLKTEAPFWKKEANSTGEHWIEAKSADDTARDRWNIE. 151
49 1.000e-80gi|491624876|ref|WP_005482416.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio parahaemolyticus]  clstr ali  40  4.RVSVQVEDFSVDQEYQRLSEG-TASGAVVTFIGKVRDMNDNVIGLHLEHYPGMTEKSLSDICDEAEARWPLLGVRVIHRVGDMDSGDQIVFVGVSSAHRGAAFDACEFIMDYLKTKAPFWKKERTTNEDRWIESRDTDHQAARRWEN.. 151
50 1.000e-80gi|654304729|ref|WP_027818359.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia bannensis]  clstr ali  40  1MPVRVQTEDFDLSTEVAQLRAHNPSIGAVACFVGTVRDLNDGVAGMELEHYPGMTEKALEAIVTQAQQRWPGIDVLIVHRVGKLALLDQIVLVATTSKHRGDAFASCEFVMDYLKTEAPFWKKEETEHGARWVDARTSDDAALARWGVKS 152
51 1.000e-80gi|494074662|ref|WP_007016718.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bermanella marisrubri]  clstr ali  34  4..IAVQEADFDIAQEYQAMRQDNPNDGAIVFFTGLVRDFNQGVTGLFLEHYPGMTEKSLENIVEQAKQRWPINRVSLIHRIGQLHISDQIVFVSASSPHREAAFDACRFIMDYLKHEAPFWKKETTQEGDRWVKANQKDKDALKKW.... 149
52 1.000e-80gi|654355686|ref|WP_027848144.1| hypothetical protein [Marinospirillum minutulum]  clstr ali  43  7..VSVQSKVFDLNQETQALIKGRSDLGALVTFTGYVRDFNEDVLALTLEHYPGMTEQALKAILQEAEQRWALKGTRIIHRIGRMEPSDPIVLVATSSAHRQDAFDACNFIMDYLKTRAPFWKKEHTLTGDYWVSARTSDTQAAERWK... 153
53 1.000e-80gi|498314166|ref|WP_010628322.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. KM-1]  clstr ali  48  1.MIRVQEAPFDAGVEQQRLLADRSDIGAVVSFTGLVRDFNEDVTALTLEHYPGMTEAALGEIVNQAEARWSLQGVRVIHRVGRLTPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHSITGDYWVAERESDYRDASRWESE. 150
54 2.000e-80gi|519208746|gb|EPM92880.1| molybdenum cofactor biosynthesis protein E [Pseudomonas syringae pv. actinidiae ICMP 19070]  clstr ali  44  1MTIRVQAAAFDPGTEVNALHAANLGIGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALAKIVEEAEQRWPLLRLDVLHRVGALEPGEPIVFVGVASAHRQAAFEACDFVMDYLKTRAPFWKKENTSQGPQWVEGRDSDQAA........ 144
55 2.000e-80gi|499798751|ref|WP_011479485.1| molybdenum cofactor biosynthesis protein MoaE [Methylobacillus flagellatus]  clstr ali  38  1MTVRVQEQDFDVGEEITRLRLQYPQAGAVVSFTGQVRDLNDGVASLKLEHYPGMTEKSLAAIVEQARKRWPIFDAVVIHRIGTLAPQAQIVLVVVASAHRGDAFAACEFIMDYLKTEAPFWKKEATPEGEKWLDSRESDQAARGRWQ... 149
56 2.000e-80gi|517253955|ref|WP_018442773.1| hypothetical protein [Burkholderia sp. JPY347]  clstr ali  43  1MTVRVQTADFDLTAEVAALRAQNPKVGAVACFIGTVRDLNEGVAAMELEHYPGMTEKALEAIVDEARLRWPGSDVLIVHRVGKLYPLDQIVLAAATASHRHDAFAACEFVMDYLKTQAPFWKKETTEAGERWVDARASDDEALARWGLSA 152
57 2.000e-80gi|571266976|emb|CDG82223.1| moaE family protein [Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628]  clstr ali  43  4..VRIQTDDFDLSSEVARLRAGQPQVGAVVTFVGTVRDMNDGVSEMELEHYPGMTEQAITAIVEQAKQRWPLYGALVIHRVGPLKPLEQIVLVATSAAHRGEAFAACEFIIDYLKTEAPFWKKEQTPQGARWVDARVSDDIALSKW.... 149
58 2.000e-80gi|727070266|gb|KHF26250.1| molybdopterin synthase, subunit MoaE [Solemya velum gill symbiont]  clstr ali  44  4.SVRIQHEDFDIGAEIRHFQQSRTEIGAVATFTGLVRDLNDKVSSMTLEHYPGMTEKSLQEILEQAIERWQLIDAMVIHRVGKLLPGDQIVFVTTASAHRGDAFSACEFIMDYLKTQAPFWKKEETASGSRWVDARETDSDAAERWK... 151
59 2.000e-80gi|655154603|ref|WP_028601281.1| molybdenum cofactor biosynthesis protein MoaE [Ottowia thiooxydans]  clstr ali  43  4VRVSIQTEDFNLSEEVAALRANDARVGAVCAFVGTVRDRNDGVGSLELEHYPGMTEKSIEAMVSEALERFDLFGVRIIHRVGLLAPQDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEETPEGSRWVDARSSDDAALARWGIKA 155
60 2.000e-80gi|647646214|ref|WP_025918140.1| molybdenum cofactor biosynthesis protein MoaE [Herminiimonas sp. CN]  clstr ali  40  1MPVRIQTEDFDLTTEVSQLRVANPKVGAVVAFVGTVRDLNDGIASMELEHYPGMTEKALEEIVQQARSRWVFFDALVIHRVGPLAPLDQIVLVAITSAHRGEAFAACEFIMDYLKTAAPFWKKEQTPNGARWVDARESDDQALAKWGISS 152
61 3.000e-80JGI.Meta JGI_HUM.0277509 7062523745 SRS017227_Baylor_scaffold_27253__gene_31941 moaE protein [Human Supragingival plaque microbiome from visit number 1 of s  ali  42  54..VCVQTGDFDVGAELRRLQRLTLETGGVASFVGYVRDTNQGIGGLTLEHYPGMTERSLERICAQAEARWPLLGVTVIHRVGPLAPGDQIVLVATASRHRDAAFESCRFIMDYLKTEAPFWKKESTPDGERWVDARDSDEAARRRWEQG. 202
62 3.000e-80gi|551344449|ref|WP_022963861.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas pelagia]  clstr ali  41  1MAITVQTASFDPGAMLNRLHAQQLGVGAVVGFTGYVRDFNDGVAGMLLEHYPGMTEKALQIIVDEAQGRWPLLSVEVLHRVGRLEPGEPIVFVGVSSAHRAAAFDACQFIMDYLKTRAPFWKKEDSADGPRWVDARDSDSQALDKW.... 148
63 3.000e-80gi|491911942|ref|WP_005666787.1| molybdopterin synthase catalytic subunit [Massilia timonae]  clstr ali  40  4..VRVQAGDFDLGQEVARLRANDARIGAVVSFVGTVRDLNDGVSEMELEHYPGMTEKSLEAIAARACERWPLYGTLVIHRVGPLAPLDQIVLVACSAAHRGDAFAACEFIMDYLKTEAPFWKKEQTPDGARWVDARVTDDSAKARWEAP. 152
64 3.000e-80gi|493273383|ref|WP_006231194.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium profundum]  clstr ali  38  1.MISVQFDDFSVAEEYALLSEG-TDAGAVVTFIGKVRDFNDDVTGLSLEHYPGMTEKSLEEIVVQARERWPLLKTRVIHRVGDLGLGDQIVFVGVTSAHRGAAFEACEFIMDFLKTRAPFWKKEQTSNETRWVDARDTDTSAADRWQNK. 149
65 4.000e-80gi|495338036|ref|WP_008062772.1| molybdenum cofactor biosynthesis protein MoaE [Methyloversatilis universalis]  clstr ali  44  3VSVSVQQADFDIGAEIDALLAGRTDVGAVATFTGLVRDINDGVHAMTLEHYPGMTEAALEDIVAQAKARWDILAVRVIHRVGTLQPADRIVLVIVAGSHRGEAFSACEFIMDYLKTRAPFWKREDTPDGSRWVDARDSDDSAAQRWMQQG 154
66 4.000e-80gi|502912950|ref|WP_013147926.1| molybdenum cofactor biosynthesis protein MoaE [Methylotenera versatilis]  clstr ali  42  1MTVRVQTQDFDAGFEISLLRNARKDTGAVVSFIGQVRDLNEGVSQLTLEHYPGMTEKALEAIVNQAQSRWDIFDAIVIHRVGILQPTDQIVLVAVSSAHRGEAFKACEFIMDYLKTEAPFWKKEVTSQGERWVDAKLTDDDARERWK... 149
67 4.000e-80gi|490864602|ref|WP_004726636.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio furnissii]  clstr ali  42  4.RVSVQTQDFSVADEYAQLSAG-TQAGAVVTFVGKVRDMNDNVAGLHLEHYPGMTEKALLEICDEAARRWPLQNVRVIHRVGDMDIGDQIVFVGVSSAHRSASFEACEFVMDYLKTKAPFWKKERTTEATRWVDSRESDAKAAERWQQ.. 151
68 5.000e-80gi|550701364|ref|WP_022639464.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. CMAA1215]  clstr ali  45  1MGIQVQQQAFSLDALNTALQAGDPAVGAVVTFVGYVRDLNLGVQSLFLEHYPGMTERSLRGIVAQAEQRWPLLRVELVHRVGLLRVGEPIVFVGVASAHRQAAFEACDFIMDYLKTRAPFWKREVTDSGEHWVEGRASDQQAASRWQQP. 151
69 5.000e-80gi|668956245|gb|KFC74889.1| Molybdopterin synthase catalytic subunit [Massilia sp. LC238]  clstr ali  42  16..IRVQEADFDLSRELAALRAGDGRVGAVVSFVGTVRDLNEGVSEMELEHYPGMTEKALEEIVAQARARWPLFGVQVIHRVGPLKPLDQIVLVACSSAHRGEAFAACEFIMDYLKTDAPFWKKEQTPEGARWVDARASDDSAKRKW.... 161
70 5.000e-80gi|504859354|ref|WP_015046456.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Simiduia agarivorans]  clstr ali  40  5..IAVQTEDFDHTSLYQRLLSDTPEIGAIVTFTGLVRDLNDAVAGLFLEHYPGMTEKSLQAIVDEARQRWPIMRVELIHRVGQLAPADQIVYVGVSASHRGDAFAACEFIMDYLKTRAPFWKREATPEGDRWVDARDSDHQAATRWK... 151
71 5.000e-80gi|518547882|ref|WP_019718089.1| molybdenum cofactor biosynthesis protein MoaE [Ralstonia solanacearum]  clstr ali  43  3.TIRVQEADFDLGAEIAALRAGRPQIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALANIVDAAMQRWDLIDALVIHRVGKLRPEDQIVLVAVASGHRGEAFAACEFIMDYLKSEAPFWKKEQTAQGARWVDARVTDERALARWG... 150
72 6.000e-80gi|654851949|ref|WP_028304338.1| hypothetical protein [Oceanospirillum maris]  clstr ali  43  5IYIKVQEAPFDLAVVNRGMTEGRTDIGAVVTFSGLVRDFNEDVQGLTLEHYPGMTEQALQQIAEEASERWSLQAVSVIHRVGHLTPGDPIVLVAVASAHRQAAFDSCAFIMDFLKTRAPFWKKENTREGDYWVSARTSDEDAAQRWHKG. 155
73 1.000e-79gi|503112490|ref|WP_013347223.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Ferrimonas balearica]  clstr ali  37  1.MIAVQTQDFSVADEYAKL-ADNPGCGAVVTFVGKVRDFGDGVSAMTLEHYPGMTEAVLHQIEAEARQRWPLDEVTIIHRVGELQLCDQIVFIGVSSAHRKAAFAACEFLIDFLKTRAPFWKKETSDDGTVWVDAKDADQQAAEQWQR.. 148
74 1.000e-79gi|500232694|ref|WP_011902287.1| molybdenum cofactor biosynthesis protein MoaE [Polynucleobacter necessarius]  clstr ali  39  6..IRIQEQDFDLSAEIVALRKGDARVGAVVSFLGTVRDLSDGVKGMTLEHYPGMTEKSLQAILDQAATRWNIFQTLVIHRVGLLLPEDQIVLVAVTSAHRGEAFSACEFIMDYLKTAAPFWKKEDTPEGSRWVDARVTDETAMARWNK.. 153
75 1.000e-79gi|515607741|ref|WP_017040341.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio genomosp. F10]  clstr ali  41  4.RISVQQTDFSVADEYEKLSQG-TEPGAVVTFIGKVRDMNDNVTGLSLEHYPGMTEKALSEICDKAEERWPLLALSVIHRVGDLDIGDQIVFVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTQTTRWVESRDSDAQAALRWK... 150
76 1.000e-79gi|516387084|ref|WP_017776760.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia kururiensis]  clstr ali  41  1MTVRVQTEDFDLSAEVAALRAQNPRIGAVACFVGTVRDLNEGVEAMELEHYPGMTEKALADIVDAARDRWRGVDVLIVHRVGKLYPLDQIVLVATTSAHRGDAFASCEFVMDYLKTQAPFWKKEKTAAGECWVDARESDDAALARWGIKS 152
77 1.000e-79gi|496181812|ref|WP_008906319.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. NO-1]  clstr ali  38  5.RVSIQTEDFDLSTEVAALRRENKGIGAVCSFIGTVRDRNEGVSSMELEHYPGMTEKSIEAMVDEAFRRFDIFGARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEETPQGARWVDARVSDDAALARWGITA 155
78 1.000e-79gi|501325853|ref|WP_012357488.1| molybdenum cofactor biosynthesis protein MoaE [Polynucleobacter necessarius]  clstr ali  35  25MSIRIQEGDFDLSFEIASLRKGDPRVGAAVAFLGTVWDMNDGIKGMTLEHYPGMTEKSLQEILDQAKARWDIYHTLVIHRIGSLLPEDQIVLVAVTSAHRGEAFAACEFIMDYLKTAAPFWKKEDTPDGARWVDARVTDEAAMARWKK.. 174
79 1.000e-79gi|517436410|ref|WP_018607297.1| hypothetical protein [Uliginosibacterium gangwonense]  clstr ali  40  1MSVSVQHTDFDLDAETAHLASVSHNVGAVATFLGYVR-GDDALAAMTLEHYPGMTEKSLADIVSQAQARWPLLAVRVIHRIGRLLPGERIVFVGVASRHRGAAFDACEFIMDYLKTRAPFWKKEETEQGARWVDARDSDESALEKWGK.. 147
80 2.000e-79gi|516564861|ref|WP_017940047.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas thermotolerans]  clstr ali  47  1MAIRVQSETFDPGLELNALHAANRGIGAVVGFVGYVRDFNDGVAALFLEHAPGMTEKALARIVAEAEQRWPLLGVEVLHRVGHLQPGEPIVFVGTASAHRQAAFEACNFIMDYLKTRAPFWKKEDTPEGPRWVEGRDSDLAAAERWRR.. 150
81 2.000e-79gi|505248350|ref|WP_015435452.1| molybdenum cofactor biosynthesis protein E [Azoarcus sp. KH32C]  clstr ali  45  1MSVSVQESDFDVGAEIAALSEDRREVGAVASFVGLVRDISEGVAAMTLEHYPGMTEQALEEIVAEARSRWSLHAVRVIHRYGRLEPGDRIVFVGVAGAHRGESFAACEFIMDYLKTRAPFWKKEETPDGARWVDARDSDDSAARRWER.. 150
82 2.000e-79gi|656111203|ref|WP_029134716.1| molybdenum cofactor biosynthesis protein MoaE [Sedimenticola selenatireducens]  clstr ali  40  4..IIIQTEPFDLAAIQEELRRENPAIGALVTFLGQMRDINEGVTTMTLEHYPGMTEKALQAIVDEANERWQLTGIRVVHRVGPLQPLDPIVLVAVASAHRGEAFQACEFVIDYLKTRAPFWKKEQTPEGDRWVDARHTDDQAEQRWRR.. 151
83 2.000e-79gi|640742941|ref|WP_025164997.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas taeanensis]  clstr ali  46  1MAIRVQLDAFDPGVETNALHAANVGVGAVVSFVGYVRDFNDGVGGMFLEHFPGMTEKALTKIAVEAEQRWPLLNIQIIHRIGRLEPGEPIVFVATASAHRQAAFDACAFVMDYLKTRAPFWKKEDTSEGPRWVEGRSSDQSAAERWHK.. 150
84 2.000e-79gi|503207844|ref|WP_013442505.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Methylovorus]  clstr ali  40  1MTIRVQADDFDVGAEINRLRQQRPDIGAVAAFVGQVRDLNQGIAGMTLEHYPGMTEKSLEAIVQQAKARWDIMDAVVIHRIGELKPLDQIVLVAVAGAHRGEAFHACEFIMDYLKTEAPFWKKEQTPEGERWVDARSSDDAARARWQ... 149
85 3.000e-79gi|517757558|ref|WP_018927766.1| MULTISPECIES: hypothetical protein [Pseudomonas]  clstr ali  41  1.MIRVQTERFEPGTEINALQALSLNVGAVVSFVGYVRDTNQEVAGMFLEHYPGMTEKVLGKIADEARQRWPLLGLVLIHRIGALQPGDPIVFVGVSSSHRQAAFDACAFVMDYLKTRAPFWKKEQVAESSHWVEARHSDREAAQRWE... 148
86 3.000e-79gi|654509737|ref|WP_027979045.1| molybdenum cofactor biosynthesis protein MoaE [gamma proteobacterium L18]  clstr ali  45  1MGVRVQVEAFDPGVEVNAMHAAHVGVGAVVSFVGYVRDFNDGVSGMFLEHYPGMTEKALSKIVGEAEQRWPLLKVEVLHRIGALDPGEPIVFVGVASAHRQAAFDACNFIMDYLKTRAPFWKKEQTGAGERWVEGKASDGDAAERWG... 149
87 4.000e-79gi|517332721|ref|WP_018508213.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus thioparus]  clstr ali  47  1MKILVQSEAFELGAEVDALRRGRTDIGAIASFVGLARDMNDGVAAMTLEHYPGMTEKALAALVEEAQSRWTLLDVTLIHRVGRLLPGDPIVLVAVAGSHRGEAFAACEFIMDYLKTRAPFWKKEVTPEGERWVEARASDDVAATRWGK.. 150
88 4.000e-79gi|646773965|gb|KDR43811.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia glathei]  clstr ali  42  6.RVRVQEADFDISTEVAALRAQNPKVGAVACFVGTVRDLNEGVETMELEHYPGMTEKSLEAIAAQARERWPGSDVLIVHRIGKLKPLDQIVLVATTAMHRADAFESCAFVMDYLKTQAPFWKKEKTEAGERWVDARESDDSALARWGVEA 156
89 5.000e-79gi|518389273|ref|WP_019559480.1| molybdenum cofactor biosynthesis protein MoaE [Caldimonas manganoxidans]  clstr ali  43  5.RVRIQTEDFDLGAEVAALRAGDPAVGAVAVFVGTVRDHNDGVRCMELEHYPGMTEKAIEAMIDEAQRRFEIRAARVIHRVGLLQPQDQIVYVGVTSAHRAEAFRACEFLMDYLKTQAPFWKKETTPAGARWVDARLSDDEALRRWGIEA 155
90 7.000e-79gi|501401258|ref|WP_012432824.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia phytofirmans]  clstr ali  41  1MPVRVQTEDFDLTAEVAALRARNPKIGAVACFVGTVRDLNDGVETMELEHYPGMTEKSLEAIIVSARERWPGIEVSIVHRVGKLYPLDQIVMVATTAAHRGEAFVSCEFVMDYLKTQAPFWKKEKTEAGERWVDARVTDDAALARWGIKS 152
91 8.000e-79gi|499826640|ref|WP_011507374.1| molybdenum cofactor biosynthesis protein MoaE [Chromohalobacter salexigens]  clstr ali  48  2IEVRVQSAVFDVGEEQQRLLSGRHDVGAVVTFTGLVRDFNEDVEALSLEHYPGMTEAALHDIARQATARWPLDGIRIVHRIGRLSPGDPIVLVMVASAHRRAAFEACDFLMDYLKTRAPFWKKEHTASGTYWVSARDSDAQDAARWE... 150
92 8.000e-79gi|515593072|ref|WP_017025711.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio rumoiensis]  clstr ali  39  6.MVSVQFDDFDIGLEYQHLSQG-TQAGAVVTFVGKVRDMNDSVTGLSLEHYPGMTERSLIQICEQAKSRWPLLNIRVIHRVGDLDLGDQIVFVGVSSAHRNAAFEACEFVMDYLKTQAPFWKKERTTDDVRWVESRDSDAKAADRWK... 152
93 9.000e-79gi|517819956|ref|WP_018990164.1| molybdenum cofactor biosynthesis protein MoaE [Azoarcus toluclasticus]  clstr ali  48  1MTVSVQAEDFDVGAEIAALSAGRNEVGAVATFLGLVRDVSGGVGAMTLEHYPGMTEASLEEIVVQARARWSLYAVRVIHRFGRLEPGDRIVFVGVAGAHRGETFAACEFIMDYLKTRAPFWKLEETPEGARWVDARDSDDSAAARWEQGG 152
94 1.000e-78gi|556740201|ref|XP_005965647.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Pantholops hodgsonii]  clstr ali  42  23.RVSIQTEDFDVSAELAALRSGDARVGAVCSFIGTVRDRNEGVASMELEHYPGMTEKSIEAIIDEAVQRFGIHGARVIHRIGPLQPMDQIVLVAVTASHRGMAFQACEYIMDYLKSLAPFWKKEQTPEGARWVDARVSDEEALARWRQ.. 171
95 1.000e-78gi|577704125|gb|EUJ10271.1| molybdopterin converting factor, large subunit [Methylophilaceae bacterium 11]  clstr ali  36  15..VKVQIEDFDVGEVLASVRRDHPQIGAIVSFVGLVRDMNDSVTTLTLEHYPEMTEKSLQAIVDQAQQRWDIMDAVVIHRVGTLKPLDQIVLVVISSAHRQAAFSACEFVMDYLKTQAPFWKKETNNESERWVEAKSSDDQAQARWQS.. 162
96 1.000e-78gi|500255449|ref|WP_011912357.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  45  1MAVRVQQGSFDPGAELNALHAANLGIGAVAGFVGYVRDFNDGVAGMFLEHAPGMTEKALEKIVQEAEQRWPLLRLDVLHRVGSLEPGEPIVFVGAASAHRDAAFDACRFVMDYLKTRAPFWKKENTSAGPRWVEGRASDQLAAERWNEES 152
97 1.000e-78gi|666638908|ref|WP_031356458.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia sordidicola]  clstr ali  42  3.RVRVQEADFDLSTEVAALRADNPKVGAVACFVGTVRDLNEGVQAMELEHYPGMTEKALEGIAAQARERWPGSDVLIVHRVGKLLPLDQIVLVVTTAMHRAQAFESCAFVMDYLKTQAPFWKKETTEHGEKWVDARESDDAALSRWDLGS 153
98 1.000e-78gi|656256926|ref|WP_029203241.1| molybdopterin synthase catalytic subunit [Vibrio genomosp. F6]  clstr ali  38  4.RVSVQYDDFSIADEYEILAKG-TSAGAVVTFVGKVRDMNDNVIGLRLEHYPGMTEKSLAEICDQAEARWPLLGVRVIHRVGDLDIGDQIVYVGVSSAHRGASFEACEFIMDYLKTSAPFWKKERTTQESRWVESRDSDAKAAERWEN.. 151
99 1.000e-78gi|493460101|ref|WP_006415335.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia multivorans]  clstr ali  44  4.TVRVQTDDFDLNAEVAALRARNPKIGAVACFVGTVRDLNEGVAALELEHYPGMTEKALEKIAAEAGRRWPGIDVAIVHRVGKLYPLDQIVMVATVAAHRGDAFASCEFVMDYLKTDAPFWKKETTPNGERWVDARSTDDAALARWGIES 154
100 1.000e-78gi|647595513|ref|WP_025872151.1| molybdenum cofactor biosynthesis protein MoaE [Methylobacillus glycogenes]  clstr ali  38  1MTVRVQAEDFDLGAEVRQLRLQSAGAGAVVSFVGQVRDLNENVASLTLEHYPGMTEKALQAIVTQAQARWPILNALVIHRIGTLQPLDQIVLVAVASAHRGDAFAACEFIMDYLKTEAPFWKKESSSKGEQWLEALGTDHQARERW.... 148
101 1.000e-78gi|584383274|gb|EWH00247.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. BC04]  clstr ali  48  7..VQVRHEPFDAGVEQQRLLADRSDIGAVVSFTGLVRDFNEDVTALTLEHYPGMTESALSDIVTEAEMRWPLQGVRLIHRVGRMTPGDPIVLVVVASAHRREAFEACDFIMDYLKTRAPFWKKEHSVSGDYWVAERESDHQDASRWEGD. 155
102 1.000e-78gi|497206393|ref|WP_009520655.1| molybdenum cofactor biosynthesis protein MoaE [Hydrogenophaga sp. PBC]  clstr ali  38  6.RVSIQTADFDLSTEVARLREQDKGVGAVCSFIGTVRDRNDGVSAMELEHYPGMTEKAVEAMIDEAFRRFQILGARVIHRVGPLQPLDQIVLVVVSSAHRGQSFQACEFLMDYLKTQAPFWKKEETPEGARWVDARVSDDAALARWGIQA 156
103 1.000e-78gi|684596091|dbj|GAL37329.1| molybdenum cofactor biosynthesis protein MoaE [Vibrio maritimus]  clstr ali  41  85IQVSVQQQDFSVGAEYEALAEGSAS-GAIVTFTGKVRDMNDNVQGMSLEHYPGMTERALEKICDEAETRWMLNGIRVIHRVGDLDAGDQIVFVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTESTRWVESRESDAQAAERWQK.. 233
104 1.000e-78gi|654642953|ref|WP_028104107.1| molybdenum cofactor biosynthesis protein MoaE [Pseudoduganella violaceinigra]  clstr ali  39  4..VRIQTDDFDLSHEVAQLRAGNAKVGAIVTFVGTVRDLNDGVAEMELEHYPGMTEQAIQAILEQAKVRWPIYGALVIHRVGPLKPMDQIVLVAVTSPHRGEAFSACEFIIDYLKTEAPFWKKEQTPEGARWVDARTSDDEARKKWS... 150
105 1.000e-78gi|492901543|ref|WP_006031949.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Moritella sp. PE36]  clstr ali  40  5.TIQIQTEDFDLATEYAALGKSH-STGAVVTFIGKVRDFNQGVSGLTLEHYPGMTEKSLAKILIEAETRWSIQGVKVIHRIGELALGDQIVFVGVASMHRGDAFQACEFIMDYLKTQAPFWKKEATQAGSHWVDARETDTTAADRWK... 151
106 2.000e-78gi|505449036|ref|WP_015636138.1| molybdopterin synthase catalytic subunit MoaE [Pseudomonas protegens]  clstr ali  44  1MSIQVQTQALSLDQLNAGLQAGDASVGGVVTFVGYVRDLNEAVHSLFLEHYPGMTERSLQRIVEQAQARWPLNRVSLVHRVGLLQVGEPIVFVGVASAHRQAAFEACAFIMDYLKTRAPFWKREVTPAGERWIDGRESDRQAAERWGVE. 151
107 2.000e-78gi|497352952|ref|WP_009667165.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium IMCC9480]  clstr ali  40  1MTIRIQQADFDMSTELANLRAGSPQVGAIVSFVGTVRDLNDGVSQMELEHYPGMTEKSIAVIVERARAHWPIADALVIHRIGPLLPTEQIVLVAVAAAHRGEAFAACEFIMDYLKTEAPFWKKEQTPEGARWVDARAVDDAALAKW.... 148
108 2.000e-78gi|501059842|ref|WP_012111193.1| molybdenum cofactor biosynthesis protein MoaE [Parvibaculum lavamentivorans]  clstr ali  43  1.MIRIQTEDFDIGAEIAALTEGRTDIGAVVTFSGLVR-ETGGIASMELEHYPGMTEKKLARIESEATARWPLQATLIIHRVGKLLPGDNIVLVVAASAHRQAAFDAASFLMDYLKTRAPFWKREQTGDKSHWVDARESDGTAAAKWDT.. 146
109 2.000e-78gi|499630805|ref|WP_011311539.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  48  1MKIAVQNEAFDLGSEVAALTHGRRDVGAVASFVGLARDINEGVAAMTLEHYPGMTEKALAALVDEACARWALLDVSVVHRVGRLLPGDPIVLVAVASAHRGEAFAACEFIMDALKTRAPFWKKEETPDGERWVEARASDEAAAGRWEK.. 150
110 2.000e-78gi|502599921|ref|WP_012837296.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas testosteroni]  clstr ali  40  15.RVSIQTQDFDLSAEIAALRAGDARVGAVCSFVGTVRDRNEGVSSMELEHYPGMTEKSIEAIIDKAVARFGIYGARVIHRIGLLQPMDQIVLVAVSSAHRGKSFEACEYIMDYLKSEAPFWKKEQTEQGARWVDARVSDEQALARWATP. 164
111 2.000e-78gi|501315412|ref|WP_012347047.1| molybdenum cofactor biosynthesis protein MoaE [Leptothrix cholodnii]  clstr ali  43  5.RVTIQQADFDLSAEVAALRAGDGGVGAVASFIGTVRDRSDGVSAMELEHYPGMTERSIEAMIDTALQRFDIRAARVIHRVGLLQPQDQIVLVAVSSAHRGQAFQACEFLMDYLKTEAPFWKKETTPEGARWVDARVSDDDALRRWG... 152
112 3.000e-78gi|499558804|ref|WP_011239587.1| molybdenum cofactor biosynthesis protein MoaE [Aromatoleum aromaticum]  clstr ali  45  1MSVSVQQADFDVGAEIAALSQGRHEVGAVASFVGLVRDVSGGVAAMTLEHYPGMTERSLEDIVGEARRRWQLDGVRVIHRYGRLEPGDRIVFVGVAGAHRGEAFAACEFVMDYLKTRAPFWKLEETPDGAHWVDARDSDDSAAARWDT.. 150
113 3.000e-78gi|658513324|ref|WP_029708831.1| molybdenum cofactor biosynthesis protein MoaE [Rhodoferax saidenbachensis]  clstr ali  40  10.RVTIQTADFDLSAEVAALRAGHKGVGAVCSFVGTVRDRTKGISAMELEHYPGMTEKAIEAMIDEAYKRFDILGARVIHRVGLLQPLDQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEQTPQGAQWVDARVSDDAALAKWGISA 162
114 3.000e-78gi|654770236|ref|WP_028224749.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia ferrariae]  clstr ali  42  1MLVRVQTEDFDLTTEVAQLRARNPAIGAVACFVGTVRDLNDGVATMELEHYPGMTEKALEGIAVEAQRRWPGIEVLIVHRVGKLAPLDQIVLVATTAMHRGDAFASCEFVMDYLKSEAPFWKKEETEHGARWVDARATDDAALARWGIAS 152
115 3.000e-78gi|518358900|ref|WP_019529107.1| hypothetical protein [Dasania marina]  clstr ali  39  5..VRVQTADFDVSTELNLLRQQSLQTGAVVNFVGTVRDIHNGIANMELEHYPGMTEKSIQDITLQAAQRWQLLAATVIHRVGLLQPGEQIVLVAVSSQHRGEAFQACEFIMDYLKTQAPFWKKEQTEQGAQWLDARESDGEAAKRWQ... 151
116 4.000e-78gi|518171972|ref|WP_019342180.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  44  1MGVRVQQGPFDPGAELNALHAANLGIGAVTGFVGYVRDFNDGVAGMFLEHAPGMTEKALQKIIDEAADRWPLLTLEILHRVGRLEPGEPIVFVGAASAHREAAFDGCRFVMDYLKTRAPFWKKEDTSEGTRWVEGRCSDQAAADRWRQG. 151
117 4.000e-78gi|489380450|ref|WP_003287142.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  43  1MSVRVQQAAFDPGAELNALHAANLGIGAVAAFVGYVRDFNDGIAGMFLEHAPGMTEKALGKIIAEAETRWPLLGIDVLHRVGALEPGEPIVFVGVTSAHREAAFEACRFVMDYLKTRAPFWKKESTPAGERWVDGRDSDQAAAERWQR.. 150
118 4.000e-78gi|500842046|ref|WP_012005758.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia proteamaculans]  clstr ali  42  6.RIRVGEAPFNVGEEYQWL-AQCDDDGAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALAEIVDEARSRWPLQRATVIHRVGELFPGDEIVFVGVTSAHRSMAFEASEFIMDYLKTRAPFWKREAVGQGDRWVDARDSDRQAAERWHK.. 153
119 4.000e-78METAHIT O2 GL0072640 [Complete] locus=scaffold47540_3:1953:2417:+  ali  41  8..ILVTTEPFDIGEETARIREGSPDMGAIVTFTGVVRNVNDGVTAMTLEHYPGMTQKSLAKIVETARGRWPLGDVTVIHRVGRMVVGEEIVLVAVASRHRHAAFEAASFIMDWLKTEAPFWKKEETPEGARWVDARESDDLAKARWG... 154
120 5.000e-78gi|723241741|gb|AIX74377.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. PSNIH2]  clstr ali  45  4.RIRVGQPPFSVAEEYQWLSASN-DDGAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALAEIVEEARARWPLHLVSVIHRVGELFPGDEIVFVGVSAAHRGAAFEAAGFIMDYLKTRAPFWKREATPQGDRWVEARDSDRQAAGRWD... 150
121 5.000e-78gi|516713441|ref|WP_018059390.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium JGI 0001004-K23]  clstr ali  41  4..VRVQTADFDVSAELAALRAGDARVGALVTFVGTVRDMNEGVAEMELEHYPGMTERAIETIVEQARARWPLFAALVIHRVGPLKPMEQIVLVACTAAHRGEAFAACEFIIDYLKTEAPFWKKEQTPDGARWVDARVSDDQALRKWS... 150
122 5.000e-78gi|544667940|ref|WP_021101295.1| Molybdenum cofactor biosynthesis protein MoaE [Thalassobacter arenae]  clstr ali  42  1MRVLVQEALFDAGAELNAFAKGDTDIGAVVSFTGVTRDVSGGLSRMLIEHYPGMTERALTQICEEAQTRWSLADVLVIHRFGTMEPGDNIMMVATASRHRADAFAAAEFLMDYLKSRAPFWKKEITADGSEWVAAKDSDEDALDRWS... 147
123 6.000e-78gi|655964080|ref|WP_029006733.1| molybdenum cofactor biosynthesis protein MoaE [Azospirillum halopraeferens]  clstr ali  44  1MTIRVQCEDFDVGAELEALTRGRTSIGGVTSFVGYVRDMAGGVSAMTLEHYPGMTERQLEAIAGEARRRWPLDAVLVIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTRAPFWKLEATPEGERWVEAKASDDAAAQRWRE.. 150
124 6.000e-78gi|495318206|ref|WP_008042953.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Reinekea blandensis]  clstr ali  38  4..IRVQQDDFSVQREYDGLCRENTDDGAVVFFVGRVRDLNEGVTGMFLEHYPGMTEKTLQSIADEARHRWPLNRIRIVHRVGALNPSDQIVFVGVSSPHRGAAFDGAQYIMDFLKTRAPFWKKESTPEGDRWVDARSSDTEQENRW.... 149
125 6.000e-78T2D.3598871 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  41  8..ILVTTEPFDIGEETARIREGSPDMGAIVTFTGVVRNVNDGVTAMTLEHYPGMTQKSLAKIVETARGRWPLGDVTVIHRVGRMVVGEEIVLVAVASRHRHAAFEAASFIMDWLKTEAPFWKKEETPEGARWVDARESDEEAKARWS... 154
126 6.000e-78gi|648566472|ref|WP_026258223.1| molybdenum cofactor biosynthesis protein MoaE [Endozoicomonas elysicola]  clstr ali  43  1MRISIQVEDFNLGHEYERLE-GNKSSGAIVTFTGTVRDMNDEVGGLFLEHYPGMTEKALQEIIDEAMERWELQVVRVIHRIGQMHPGDRIVFVGVVSAHRKEAFAACEFIMDYLKTRAPFWKKETTPEGDRWVDERESDQEAADRW.... 149
127 7.000e-78gi|518762895|ref|WP_019920184.1| hypothetical protein [Duganella zoogloeoides]  clstr ali  39  10..VRIQTEDFDLTTEVARLRAANPKIGAVVTFVGAVRDLNDGVAEMELEHYPGMTEQSIAAIIEQARLRWPTFGALVIHRVGPLKPLDQIVLVAATAAHRGEAFAACEFIIDYLKTDAPFWKKEVTPDGARWVDARVSDDAALAKWRGAA 159
128 7.000e-78gi|652565514|ref|WP_026959003.1| hypothetical protein [Aliagarivorans taiwanensis]  clstr ali  40  1.MISVQKEDFDVAALYQALQQ-NPSSGAVVTFTGLVRDLNLGVNALFIEHYPGMTERALSDIVEQAKQRWPINDVAVVHRVGRLEVNQQIVFVGVNSAHRQAAFDACEFIMDYLKTSAPFWKKELSDQGEQWLEQRESDRVASKRWS... 147
129 7.000e-78gi|503623182|ref|WP_013857258.1| MULTISPECIES: molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio]  clstr ali  40  5.RISVQISDFSVDAEYRDLSQG-TSAGAVVTFIGKVRDMNDNVIGLTLEHYPGMTEKALSDICDQAQARWPVQKIRVIHRIGDLDIGDQIVFVGVSSSHRGAAFEACEFVMDYLKAKAPFWKKERTTEQTRWVESRDSDAQAAQRW.... 150
130 9.000e-78gi|723256625|gb|AIX50646.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. PSNIH1]  clstr ali  42  4.RIRVGPEPFDTGAEYRLLAADDRD-GAIVTFTGKVRNHNLGVAALTLEHYPGMTEKALAEIAEAARQRWPLQQITVIHRVGELFPGDEIVLVGVSSAHRGSAFAAAEFIMDYLKTRAPFWKREATPEGDRWVDARDSDHQAAARWE... 150
131 1.000e-77gi|517848139|ref|WP_019018347.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas lutea]  clstr ali  46  1.MISVQTAPFDVGTEQQVLTRKRTDIGAVVSFTGLVRDFNEDVQALTLEHYPGMTEQALQDIVAEAEARWALQGIRLIHRVGRLEPGDPIVMVAVASAHRRHAFEACDFIMDYLKTRAPFWKKEHTVSGHYWVAERNTDIEDAKRWE... 148
132 1.000e-77gi|651335424|ref|WP_026458667.1| molybdenum cofactor biosynthesis protein MoaE [Aeromonas enteropelogenes]  clstr ali  39  9.RILVQQADFSLADEYARL-ATRADTGAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALIEIVAEARRRWPLQECTLIHRIGELMLGDQIVLVAVSSAHREAAFDACHFIMDFLKTRAPFWKKELTADGKRWVDAKESDNAAAARWQQPG 159
133 1.000e-77gi|492768500|ref|WP_005958651.1| molybdenum cofactor biosynthesis protein MoaE [endosymbiont of Riftia pachyptila]  clstr ali  41  6..IRVQSEPFDPNVEVDLLRNHSPSIGGVVSFIGQVRDFNDDVLAMTLEHYPGMTEKALAAIVDEANARWELMGVRVVHRVGRMLPKDPIVLVAVASSHRGEAFQACEFIIDYLKTRAPFWKREESVEGARWVDARESDDHAEARWK... 152
134 1.000e-77gi|498913082|ref|WP_010848258.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus nematophila]  clstr ali  40  5.RIRVQRERFHVGDEYQWLSQCD-EDGAVVTFTGKVRNHNDNVNALTLEHYPGMTEKMLQKIADEARQRWPVQRITIIHRIGELYPGDEIVFVGVTSSHRNMAFTAAEFMMDYLKTKAPFWKKESLAEGERWVEIKQHDQEAANRWQS.. 152
135 1.000e-77gi|655418324|ref|WP_028816890.1| hypothetical protein [beta proteobacterium SCGC AAA027-K21]  clstr ali  46  10.SVAVQSADFDLGHEYSALLAHDRGIGAIVAFVGTVRDLNDDVVALELEHYPGMTEKSLRKILDAAVERWSLQGARIVHRIGKMCPGDQIVLVLTASAHRGDAYEANNFIMDYLKTEAPFWKKEWTPEGPRWIEARDSDDKAAARWK... 157
136 1.000e-77gi|653279354|ref|WP_027475777.1| molybdenum cofactor biosynthesis protein MoaE [Curvibacter gracilis]  clstr ali  40  6.RVAIQTADFDVSAELAALRAHDRRVGAVCSFVGTVRGGNEGVLSMELEHYPGMTERAIEAMIDQAHQRFDLYGARVVHRVGLLQPGEQIVLVAVTSAHRGQSFLGCEFLMDYLKTQAPFWKKEQTPQGAHWVDARVSDDAALARWGIEA 159
137 1.000e-77gi|504058685|ref|WP_014292679.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Oceanimonas sp. GK1]  clstr ali  39  1.MIRVQTEDFCLATEYAALSQSH-QTGAVVTFVGKVREMNQGVSGMTLEHYPGMTEHALAQIVSEAQGRWPLLECRVIHRVGALELGDQIVFVGVASAHREAAFAACHFIMDYLKTRAPFWKKERTADGERWVDAKDSDTDAARKW.... 146
138 2.000e-77gi|544832997|ref|WP_021248775.1| hypothetical protein [Thauera terpenica]  clstr ali  44  10.RVSVQEADFDVGAEVGSLHGGSGQVGAVASFVGLVRDEGDGVTAMTLEHYPGMTEKALEEIVAQARERWALLGVSVIHRFGRFVPTDRIVFVGVASAHRGEAFAACEFIMDYLKTRAPFWKREETPAGARWVDARDSDDSAAARWQTAG 160
139 2.000e-77gi|492246237|ref|WP_005788105.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas synxantha]  clstr ali  47  1MPIQVQTELLDLGELTRSVHAEDPGVGAVATFVGYVRDINQGVSALFLEHYPGMTERALQLIVDQAHERWPLQRVSIVHRVGPLKVGEPIVFVGVASQHRLDAFEACAFLMDYLKTRAPFWKREQTPAGERWVEGRESDRLAQERW.... 148
140 2.000e-77gi|490193711|ref|WP_004092283.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Hafnia alvei]  clstr ali  42  7.RIRVGQENFSVGDEYQWLSQC-EDDGAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALGEIVAEARERWPLQRISLIHRVGAMYPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATEQGDRWVDARDSDHQAAKRW.... 152
141 2.000e-77gi|504006495|ref|WP_014240489.1| molybdenum cofactor biosynthesis protein MoaE [Azospirillum brasilense]  clstr ali  44  1MTVKVQSEDFDVGAELAAMTGGKTGIGGVTLFVGLVRDMAGGVSAMTLEHYPGMTERQLEAIEAEARARWPLDDALIIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTKAPFWKMEATPEGERWVEAKESDDTAAARWTKPA 152
142 2.000e-77gi|515590231|ref|WP_017022891.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Aliivibrio logei]  clstr ali  39  1.MISVQEHDFNVGDEYT-LLAEGTASGAVVTFIGKVRDMNDDVTGLSLEHYPGMTEKSLNDIVAQSKERWPLLKVKVIHRVGDLELGDQIVFVGVSSAHRGAAFESCEFIMDYLKTNAPFWKKERTTKEVRWVESRDTDKSAAQRWEK.. 148
143 2.000e-77gi|503667651|ref|WP_013901727.1| molybdenum cofactor biosynthesis protein MoaE [Ramlibacter tataouinensis]  clstr ali  40  6.RVVIQEQDFDLSAEVAALRGRDTGVGAVCCFVGTVRDRNDGVSTLELEHYPGMTEKAIEAMIDEAMRRFDIRAARVVHRIGPLQPQEQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEQTPTGARWVDARVSDDAALARWGIAS 156
144 2.000e-77gi|503463614|ref|WP_013698275.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Burkholderia]  clstr ali  43  5.RARVQTGDFEVGAELAALRARNPKIGAVACFVGTVRDLNEGVAALELEHYPGMTEKALEAIADEAIARWPGIEVAIIHRVGRLLPLDQIVFVATVAAHRGDAFASCEFVMDYLKTEAPFWKKESTPSGERWVDARSSDDAALARWGLRS 155
145 2.000e-77gi|662308950|gb|KEQ14266.1| molybdenum cofactor biosynthesis protein MoaE [Endozoicomonas montiporae]  clstr ali  45  8...SVQTDDFDPALEQARLS-DNAAVGGVVTFTGLVRDNNDHVSGLYLEHYPGMTESALQTIIDEASERWSLYAVSVIHRVGQLHPTDRIVFVGTASAHRQDAFAACDFIMDYLKTRAPFWKKETTPEGDRWIEERQSDKDAAQRWQ... 152
146 2.000e-77gi|589827366|gb|EXJ09872.1| Molybdopterin synthase catalytic subunit [Nitrincola sp. AK23]  clstr ali  41  2IRIRVQPEVFNAGQEIDAITHARSDIGAVVNFIGYVRDFNEDVVALTLEHYPGMTEQSLQEIAKSAQERWPLEAITIIHRIGRLTPGDPIVLVAVASAHRQAAFDACNFVMDYLKTQAPFWKKEHSRSGDYWVAARHSDSDAVRRWEN.. 151
147 2.000e-77gi|570729127|gb|AHF00347.1| molybdenum cofactor biosynthesis protein MoaE [Thioalkalimicrobium aerophilum AL3]  clstr ali  41  6..VRVQEADFDLSTEVNWLREQHADVGAVVSFIGTVRDINQGVNQLELEHYPGMTEKALEAIRQQAHQRWQLESSLIIHRIGKMQPKDQIVLVAVASRHRENAFHAAHFIMDYLKTNAPFWKKEWTPEGERWVDARLSDEQAMQRW.... 151
148 2.000e-77gi|574956830|dbj|BAO45673.1| molybdenum cofactor biosynthesis protein E [gamma proteobacterium Hiromi1]  clstr ali  41  5..IAIQTEIFDPAHEEQQLRQGNPRVGAVVSFLGLMRDINDGVYAMTLEHYPGMTEKALDAIVDEAGQRWDLEGIRVIHRVGELLPEEPIVLVMTASRHRGEAFRACEFIIDYLKTRAPFWKKENTGDGERWVEARHSDKDAESRWDS.. 152
149 2.000e-77gi|499783477|ref|WP_011464211.1| molybdenum cofactor biosynthesis protein MoaE [Rhodoferax ferrireducens]  clstr ali  40  9.RVSIQTADFDLSTEVALLRAQDPRVGAVCSFIGTVRDRTAGISSMELEHYPGMTEKSIEAMMDAALKRFDIYGARVIHRVGLLQPLDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGIAA 161
150 2.000e-77gi|667762739|ref|WP_031383803.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas zincidurans]  clstr ali  44  1.MIRVQHECFDVGAEQATLVAQRNDIGAVVCFTGLVRDFNEDVTALSLEHYPGMTESALGEIVAEAGRRWSLNGVRLIHRVGRLEPGDPIVLVAVASAHRQAAFDACLFIMDYLKTRAPFWKKEHTAHGDYWVAERDTDRQAAERW.... 147
151 2.000e-77gi|522194885|ref|WP_020702352.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium AB_14]  clstr ali  36  9..VRIQTEDFDLSTELARLRAANPKVGAIVNFVGTVRDLNEGVAEMELEHYAGMTEQSILAIIEQARQRWPVFGALVIHRVGPLKPLEQIVLVAVTSAHRGEAFAACEYIIDFLKTEAPFWKKEQTPAGARWVDARVSDDVALKKWSIE. 157
152 3.000e-77JCVI_PEP_1096690520567 /source_dna_id=JCVI_ORF_1096690520566 /offset=0 /translation_table=11 /length=169 /full_length=169  ali  41  6.SVQIQYEDFDLCREVAQLRQPDPGVGAVVSFLGTVRDRDEGIQGLELEHYPGMTESAIQAMIDQARSRFDIRAVRIIHRIGVLNPQDQIVLVAVASAHRGQAFDACEFLMDYLKTQAPFWKKQSSPEGAAWVDARQSDDTAAHRWGLPG 157
153 3.000e-77gi|655955223|ref|WP_028998106.1| molybdenum cofactor biosynthesis protein MoaE [Azohydromonas australica]  clstr ali  42  7.RVLIQTDDFDLGTEVQRLRAGDPGVGAVVSFVGTVREHSEGVSLMELEHYPGMTESAIEAMVDEAFERFDIRAARVIHRVGALKPLDQIVFVAVTSAHRGQAFQACEFLMDYLKTQAPFWKKEHTPQGARWVDARVADDQALARWGIAA 157
154 3.000e-77gi|654786581|ref|WP_028240598.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas azotifigens]  clstr ali  43  1MGIRVQPQAFDAGVELGALHAANLGVGAVAVFVGYVRDFNDGVAGMFLEHAPGMTEKALERIVAEAQARWPLLGVEVIHRVGELEPGAPIVFVGVTSAHRDAAFDACRFVMDYLKTRAPFWKKEDTPDGPRWVEGRTSDQQAVERWQR.. 150
155 3.000e-77gi|543577454|ref|WP_021025925.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas sp. B-9]  clstr ali  40  6..IAVQTADFDVSEELRLLRAADGRIGAVCSFVGTVRDRNAGVATMELEHYPGMTEKSIAQMVEAASQRFDIFGARIIHRVGLLAPGEQIVLVAVSSAHRGESFQACEFLMDYLKTEAPFWKKEDTPEGARWVDARVSDEAAMARWGLP. 154
156 3.000e-77gi|545471522|ref|WP_021707894.1| molybdopterin synthase catalytic subunit [Vibrio azureus]  clstr ali  41  4.RVSVQLEDFSLELEHQRLSAAHA-AGAVVTFTGKVRDTNLGVTGLHLEHYPGMTEKSLIDICNQAESRWPLLGVRIVHRIGDLDIGEQIVFVGVSSAHRAAAFEACEFIMDYLKTKAPFWKKERTRTESRWIESRQSDQQAALRWK... 150
157 3.000e-77gi|654646876|ref|WP_028107930.1| molybdopterin synthase catalytic subunit [Ferrimonas futtsuensis]  clstr ali  39  3...RVQTEDFNVGEEYAKL-ADNPACGAVVTFVGKVRDFGDGVTRMVLEHYPGMTQAVLTQIEQEARERWPLDQVTIIHRVGPLDLSDQIVFIGVSSAHRKAAFAACEYLIDFLKTRAPFWKKEVTEDQAQWVDAKDSDQQAAEMWREE. 149
158 3.000e-77gi|503305880|ref|WP_013540541.1| molybdenum cofactor biosynthesis protein MoaE [Variovorax paradoxus]  clstr ali  40  5.RVSIQTGDFDLSQELGALRAGDKRVGAVCSFIGTVRDRNDGVASMELEHYPGMTEKAIEAMIDEAHKRFDILGARVIHRVGLLQPLDQIMMVAVISAHRGQSFEACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGISA 155
159 3.000e-77gi|639200847|ref|WP_024539282.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas badia]  clstr ali  39  5..VSIQTEDFDVSREIARLRAEDARVGAVCCFVGTVRDGSGQVSSMELEHYPGMTEKSIAAMIDEARRRFDFYGVRVIHRVGLLQPEDQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEATPEGTQWVDARESDDAALRRWGIQA 154
160 4.000e-77gi|683413544|gb|KFZ37606.1| molybdopterin synthase catalytic subunit [Shewanella sp. YQH10]  clstr ali  36  6..ILVQTEDFDVAAEYARIAEDNGD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTENVLQQITAEARERWPLNLVTIIHRVGTMHLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEASPDGRHWVDARDSDEQAAKAWDNG. 153
161 4.000e-77gi|666390218|gb|KEY57427.1| molybdopterin synthase catalytic subunit [Serratia sp. DD3]  clstr ali  43  5.RIRVGAAPFSVGEEYPWLAECN-DDGAVVTFTGKVRNHNDQVSALSLEHYPGMTEKALGEIVAQARSRWSLQRVTVIHRVGDLFPGDEIVFVGVSGAHRSEAFDAAEFIMDYLKTRAPFWKREATGQGERWVEARDSDQQAAKRW.... 150
162 4.000e-77gi|516488026|ref|WP_017876470.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium sp. CG3]  clstr ali  40  3.RVRVQTGDFDLSAEVARLRAANPKVGAVVSFVGTVRDLNEGVAEMELEHYPGMTEQSIEAIIEQAMRRWPLFDALVIHRVGPLKPMEQIVLVLTTAAHRGVAFAACEYIIDYLKTEAPFWKKEQTPDGARWVDARVSDEAALSKWAR.. 151
163 4.000e-77gi|635198149|gb|KDE39093.1| Molybdenum cofactor biosynthesis protein MoaE [Nitrincola lacisaponensis]  clstr ali  44  4..IRVQAQRFDCGVELEALSQQRTDVGAVASFIGYVRDFNEDVVALTLEHYPGMTEQQLRLIAEQAARRWPVLAATIIHRVGRMEPGDPIVLVAVASAHRQAAFDACNFIMDYLKTEAPFWKKEHTRTGDYWVSSRESDTLAAQRWEK.. 151
164 4.000e-77gi|490543038|ref|WP_004408162.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio nigripulchritudo]  clstr ali  36  4..VSVQKEDFSLADEYD-VLAQGTSSGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLESLCEQAKQRWSIENIRVIHRVGDLDIGDQIVFVGVSSAHRGDAFNACEFVMDYLKTQAPFWKKERTTDSVRWVESRESDAAAASRWAEQG 152
165 4.000e-77gi|499705415|ref|WP_011386149.1| molybdenum cofactor biosynthesis protein MoaE [Magnetospirillum magneticum]  clstr ali  44  1MAVRVQREDFDPGAELERFSSGKTSVGGICLFVGLVRDYAGAVNAMTLEHYPGMTERQLEAIEAEARQRWPLDDTLVIHRFGRLEPGERIVLVAASSAHRDAAFEACRFLMDWLKTKAPFWKVEHTPEGDAWVEAKQSDDAAASRWDKG. 156
166 5.000e-77gi|640516401|ref|WP_024950939.1| hypothetical protein [Cobetia crustatorum]  clstr ali  41  13.SVSIQVDDFDIRAEQRYLTNTRGQVGAIVAFTGLVRDFNQDVVALTLEHYPGMTERSLEQLLDEARERFSLNGARIIHRVGRLEPGDNIVLVLVASAHRQAAFAACDFLMDNLKSRAPFWKKEHTASGDYWVRERTSDRDALMRWQLP. 162
167 5.000e-77gi|691633185|gb|KGF78467.1| molybdenum cofactor biosynthesis protein MoaE [Massilia sp. JS1662]  clstr ali  41  4..VRVETADFDVSAEIARLRAGDARVGAVVSFVGTVRDMNDGVAELELEHYPGMTEKALHDIVDQARARWPLYGVLVIHRIGPMRPLDQIVLVACTAAHRGEAFAACEFIMDYLKTDAPFWKKEQTPNGARWVDARVTDDTARAKW.... 149
168 5.000e-77gi|497323402|ref|WP_009637615.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia sp. M24T3]  clstr ali  42  5.RIVVDAAPFSVGEEYQWL-AQSDSDGAVVTFTGKVRNHNDSVSALTLEHYPGMTEKALAEIVEEARQRWPLQRVSVYHRVGALFPGDEIVFVGVTSAHRGMAFDATEFIMDYLKTRAPFWKREATEQGDRWVESRESDKTAASRWSSSS 154
169 5.000e-77gi|648287459|ref|WP_026068608.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas smyrnensis]  clstr ali  46  3.RVRVQQQAFDAGEEQRRLIEARTDIGAVVGFTGLVRDFNEEVQALSLEHYPGMTEAALEAIVDEAESRWPLQGVRVIHRIGRLAPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHTASGDYWVAERQTDHRDAERWEVSS 153
170 6.000e-77gi|668681361|gb|KFB74337.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-91]  clstr ali  45  1.MVRVQAADFDPGAELAAMRLGKPQIGALASFVGLVRELNDGVSELTLEHYPGMTEKALEEIIAEARRRWTLIDVLLIHRVGRLLPTDQIVLVAVASAHRGEAFAACEFIMDYLKTRAPFWKREVTAAGARWVEARLADEQAAERW.... 147
171 6.000e-77gi|505131366|ref|WP_015318468.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium australicum]  clstr ali  52  8.TVRIQRQDFDVAAEIAALTQGRVDIGAVVTFSGLCRDEQGALSALELEHYPGMAEAEIGRIATEASERWPLQGLSVIHRHGKIAPGENIVLVVAASAHRQAAFEAADFLMDYLKSRAPFWKKEHRTDGSEWVEAKETDAQAAQRWKRP. 157
172 6.000e-77gi|569547279|gb|AHE48900.1| moaE product [Aeromonas hydrophila 4AK4]  clstr ali  42  12.RILVQRADFSLGEEYERL-ATRHDTGAIVTFVGKVRDFNQGVKGLSLEHYPGMTEKALADIVAQARARWPLQECTLIHRIGDLLLGDQIVLVAVSSAHRDAAFEACHFIMDFLKTRAPFWKKELTAEGQRWVEAKQSDDAAAARWRQ.. 160
173 7.000e-77T2D.3471269 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  41  5.RVLIQTQDFDVSAELAALRAGDARVGAVCCFVGTVRDRNEGVSAMELEHYPGMTEKSIEAIIERATERFGIHAAKVIHRIGPLQPMDQIVFVGVTSAHRGMSFQACEFIMDYLKSEAPFWKKEQTPEGARWVDARVSDEEALARWQ... 152
174 7.000e-77gi|505301507|ref|WP_015488609.1| molybdenum cofactor biosynthesis protein E [Thalassolituus oleivorans]  clstr ali  36  3.SITVQTNDFNIADEYQALCGQNTEAGAIVFFSGLVRDRNEGVTGLFLEHYPGMTERSLEDIVKQARLRWPILQVRLIHRIGQLDINDQIVFVGVSSAHREAAFDACRFIMDFLKTEAPFWKKETRTDGHHWIESQTKDQEAKTRWNK.. 151
175 7.000e-77gi|503200500|ref|WP_013435161.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia rhizoxinica]  clstr ali  43  1MTVSVQARDFDVTTELARLRARNPRIGAVVSFVGTVRELSDGISALELEHYPGMTERALEAIVAEAERRWAGIDVCVVHRYGRLDAGEQIVLVAVAAAHRGDAFAACEFVMDYLKSNAPFWKKERTEQGERWVDARATDDAALARWGIAS 152
176 7.000e-77gi|521067945|ref|WP_020399896.1| hypothetical protein [Kordiimonas gwangyangensis]  clstr ali  40  3.SISVQADDFDITGEINALKADRVDIGAIVTFTGTVRDLDGSLTSMTLEHYPGMTERELQAVADEAEARWPLQACRVIHRYGTLSPGENIVLVITMSAHRHAAFQAADFLMDFLKSRAPFWKKEETGEGATWVDARESDELALKRWNS.. 149
177 8.000e-77gi|674642264|emb|CEA04345.1| molybdopterin biosynthesis MoaE protein [Pseudomonas sp. 12M76_air]  clstr ali  42  2ISIQVQTAPFDPGQVTNSVHAGDPAIGALVCFTGYVRDFNQTVTGLFLEHFPGMTEKSLRRIAEEATERWALQRVHVLHRVGQLGLAEPIVFVAAASRHREDAFQACAFIMDYLKTRAPFWKKEQTSTGNHWVEGKDSDLDAAHRWSQD. 152
178 9.000e-77gi|500130315|ref|WP_011806320.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. JS42]  clstr ali  40  3.RVSIQTHDFDVSTELAALRARDARVGAVCCFVGTVRDRNEGVASMELEHYPGMTEKSIEAMVDAAFARFNLYGVRVIHRVGLLAPLDQIVMVAVTSAHRGESFQACEFVMDYLKTQAPFWKKEQTPDGARWVDARVSDDAALARWGIAA 153
179 9.000e-77gi|519023381|ref|WP_020179256.1| hypothetical protein [Methylopila sp. M107]  clstr ali  44  1MAIRIQTEPFDLGSEVAALTQGLTDQGAVVTFSGLCRDRGDGLVALTLEHYPGMTEDELARIEAEARSRWPLADALVVHRVGRILPGEPIVLVVTVSAHRKAAFEAAEFLMDYLKTSAPFWKSEETAEGASWVAAKQSDDDSAERWRRDG 153
180 1.000e-76gi|502353039|ref|WP_012770224.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Dickeya zeae]  clstr ali  41  4.RIRVGQEPFSVGDEYAWL-ATSDMDGAVVTFTGKVRNHNDHVSALTLEHYPGMTEKALAEIVDDARQRWPIQRVSLIHRVGALFPGDEIVFVGVSGAHRQASFDAAQFIMDYLKTRAPFWKREATSDGDRWVDARDSDRQAAERWS... 150
181 1.000e-76gi|495194158|ref|WP_007918948.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Pseudomonas]  clstr ali  43  1MAIRVQHKSFDVGQLTADLHARNPRVGAVVNFVGYVRDLNMGVNELFLEHYPGMTEKALEQIAEEARERWPLLGVEIVHRVGALSVSEPIVFVGVSSKHRHMAFEACAFIMDVLKTRAPFWKRETTPEGSHWVEGRESDRDAALRWS... 149
182 1.000e-76gi|654496965|ref|WP_027966747.1| hypothetical protein [Halomonas halocynthiae]  clstr ali  44  1.MIDVQYETFDVGAEQRAMLAGRCDIGAVVSFTGLVRDINEDVQGLILEHYSGMTEKALNNIVCEAKARWPLQAVRIIHRIGHLVPSDPIVLVMVASAHRRDAFLACDFLMDYLKTRAPFWKKEQTASGDYWVAERDSDQQDAKRW.... 147
183 1.000e-76gi|500089284|ref|WP_011765297.1| molybdenum cofactor biosynthesis protein MoaE [Azoarcus sp. BH72]  clstr ali  44  1MSISVQEEDFDVGAEIDALTAGRVDVGAVASFVGLVRDANEGVSAMTLEHYPGMTEQALADIVAEAEARWRLNAVRVIHRYGRLVPGNRIVFVAVAGAHRGEAFAACEFIMDYLKTRAPFWKREETPQGARWVDAREGDAAAAARWGTGG 152
184 1.000e-76gi|260072594|gb|ACX30493.1| molybdenum cofactor biosynthesis protein E [uncultured SUP05 cluster bacterium]  clstr ali  38  4..INIQKKDFDLTLEVNLARGDDSDIGAVVSFVGTVRDLDDAIQKMTLEHYPGMTEKALESIATQAQGRWPLGNITIIHRVGDLDINDQIVLVVTTSKHRKSAFEACEFIMDYLKTQAPFWKKEHTTNESKWVEAKDNDNDAASRW.... 148
185 1.000e-76gi|494152251|ref|WP_007091994.1| molybdenum cofactor biosynthesis protein MoaE [Thalassospira xiamenensis]  clstr ali  45  3.RVSVQENDFDPGAELAALTDGRTDIGAAVSFVGLVRDGGDQVSALTLDHYPGMTERELENIVDEAARRWPLDDVRIVHRFGRMLPGERIVLVITLSAHRRAAFEACDFIMDFLKTRAPFWKREQTPKGDHWVTAKASDDADAERWNTD. 152
186 1.000e-76gi|647532546|ref|WP_025822678.1| molybdopterin synthase catalytic subunit [Shewanella marina]  clstr ali  39  7.MIRVQTQDFDVPTEYAAIAADNSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLEQIEAQARERWPLTHVTIIHRVGTMGLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLEAGQQGQAWVEAKDSDDQAAAMWQQK. 155
187 1.000e-76gi|504592137|ref|WP_014779239.1| molybdenum cofactor biosynthesis protein MoaE [Thiocystis violascens]  clstr ali  43  3.RVQIQTEPFDIAAEQESLWHGNPRVGALVTFVGLMRDLHEGVSRMTLEHYPGMTEKALAEIAEEANARWKLEGVTIVHRLGKLEPQDPIVFVGVASHHRGDAFRACEFLIDYLKTRAPFWKKEQTEQGERWVESKVSDDVAARRW.... 149
188 1.000e-76gi|652944086|ref|WP_027197566.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia sprentiae]  clstr ali  41  1MPVRVQTEDFDLSAEVAALRARNPKIGALACFVGTVRDVNEGVETMELEHYPGMTEKSLEAIVERARERWRGIEVLIVHRVGKLYPLDQIVLVATTAAHRGDAFASCEFVMDYLKTEAPFWKKEKTDAGERWVDARVTDDAALARWRTEA 152
189 1.000e-76gi|721529733|gb|KGY73118.1| molybdenum cofactor biosynthesis protein MoaE [Aeromonas caviae]  clstr ali  39  9.RILVQREDFSLADEYARL-AARQDTGAIVSFVGKVRDFNQGVKGLALEHYPGMTEKALADIVAEARGRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMDFLKTRAPFWKKELTADGQRWVEARASDDAALARWQQG. 158
190 1.000e-76gi|494432180|ref|WP_007225486.1| molybdenum cofactor biosynthesis protein MoaE [marine gamma proteobacterium HTCC2143]  clstr ali  40  6MSVSVQQQDFDVSAELRRLRDQSAQVGAVASFVGVVRDINDSVSVLELEHYPGMTEQSIADIIIMAGERWQLVGARVIHRVGKLLPTDQIVLVAVTSRHRGDAFAACEFIMDYLKTRAPFWKKEQTEEGARWLDARSADQAAVDRWEQ.. 155
191 1.000e-76gi|491501732|ref|WP_005359416.1| molybdopterin converting factor subunit 2 [Aeromonas diversa]  clstr ali  40  1.MIRVQREDFSLAAEYERLS-GDPACGAIVTFVGKVRDMNQGVAGLSLEHYPGMTEKALAAIVDEAKTRWALQGCTLIHRVGDLLLGDQIVLVAVSSAHREAAFAACHFIMDYLKTRAPFWKRELSTDGRRWVEAKESDNEAAARWHE.. 149
192 2.000e-76gi|545478845|ref|WP_021714905.1| molybdopterin synthase catalytic subunit [Vibrio ezurae]  clstr ali  37  3.RVVVQEEDFDLSKEYARL-GESPSIGAVVTFVGKVRDFNDNVLGLHLQHYPQMTEKALHEICTLARSRWPLDKVTVIHRVGDLDIADQIVLVGVSSAHREAAFSACEFIMDYLKTKAPFWKKERLSNASRWIESRESDQESMQRW.... 148
193 2.000e-76gi|640282888|ref|WP_024850144.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira kuenenii]  clstr ali  40  7..IKIQQEDFDLSTEIKALREGHKDIGAVVSFIGTVRDINEGISVLELEHYPGMTEKALEAIRLQAHERWPLQSSLIIHRIGEMMPCDQIVLVAVSSRHREAAFEAAHFIMDYLKTNAPFWKKETFPDGERWVDARVSDKEAEARWHQ.. 155
194 2.000e-76gi|648404398|ref|WP_026096149.1| molybdenum cofactor biosynthesis protein MoaE [Ideonella sp. B508-1]  clstr ali  40  11.RVRIQTADFDLGQEVASLRADDGGVGAVVSFLGTVRDQAGEVSAMELEHYPGMTEKAIEAMIDAAHARFDIRAARVIHRVGPLRPCDQIVLVVVSSAHRGEAFQACEFLMDYLKTQAPFWKKETTAEGARWVDARVADDQALARWGIAS 163
195 2.000e-76gi|519073914|ref|WP_020229789.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. MR-S7]  clstr ali  41  3.SVSIQTDDFDVSAELAALRAQDGRVGAVCCFVGTVRDRSDGVASMELEHYPGMTEKSIEAMVAEARRRFDLFGVRVIHRVGLLAPLDQIVLVAVTAAHRGESFQACEFLMDYLKTQAPFWKKEDTPQGVRWVDARVSDDAALARWGIAA 153
196 2.000e-76gi|489029126|ref|WP_002939523.1| molybdopterin biosynthesis MoaE protein [Thauera sp. 27]  clstr ali  43  6..VCVQEDDFDVGAEIAALSQERADVGAVASFVGLVRDVNDGVSAMTLEHYPGMTERALEEIVIEARARWSVLDACVIHRHGRLMPAERIVFVGVASAHRGDAFAACEFIMDYLKTRAPFWKREETPDGGRWVDAREADDSAAARWS... 152
197 2.000e-76gi|499718234|ref|WP_011398968.1| molybdenum cofactor biosynthesis protein MoaE [Hahella chejuensis]  clstr ali  40  5IRIDVTTDDFDLGEETRRLTDGDTAVGAVCSFVGLVRDFSDDVKGLYLEHYPAMTEKSLTKIAKEAFQRWDLNGVRVIHRVGELWAGDQIVLVVTASAHRGDAFAACEFIMDYLKVQAPFWKKELTAEGEHWVEAKESDQVRAGEWSSE. 155
198 2.000e-76gi|577074894|gb|EUD11073.1| molybdopterin converting factor, subunit 2 [Providencia alcalifaciens 205/92]  clstr ali  41  6..IAVQTENFSVGEQYSWLAQDSDSDGAVVTFTGKVRNHNDSVAALTLEHYPGMTEKALSDIVMQSRERWSLQRVSVIHRIGTLQPGEEIVFVGVTSAHRNAAFQAAEFIMDYLKTKAPFWKKESLPDNERWVEAKESDEASANRW.... 152
199 2.000e-76gi|495142255|ref|WP_007867062.1| molybdenum cofactor biosynthesis protein MoaE [Polaromonas sp. CF318]  clstr ali  42  5.RVLITTDDFNLADEVAALRAGDKRVGAVCTFTGTVRDRNDGVSSMELEHYPGMTEKAIEAMIDEAMARFDIFGARVVHRVGLLQPLDQVVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVADDAALAKWGITA 155
200 2.000e-76gi|575852866|emb|CDL80496.1| Molybdopterin synthase catalytic subunit [Xenorhabdus cabanillasii JM26]  clstr ali  43  5.RICVQKEMFNVGAEYQWL-AQCDEDGAVVTFTGKVRNHNDDVRALILEHYPGMTENMLQKIADEARQRWRLQRINIIHRIGKLYPGDEIVFVGVTSTHRSMAFAAAEFLMDYLKTQAPFWKKEFLNDGERWVEAKESDREAASRW.... 150
201 2.000e-76gi|498123029|ref|WP_010437185.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio cyclitrophicus]  clstr ali  38  10.RVVVTAEDFSVGDEYDYLAQG-TAAGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLSEICDQAEARWPIEKMRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFVMDFLKTKAPFWKKERTTETTRWVDSRDSDAKAAERWEK.. 157
202 3.000e-76gi|496340546|ref|WP_009049724.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas chlororaphis]  clstr ali  43  1MTVHVQAEVLDLDRLHREVHGGDPSIGAVVTFVGYVRDLNDQVGSLFLEHYPGMTERALQRIVDEANQRWPLQRVRVVHRVGLLQVAEPIVFVGVASAHRQAAFAACAFLMDYLKTRAPFWKREQTLSGERWVEGRESDQLAASRW.... 148
203 3.000e-76gi|668679905|gb|KFB73423.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-91]  clstr ali  43  1MMVRVQEADFDVGAELAALRRDRPQIGALASFVGVVRADSDGVSEMTLEHYPGMTEKALAAMVGEAGRRWKLIDAIVIHRVGRLLPGDQIVLVAVAGAHRGEAFAACEFLIDYLKTRAPFWKREVTPQGARWVAARASDDQAAERW.... 148
204 3.000e-76gi|40063018|gb|AAR37874.1| molybdopterin converting factor, subunit 2 [uncultured marine bacterium 560]  clstr ali  34  4..IVVQTEDFDLTTEVAHTRSNNPQIGAIVSFIGTVRDHPGSISSMTLEHYPEMTEKSLKSIVTEARERWDLQNITIIHRIGKLKVNDQIVLVVTTSKHRQAAFESCHFIMDYLKTDAPFWKKESTEQKEEWVESRESDDEQKKRWQS.. 150
205 3.000e-76gi|665494269|dbj|GAK45966.1| molybdenum cofactor biosynthesis protein E [alpha proteobacterium MA2]  clstr ali  43  1MSISVQLEDFDIKAETEKVTAGRTDIGALVTFTGLARDHTKTVEAMELEHYPGMTERELERIEKEAHERWQLQASRIIHRYGPLHPGEQIVLVITASAHRKDAFEAAEFLMDWLKTKAPFWKKETGPSGTHWVDAKVSDDEAAARWQK.. 150
206 3.000e-76gi|495124258|ref|WP_007849071.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. CF316]  clstr ali  42  8.SVSIQTEDFDLSAEVAALRHGDRRVGAVCAFVGTVRDRNDGVASLELEHYPGMTEKSIAAMVDAAFGRFELFGVRVIHRVGLLQPLDQIVLVAVTSAHRGQSFEACEFLMDYLKTQAPFWKKEVTPAGARWVDARVSDDAALARW.... 154
207 3.000e-76gi|653000583|ref|WP_027252786.1| molybdopterin synthase catalytic subunit [Photobacterium halotolerans]  clstr ali  36  5..ICVQAEDFSLALEYQALAEGN-QAGAVVTFVGKVRDMNESVSTLTLEHYPGMTEKSLLFIVEQAKSRWPVLAATVIHRVGQLTAGDQIVFVGVSSAHRGAAFQACEFIMDYLKTEAPFWKKEVREGETSWVDARETDQQARQRWHK.. 151
208 3.000e-76gi|503874917|ref|WP_014108911.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Glaciecola nitratireducens]  clstr ali  35  8..ISVQEQDFDLALEYTQIRKHSDSDGAIVTFTGLVRELTGNLKYMTLEHYPGMTEKSLMNICEQARERWPIGSIRIIHRIGKLPPDEQIVFVGVSSKHRKAAFAATEFMMDFLKTQAPFWKKELTTEGEFWVDAKSSDKHKANDW.... 153
209 4.000e-76T2D.3881205 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  46  8..IVVGPQPFSVGEEYPWL-AERDEDGAVVTFTGKVRNHNDSVNALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW.... 152
210 5.000e-76gi|500153143|ref|WP_011829146.1| molybdenum cofactor biosynthesis protein MoaE [Methylibium petroleiphilum]  clstr ali  41  11.RVTIQTEDFDLSSEVAALRAHQRGVGAVASFVGTVRDRNDGVSRMELEHYPGMTERAIEAMIDAAFARFDLLGARVIHRIGPLEVGEQIVLVVVSSAHRGQAFQACEFLMDYLKTQAPFWKKEQTPQGARWVDARVADDDALRRWGIAA 161
211 5.000e-76gi|490355923|ref|WP_004235696.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Morganella morganii]  clstr ali  45  5.RIAVQTDNFSVGEEYQWL-AGCADDGAVVTFTGKVRNHNDNVAALSLEHYPGMTEKALADIVTQARERWELQRVTLIHRVGSLYPNDEIVFVGVSAAHRGMAFEAAEFLMDYLKTRAPFWKKETLPEGTRWVDARESDQKAADRW.... 151
212 5.000e-76gi|654835318|ref|WP_028288036.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola nanhaiensis]  clstr ali  45  1MRVVVQSEPFDLGALTAGFAAGRSDMGAVVSFTGIVRDTDGRLDRMEIEHYPGMTERAIATIAEEAQARWSLGDVLVIHRHGTLRPGELIMMVATCSPHRGDAFAAAEFLMDYLKSRAPFWKKELTADGAAWVAAKPEDEDALSRWTR.. 148
213 5.000e-76gi|527114691|ref|WP_020914948.1| Molybdenum cofactor biosynthesis protein E [Shewanella piezotolerans]  clstr ali  37  1.MIRVQTTDFSVPDEYQLISQDNGD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLNQIEAQARERWPLNHVTIIHRVGKMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGEEGASWVEARDSDEQAADVWNKK. 149
214 5.000e-76gi|651235346|ref|WP_026375424.1| molybdopterin synthase catalytic subunit [Aestuariibacter salexigens]  clstr ali  37  1.MISIQREDFNVGDEYELLRKTSRSEGAVVTFVGLVRDVNDSVTALELEHYPGMTEKVLNELCDEARQRWVLGAIRIIHRVGKLQANDQIVFVGVSSRHRQDAFDAAQFVMDVLKTQAPFWKKEHGVNSAKWVEVRETDMLALQRWQNP. 150
215 6.000e-76gi|653020989|ref|WP_027272890.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Leminorella grimontii]  clstr ali  42  7.RIVVGAAPFSVGEEYQWLSQCD-DDGAVVTFTGKVRNHNDSVSALTLEHYPGMTEKSLAEIVVAARERWPLQRVSVNHRVGELFPGDEIVFVGVTSAHRGSAFDAAEFIMDYLKTKAPFWKREATQEGDRWVESRDSDREAAERW.... 152
216 6.000e-76gi|506315285|ref|WP_015835060.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photorhabdus asymbiotica]  clstr ali  40  5.RIFVGLENFNVGDEYEWLSQCD-EDGAIVTFTGKVRNHNDRVSGLRLEHYPGMTEKVLRNIVVEARSRWPLQRISIIHRVGALYPGDEIVFVGVTSAHRSMAFDAAEFIMDYLKTKAPFWKKEFLPDGERWVESRESDQEAARRW.... 150
217 7.000e-76gi|661560906|emb|CDG17165.1| Molybdopterin synthase catalytic subunit [Xenorhabdus doucetiae]  clstr ali  39  5.RITIQRETFNVGEEYQWLSQCD-EDGAVVTFTGKVRNHNDQVKALTLEHYAGMTEKMLQQIVDKARQRWPLQRVSVIHRIGELYPGDEIVFVGVTSSHRNMAFMATEFIMDYLKTQAPFWKKESLAEGKRWVETRQSDHDAANRWKRD. 153
218 9.000e-76gi|597958564|gb|EYC51752.1| molybdenum cofactor biosynthesis protein MoaE [Hylemonella gracilis str. Niagara R]  clstr ali  40  5.RVSIQTCDFNVATEIAALRARDARVGAVCSFIGTVRDRNGGVSAMELEHYPGMTEQAIEGMIDEAQRRFDIYAARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPQGARWVDARVSDDEALARWGISA 160
219 1.000e-75METAHIT MH0083 GL0075865 [Complete] locus=scaffold78862_2:131:589:+  ali  38  5.TIRVSPEDFSVDAEVARVREASPSAGAVVSFVGVVRNRNDGVSKMTLEHYPGMTEKALGKIVEKARERFHLEDVVVIHRVGDLSVGDQIVLCLVSASHRGEAFEGCEYIMDWLKTEAPFWKRETTPEGERWVDARESDDRAKARWG... 152
220 1.000e-75gi|497236200|ref|WP_009550462.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderiales bacterium JOSHI_001]  clstr ali  42  4.RVRIQTEDFDLGTEVAAVRAGNPAVGAVAAFVGTVRDRNAGISAMELEHYPGMTEKAIEAMIDDAMRRFRVLGARVIHRVGPLKPLDQIVLVVVTSTHRGDAFQACEFLMDYLKTQAPFWKKETTPEGARWVDARVADDAALARWGITA 156
221 1.000e-75gi|670455687|ref|WP_031404486.1| molybdenum cofactor biosynthesis protein MoaE [Thiomonas sp. FB-Cd]  clstr ali  42  7.TIRIQHEVFDTCEELRKMRAGRTDIGALASFEGICRDHNQAVQALELEHYPGMTEQSILRMVREAHERWPLQAATVIHRIGRLQPGDPIVFVAVACAHRHAAFEACAFLMDYLKTQAPFWKKETTAQGTQWVDAREADDAALARWGIEA 163
222 1.000e-75JCVI_PEP_1096684895653 /source_dna_id=JCVI_ORF_1096684895652 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  41  9.RILVQRDDFSLADEYARL-AARQDTGAVVSFVGKVRDFNQGVKGLALEHYPGMTEKALTDIVAEARSRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMDFLKTRAPFWKKELTAEGQRWVEAKESDNTAAARWQ... 156
223 1.000e-75gi|488369995|ref|WP_002439380.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shimwellia blattae]  clstr ali  42  5.RIRVGHDGFSVGDEYQWLAQCDAD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKALAEIVASARERWPLQRVSVIHRTGELWPGDEIVFVGVTGAHRGSAFEAAEYIMDYLKTRAPFWKREKTADGDRWVDARESDQQAASRW.... 150
224 1.000e-75gi|689828592|dbj|GAL58899.1| molybdopterin synthase catalytic subunit [Escherichia vulneris NBRC 102420]  clstr ali  44  5.RIRVGHDPFSVGEEYTWL-AERDEDGAVVTFTGKVRNHNDSVRALTLEHYPGMTEKTLADIVQQARDRWPLGRITVVHRIGELWPGDEIVFVGVTSVHRGSAFAAGEYIMDYLKTRAPFWKREATEEGDRWVEARESDQQAAKRW.... 150
225 1.000e-75gi|652911636|ref|WP_027165586.1| molybdopterin synthase catalytic subunit [Mesorhizobium sp. WSM3224]  clstr ali  49  9..IRIQREDFDVAAEIAGLTRGRADIGAVVTFSGLCRDEQGALSALELEHYPGMAEAEIGRIAAEAVERWPLQGLTVIHRHGKIAPGENIVLVVAASSHRQAAFEAANFLMDYLKSRAPFWKKEHLADGSQWVEAKEADDHAADRWTKP. 157
226 1.000e-75gi|491640764|ref|WP_005498293.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella benthica]  clstr ali  40  8..VRVQTEDFSVSDEYA-LIAGDNSDGAVVTFVGKVRDFNDGVSDLTLEHYPGMTEAVLNQIALEARERWPLNNVTIIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDKGANWVEAKDADDQAANMWEKQ. 155
227 1.000e-75gi|497224573|ref|WP_009538835.1| Molybdenum cofactor biosynthesis protein MoaE [Caenispirillum salinarum]  clstr ali  46  1MAVRVQREDFDVGAEMAAFCAGDTSVGAVASFVGLVREGSGAVSAMTLEHYPGMTERQLEAIEADARERWPLHDVLVVHRYGRMEPGERIVLVLTASSHRQAAFDACAFLMDWLKTKAPFWKLEETPNGGRWVDARESDDAAAARWGGD. 154
228 1.000e-75gi|492601959|ref|WP_005900411.1| molybdopterin converting factor subunit 2 [Aeromonas molluscorum]  clstr ali  39  11.RILIQREDFCLADEYARL-ATRPDSGAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALADIVAQARGRWPLQECTLIHRIGELRLGDQIVLVGVSSAHRDAAFDACHFIMDFLKTRAPFWKKELIAEGQRWVEAKESDNDAASRW.... 157
229 1.000e-75gi|500085621|ref|WP_011761634.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella amazonensis]  clstr ali  37  5.RILVQTADFSVPEEYQRIAADN-QDGAVVTFVGKVRDFNEGVSDLTLEHYPGMTEKVLDQIADQARERWPLNHLTIIHRVGTMHLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLETSDKGQGWVEARDADDQAAKAWEQ.. 152
230 2.000e-75gi|500118386|ref|WP_011794391.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax citrulli]  clstr ali  40  18.RVSIQPQDFDVSAELAALRARDGRVGAVCCFVGTVRDRSDGVAAMELEHYPGMTEKSIEAMVDEALGRFDIFGARVVHRVGLLAPQDQIVMVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPLGARWVDARVSDDAALARWGIVS 168
231 2.000e-75gi|496205718|ref|WP_008925054.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. aB]  clstr ali  43  5..IRVGPAPFDMAEAYRWLAACD-EDGAVVTFTGKVRNHNDNVAALMLEHYPGMTEKALQEIVDAARERWPLQRVTVIHRVGELFPGDEIVLVGVTSAHRSSAFSAAEFIMDYLKTRAPFWKREATEQGDRWVDARDSDHQAAQRWD... 150
232 2.000e-75gi|646636369|ref|WP_025567652.1| hypothetical protein [Gammaproteobacteria bacterium SCGC AAA003-E02]  clstr ali  43  1MNISVQLNDFEPTVEQQALEQF-PGAGAVVTFTGLVRNKNDGVSSLTLEHYPGMTEKSLEKIVLEAKQRWTLEAVRVIHRVGTLAVGERIVFVGVAATHRGEAFAACEFIMDYLKTKAPFWKKEQGELEGRWVDARETDDQAAHRWQKG. 150
233 2.000e-75gi|260219647|emb|CBA26492.1| Molybdopterin-converting factor subunit 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  40  10.RVRIQTEAFDLGLEISQLQAADPRVGAVCSFVGTVRDRNGSVQTLELEHYPGMTEKSIEAMVDAAFARFDIYGARVVHRVGVLQPTEGVVLVAVTSAHRGQSFQACEFIMDYLKTQAPFWKKETTPEGAHWVDARVSDDEALARWGITA 163
234 2.000e-75gi|497966771|ref|WP_010280927.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pectobacterium carotovorum]  clstr ali  45  5.RIRVGEENFNVGDEYQWL-AQCDEDGAVVTFTGKVRNHNKDVSALTLEHYPGMTEKALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDKQAAQRW.... 150
235 2.000e-75gi|652656762|ref|WP_027016863.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas composti]  clstr ali  44  5.RVFIQTQDFDVSAELAALRAGDAGVGAACCFVGLVRDRNEGVASMELEHYPGMTEKSIEAIIDQAQARFGIHGARVIHRVGLLAPMEQIVLVAVTAAHRGKAFEACEYIMDYLKSLAPFWKKEQTPAGARWVDARVSDEQALERWS... 152
236 2.000e-75gi|497445209|ref|WP_009759407.1| molybdenum cofactor biosynthesis protein MoaE [Roseibium sp. TrichSKD4]  clstr ali  44  6.SVRVQAENFDLTEETAKLTAGRFDIGAVVTFTGLCRDEGGQLSALELEHYPGMAEAEISRIAERAAERWPITGLTVIHRFGKIAPGENIVLVIAASPHRQAAFDAANFLMDFLKTRAPFWKKEHLKSGQDWVDAKDLDEQALTRWEQ.. 154
237 2.000e-75gi|594557279|gb|EXU81300.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas aquatica DA1877]  clstr ali  42  5.RVLIQHQDFDVSAELAALRAGDARVGAVCSFVGTVRDRNEGVSAMELEHYPGMTEKCIEAIIDRAVARFGIFGARVIHRIGPLQPLDQIVLVAVTSAHRGMSFQACEFIMDYLKSEAPFWKKEQIPEGARWVDARVSDEQALARWAQ.. 153
238 3.000e-75gi|492544729|ref|WP_005880959.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacter formigenes]  clstr ali  39  1MSIRIQTEDFDLSAELDRLRSDHRDIGAVVSFVGTVRDVNDGILSMELEHYPGMTEAALEEIESRARQRWDILDSIIIHRVGVLKPADQIVLVAVASRHRGEAFRACEYMIDALKTQAPFWKKEQTAKGGRWVKAKDSDESALKKW.... 149
239 3.000e-75gi|495279071|ref|WP_008003825.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. GM49]  clstr ali  39  1MTVRVQREVFDISQLIDSLQANDPGVGAVVNFVGYVRDINQGVAGLFLEHYPGMTERSLQTIIDNARARWPLRAVEIVHRIGPLSISEPIVFVGVSSQHRQAAFEACAFITDYLKTDAPFWKREDVASGARWVDARDSDRSAVERW.... 148
240 3.000e-75gi|501284337|ref|WP_012327355.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella woodyi]  clstr ali  40  8..VRVQTQDFSVPEEYA-LIADDNSDGAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLNQIATEARERWPLNKVTIIHRVGTMSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGETGKSWVEAKDADEQAAKMWDR.. 154
241 3.000e-75gi|653036070|ref|WP_027287758.1| molybdenum cofactor biosynthesis protein MoaE [Rhodovibrio salinarum]  clstr ali  37  1.MIRVQREDFDVGTELAALTQDNPGVGGMCSFVGLVRDGEGRVTAMTLEHYPGMTEKMLERIDAEAHRRWPIEASLVIHRFGRMEPGERIVLVATASAHRQAAFDSCQFLIDWLKTKAPFWKLEETPDGGRWVDARDSDDTAASRWGSD. 160
242 3.000e-75gi|491575876|ref|WP_005433453.1| molybdenum cofactor biosynthesis protein MoaE [Sutterella wadsworthensis]  clstr ali  40  5.TIRVSEADFNPGEEIERLIESSPEAGGVASFVGVVRNRNDGVTHLTLEHYPAMTERALAGIVERARARWDVCGVTVIHRVGEMAVGEHIVLVVVTSAHRREAFEACEFIMDWLKTEAPFWKKERTPEGERWVDARESDEEARRRWGEAA 155
243 3.000e-75gi|499954843|ref|WP_011635577.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella frigidimarina]  clstr ali  37  8IVVRVHTEDFSVADEYA-LLACDKQDGAVVNFVGKVRDFNDGVTDLTLEHYPGMTESVLLQISQQACERWPLNKVTIIHRVGRLSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDTGAKWVEARDSDQQAAKMWQK.. 156
244 3.000e-75METAHIT V1 GL0028585 [Complete] locus=scaffold64266_1:3615:4124:-  ali  38  1MKIAVQTEDFDVQAEVAALH-GSPKVGAVVMFLGTVRDLNEGVASMTLEHYPGMTEKALTAIVKEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSKWSKEA 151
245 4.000e-75gi|660520517|gb|KEO50498.1| hypothetical protein TP2_14620 [Thioclava pacifica DSM 10166]  clstr ali  50  1MKISVQTEPFDLGTEMAGFGTGREDVGAVVSFTGIVRDDTGAMDALELEHYPGMTERAIAKIVGEAIERWKLADVIVIHRHGRLGVGEQIMMVATAARHRVAAFEAAEFLMDYLKSRAPFWKKEHGPEGTSWVAAKDEDEDALKRW.... 146
246 4.000e-75gi|555038707|gb|ESL83022.1| molybdopterin synthase catalytic subunit [Enterobacter cloacae UCICRE 12]  clstr ali  44  18.RILVGPERFNVGTEYSWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAEIVDEARGRWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTKAPFWKREATPEGDRWVESRDSDKQAASRW.... 163
247 4.000e-75gi|639052987|ref|WP_024459735.1| hypothetical protein [Marinimicrobium sp. LS-A18]  clstr ali  36  1.MISVQTAPFDVAHEYAQLTADDVDAGAAVFFVGRVRSHNDGVTGMTLEHYPGMTEKALEQILADARQRWSLGRVRVIHRVGSLVLGEAIVFVGVTSAHRDASFEAAEFIMDYLKNRAPFWKREDTEDGSVWVDARDKDLRALARWS... 148
248 5.000e-75gi|572101856|dbj|BAO30267.1| molybdenum cofactor biosynthesis protein E [Sulfuritalea hydrogenivorans sk43H]  clstr ali  47  1MSVSVQEADFDAGAEIAALSAGRDDVGAVASFVGLVRGETAAVQAMTLEHYSGMTEKALDAIVTEARGRWNIYGVRVIHRVGRLLPGDRIVFVAVASAHRGEAFAACEFIMDYLKTRAPFWKKEETPEGGHWVDARESDDHAAGRWNR.. 170
249 5.000e-75gi|495816664|ref|WP_008541243.1| molybdenum cofactor biosynthesis protein MoaE [Sutterella parvirubra]  clstr ali  41  6.TIRVGEAPFDAGAETAALYAGDPSVGGVATFVGVVRNRNDGVAKLTLEHYPAMTEKALAGIVKRARARWTLGAVTVIHRVGPLDVSDPIVFVGVAAEHRGEAFAACEFIMDWLKTEAPFWKKEATPEGERWVDARESDDKAKARWGEG. 155
250 5.000e-75gi|559225838|ref|WP_023581223.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Proteus hauseri]  clstr ali  38  6.RIAVQTENFSVGDEYQWLSECDSD-GAVVTFTGKVRNHNDEVSTLTLEHYPGMTEKALNDIVSEARGRWPLQRVSVIHRVGTLHIGEEIVFVGVTSSHRNSAFESAEFIMDFLKTRAPFWKKELSENKDRWVDARQSDYDSAERWE... 153
251 6.000e-75gi|640183665|ref|WP_024814445.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. JHL-3]  clstr ali  38  5.RVSIQTEDFDVSTEIAALRHENKGVGAVCSFVGTVRDRTDAVASMELEHYPGMTEKSIEAMVDEAMRRFDIFGARIIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEETAQGARWVDARVSDDAALARWGIDA 182
252 6.000e-75gi|500135329|ref|WP_011811334.1| molybdenum cofactor biosynthesis protein MoaE [Verminephrobacter eiseniae]  clstr ali  40  5.RVVIQTQDFDLSSEIAALRRDNRGVGAVCSFVGVVRDRNDAVLSIELEHYPGMTEKSIEAMVDEAVRRFDIVGARVIHRVGRLQPLEQIVLVAVASAHRGQGFQACEFLIDYLKTQAPFWKKEHTPQGVRWVDARVSDDAALARWGIMA 166
253 6.000e-75gi|500094461|ref|WP_011770468.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ingrahamii]  clstr ali  36  1.MIRVQTEDFNQQREYDRLREQS-SVGAVVTFTGLVRDFNQGVASLTLEHYPLMTEKSLAQIVMQAKQRWNILACTLIHRVGELKISEQIVFVGIATAHRQDAFAACEYIMDYLKTEAPFWKKECNSQGSYWVDARESDRSALNKWS... 148
254 6.000e-75JGI.Meta JGI_HUM.3397531 7008186891 SRS065099_LANL_scaffold_75854__gene_134260 moaE protein [Human Supragingival plaque microbiome from visit number 2 of su  ali  42  5..IHVQTQDFDVGAELKRXXXXXREVGAVASFVGYVRDSNDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRPRAAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQAG. 163
255 7.000e-75gi|517238318|ref|WP_018427136.1| molybdenum cofactor biosynthesis protein MoaE [Hoeflea sp. 108]  clstr ali  45  8.MVRIQAADFDVAQEIGRLTAGRADVGAVVTFTGLCRDEAGTLSALELEHYPGMAEAEISRIAAEALERWPLSGMTAIHRFGRVRPGENIVLVVAASKHRQAAFEAASFLMDYLKSRAPFWKKEHRADGSAWVDAKESDEAAAARWARP. 157
256 8.000e-75gi|499368109|ref|WP_011055687.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Yersinia pestis]  clstr ali  44  7.RIRVGAEAFSVGDEYTWLSQCD-EDGAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALTEIIADARSRWSLQRVSVIHRVGPLFPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATVEGERWVESRDSDHIAAKRW.... 152
257 8.000e-75gi|653009923|ref|WP_027262083.1| molybdenum cofactor biosynthesis protein MoaE [Sedimentitalea nanhaiensis]  clstr ali  46  1MRVKVQEAPFDVADEMRGF--GAPGTGAIVTFTGVVRNDSGNLTAMEIEHYPGMTEAALAQIATRAQERWQLGDVLVIHRHGRLIPGEQIMMVATASRHRKAAFEAADFLMDYLKSRAPFWKKEITADGAEWVAARDEDEAALDRWSPE. 148
258 9.000e-75JCVI_PEP_1096695085025 /source_dna_id=JCVI_ORF_1096695085024 /offset=0 /translation_table=11 /length=206 /full_length=206  ali  41  47.RVLIQTADFDVSAEIDALRAQDLRVGAVCSFVGTVRDTQDEVQAMELEHYPGMTEKSIEAMIDEAHTRFDFYGARVVHRVGRLLPADQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGAHWVDARVSDDAALARWGIQA 202
259 9.000e-75gi|587642112|gb|EWY41124.1| molybdenum cofactor biosynthesis protein MoaE [Skermanella stibiiresistens SB22]  clstr ali  41  1MAIRVQREDFDVGAELAALTENNHGIGGVTSFVGLVREMGGGPSAMTLEHYPGMTERQLAEIEAEASRRWKLDATLIIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTRAPFWKLEETAKGSHWVEAKEGDDIAASRW.... 146
260 9.000e-75gi|503273696|ref|WP_013508357.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. At-9b]  clstr ali  43  5.RIRVGSAAFNVAEEYAWLSA-HDSDGAVVTFSGKVRNHNDSVAALTLEHYPGMTEKALTEIVEEARQRWALQQVSVIHRVGELFPGEEIVFVGVSSAHRSSAFAAAEFIMDYLKTRAPFWKREATAHGDRWVDARDSDHQAAERWK... 151
261 1.000e-74gi|654527170|ref|WP_027995298.1| molybdenum cofactor biosynthesis protein MoaE [Simplicispira psychrophila]  clstr ali  39  6..ISIQIADFDVSAELAALRANDLGVGAVCCFVGTVRDRNGAVASMELEHYPGMTEKSIEAMAAEAFRRFDILGARVIHRVGLLAPPDQIVLVAVTSPHRGESFQACEFLMDYLKTQAPFWKKEQTAAGAHWVDARISDDAALARWGIHA 158
262 1.000e-74gi|496087141|ref|WP_008811648.1| molybdenum cofactor biosynthesis protein MoaE [Parasutterella excrementihominis]  clstr ali  38  1MKIAVQTEDFDVQAEVAALHA-SPKVGAVVMFLGTVRDLNEGVASMTLEHYPGMTEKALTAIVEEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSRWTK.. 149
263 1.000e-74gi|495506997|ref|WP_008231644.1| molybdenum cofactor biosynthesis protein MoaE [Roseobacter sp. CCS2]  clstr ali  47  1MTVRVQSDPFDAGAELNSFAQDRTDIGAVVSFTGVVRDTKGDLQEMLIEHYPGMTQSAITKIADEAVQRWALADVLVIHRYGPLKPGEPIMMVATVSAHRAASFEAADFLMDYLKSRAPFWKKEVTAEGAAWVDAKDTDEDALKRW.... 146
264 1.000e-74gi|518446484|ref|WP_019616691.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ossibalaenae]  clstr ali  35  1.MIKVQSEDFNQQVEYDRLRKD-PSVGAVVTFSGLVRDINQGVSSLTLEHYPGMTESSLAEIVKQAESRWNIIDCTVIHRIGELQLLDQIVFVGIASLHRQDAFAACEFIMDYLKTQAPFWKKETNAQQESWVDARESDQEALNKW.... 147
265 1.000e-74JCVI_PEP_1096685142461 /source_dna_id=JCVI_ORF_1096685142460 /offset=0 /translation_table=11 /length=156 /full_length=156  ali  38  7..VRVQTVDFNVTDEYHQLAQDNSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTERVLEQIVAEARERWPLNKVTVIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDKGKNWVEAKDADEQAAQLWQHK. 154
266 1.000e-74gi|552167727|ref|WP_022987534.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter sp. ES-1]  clstr ali  40  1.MISVQTGDFDTGAEYAALRASGSGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEAVIQGLIDEASRRWDVRDARVIHRVGRLALSDQIVFVGVCSAHRGDAFAACSFIMDALKTSAPFWKKEMTSDGEHWVEQKASDRERTQAWSSD. 150
267 1.000e-74gi|699259953|gb|KGM48230.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola sp. 22II-S11g]  clstr ali  51  1MRIVVQEAPFDLGAETSRFAEGHKDQGAIVTFTGLVR-EDGGMARMEIEHYPGMTERAITKIAEEAVTRWSLGDTLVIHRFGPMQPGEAIMMVATAAPHRKDAFEAAEFLMDYLKSRAPFWKKEIGPDGSDWVAAKDEDEDALDRW.... 145
268 1.000e-74gi|666602493|emb|CDH29830.1| molybdopterin converting factor, subunit 2 [Xenorhabdus bovienii str. Jollieti]  clstr ali  41  10....VQRERFNVGDEYQWLSQCD-DDGAVVTFTGKVRNYNDSVKALTLEHYPGMTEKMLQVIIDEARQRWPLQRISVIHRIGELYPGEEIVFVGVTSAHRSMAFTAAEFIMDYLKTRAPFWKKESLVEGERWVATRESDQEAAGRW.... 152
269 1.000e-74gi|494357399|ref|WP_007193512.1| molybdenum cofactor biosynthesis protein MoaE [Thiocapsa marina]  clstr ali  41  3.RIRVQHDLFDSAEEQKILSRDKPRVGAVVTFVGLMRDFNEGVVAMTLEHYPGMTEKALGAIAEEAAQRWDLEDISILHRVGELRPQDPIVFVGVSSRHRGEAFRACEFLIDSLKTRAPFWKKEQTSEGERWVDARVTDDAAARRW.... 149
270 1.000e-74gi|557914694|ref|WP_023471537.1| Molybdopterin synthase catalytic subunit [Betaproteobacteria bacterium MOLA814]  clstr ali  39  1MTVRIQTQDFDVSTELAALHANNLQVGAVCSFVGTVRIWNKDIHGMTLEHYPGMTEKAIEAMVVQAKARFDMFDAVVIHRVGELLAGDQIVLVAVTSTHRHESFQACEFLMDYLKTQAPFWKKEHTAAGAQWVDAREADDAALARWGINA 156
271 2.000e-74gi|340385693|ref|XP_003391343.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Amphimedon queenslandica]  clstr ali  40  4.SIRIQQEPFDAGSIIEDTGRNTPKTGAVAAFVGRMRDINAGIAQMTLEHYPGMTERAIENICQEASKRWELLDIRVVHRIGPLKPLDTIVLVAVASPHRQNAFLACEFIMDFLKTRAPFWKKETTEDGAEWVESRTSDELAAERWHEKS 155
272 2.000e-74gi|503132351|ref|WP_013367012.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacter lignolyticus]  clstr ali  45  5.RIIVDTAAFDVGAEYRWL-AGRDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVEEARSRWPLGRVTLIHRIGEMWPGEEIVFVGVTSAHRSSAFAAGEFVMDYLKTRAPFWKREATPEGERWVDARDSDREAAERWQ... 151
273 2.000e-74gi|657937352|ref|WP_029638452.1| molybdenum cofactor biosynthesis protein MoaE [alpha proteobacterium Mf 1.05b.01]  clstr ali  43  1.MVRVQTEDFDPGAELDNLVAARTDVGASVSFVGHMRARNEDVETMTLEHYPGMAEKALSEIEAEAHKRWPLQASTIIHRVGPLKPGDRIVLVITASAHRQAAFEAAEFLMDWLKTKAPFWKKESGPEGDSWVSSRSTDEDAAQRWTASG 151
274 2.000e-74gi|496226493|ref|WP_008940528.1| molybdenum cofactor biosynthesis protein E [Marinobacter santoriniensis]  clstr ali  37  1.MISVQTDDFDPSAEYQSLRDSGSGTGAIVTFTGLVRDSGDDVQGLYLEHYPGMTEQVIQGLIDEASQRWDVRRARVIHRVGPLALRDQIVFVGVCSAHRGDAFKACEFIMDALKTSAPFWKKEITAEGEHWVEQKSGDRARSSRWE... 148
275 2.000e-74gi|589606701|gb|EXI78356.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-92]  clstr ali  44  1MRISVQEGDFDVGAELAALRQGNPQIGAVASFVGLVRDSNDGVAEMSLEHYPGMTEKALAEIVEEACRRWAIIDALVIHRVGRLLPSEQIVLVAVAGAHRGEAFAACEFIMDYLKTRAPFWKREVTPSGARWVDARAADDQAAERWQEPG 152
276 2.000e-74gi|543167592|ref|WP_021019499.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio gazogenes]  clstr ali  37  4.SVAVQHDDFCVEDEYQALSQGD-DAGAVVTFVGKVRDMNLGVTGLHLEHYPGMTEKALNTICEQALQRWPLLAIRVIHRIGDLAIGAQIVFVGVSSHHRDAAFAASAFIMDTLKTQAPFWKKETTSRGERWLDSRDSDRLAAEKWQ... 150
277 2.000e-74T2D.2984916 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  42  5.RIVVSPARFSVSEEYPWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAEIVELARERWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTRAPFWKREATPDGERWVDARDSDRQAAERW.... 150
278 2.000e-74gi|521079600|ref|WP_020410507.1| hypothetical protein [Hahella ganghwensis]  clstr ali  36  5IHIEISQRDFDLGTEVKRLVGDDNGIGASCSFVGYVRDFSEEVVGLELEHYPGMTEKSLQKIAEEACDRWEIEGITVIHRIGRMMLGEQIVLVVTTSAHRAEAFAACEFVMDYLKVDAPFWKKELTNDGDHWVEARDKDSERAEKWQID. 155
279 2.000e-74gi|563834250|ref|WP_023800669.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium sp. L48C026A00]  clstr ali  48  8.TVRIQAEDFDVAAEIARMTQGRADIGAVVTFSGLCRDEAGRLAALELEHYPGMAEAEIGRIAAEAVQRWPLQGLTAIHRHGRIAPGENIVLVVAASAHRQAAFEAANFLMDYLKSRAPFWKKEHHTDGSEWVDAKEADDEAASRWKR.. 156
280 2.000e-74METAHIT V1 GL0114486 [Complete] locus=scaffold55408_6:969:1421:-  ali  43  5.RILVGHERFNVGTEYDWL-AGRDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAAIVEEARGRWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTKAPFWKREATPEGERWVESRDSDKHAASRW.... 150
281 2.000e-74JCVI_PEP_1096665653177 /source_dna_id=JCVI_ORF_1096665653176 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  37  5MSVRITEDDFDIALEHEKLK--SRDAGAIVTFTGTVRDNGGGLNAMTLEHYPGMTESEIEMIIDQAKARWPLVNVTVIHRVGRMLPTENIVFVGCSSAHRGAAFDGANFIMDFLKTKAPFWKLEDGPNGAKWVDARDSDSKALDRWNLP. 153
282 3.000e-74gi|640278743|ref|WP_024848524.1| molybdopterin synthase catalytic subunit [Aminobacter sp. J41]  clstr ali  44  9..VRVQAEDFDAAQEIARLTAGRTDIGAVVTFSGLCRDENGALSALELEHYPGMAEAEISRIANEATERWPLTGLTVIHRYGMMRPGDNIVLVVAASSHRQAAFEAASFLMDFLKTRAPFWKREHRADGTEWVAAKEEDDAAQARW.... 154
283 3.000e-74gi|551321236|ref|WP_022940996.1| molybdenum cofactor biosynthesis protein MoaE [Psychromonas hadalis]  clstr ali  36  1.MIKVQSENFNQQIEYDRLRQAS-HTGAVVTFTGLVRDINQGISALTLEHYPAMTEKALADIVKQAQSRWSLIDTTVIHRVGELQLLDQIVFVGVASLHRGDAFAACEFIMDYLKTQAPFWKKETNSQGESWVDARESDQSALNKWHK.. 149
284 3.000e-74gi|495406572|ref|WP_008131271.1| molybdenum cofactor biosynthesis protein MoaE [Pseudoalteromonas sp. BSi20480]  clstr ali  41  3ISINVQTQDFSVGKQHDALCSNNKSDGAVVTFTGLVREFGDNVIALELEHYPGMTEQLLQSIAEQAQTRWQLARISIIHRVGYLALGEQIVFVGVTSRHRQAAFEGAQFIMDYLKNHATFWKKEHFKDSSNWVEFKQSDKQALNKWQS.. 152
285 3.000e-74gi|496387197|ref|WP_009096187.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. GFAJ-1]  clstr ali  43  8IAVEVQAAPFSMDYGYESTLQQRTDIGAIVSFTGLVRDFNEDVTGLTLEHYPGMTERTLAEIGEQAWERWSLQAVRIIHRVGHLSPGDPIVRVLVASAHRRDAFNACDFIMDYLKTQAPFWKKEHSREGAYWVKERDSDQQDADRWSS.. 157
286 3.000e-74gi|655016851|ref|WP_028465818.1| molybdenum cofactor biosynthesis protein MoaE [Nisaea denitrificans]  clstr ali  36  1.MIRVQKEDFDLATELSALSAGNHNIGGITSFVGQVRDMADGVGAMTLEHYPGMTEKMLEQIDAEANKRWPLEASLIIHRYGRMEPGEQIVLVACASPHREAAFEACHFLIDWLKTKAPFWKLEEKDSGAAWVDARESDADATAKWDKG. 150
287 3.000e-74gi|518257559|ref|WP_019427767.1| molybdenum cofactor biosynthesis protein MoaE [Limnohabitans sp. Rim28]  clstr ali  39  5..VTIQTEDFNVSQEIEVLRAQDLRVGAVCSFVGTVRDTRDEVQAMELEHYPGMTEKSIEAMIEQAHQRFDFYAARVVHRVGRLLPSDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPQGAQWVDARISDDAALARWGIQS 159
288 4.000e-74gi|633287858|gb|KDB52762.1| molybdopterin biosynthesis MoaE protein [Sphaerotilus natans subsp. natans DSM 6575]  clstr ali  42  9.RVAIQTEDFDLSAEVAALRAGDGAVGAVTTFIGTVRDRHAGVSAMELEHYPGMTERAIEAMIDEALRRFDIRAARVVHRVGPLAIGDQIVLVAVSSMHRGESFQACEFLMDWLKSEAPFWKKETTAEGARWVDARVSDERALARWGIAS 165
289 4.000e-74gi|515521923|ref|WP_016955177.1| hypothetical protein [Catenovulum agarivorans]  clstr ali  36  5..IKVQNNDFSVAEQYQQLIENNQQDGAVVFFVGLVRDFNQSIKSLTLEHYPAMTEKVLKQIVAQAREKWSLGRVAVVHRVGTMQLGEQIVFVGVTSQHRQAAFEAGQFIMDILKTQAPFWKKEQTEQGSHWVDAKESDQAQAQNW.... 150
290 4.000e-74gi|496588321|ref|WP_009286926.1| Molybdopterin biosynthesis MoaE [Halomonas titanicae]  clstr ali  48  9IKVTIQAAPFPMDYGYDDALAGRSDIGAVVSFTGLVRDFNEDVTGLTLEHYPGMTERTLTEIGEQAWQRWSLQAVRIIHRVGYLGPGDPIVRVLVASAHRREAFEACDFIMDYLKTQAPFWKKEHSAQGEYWVKERHSDQQDAARWE... 157
291 4.000e-74gi|493221343|ref|WP_006201583.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium amorphae]  clstr ali  46  9..VRIQREDFDVAAEIARLSEGRADIGAVVTFSGLCRDEQGRLSALELEHYPGMAEAEIARIASEAIERWPLHGLTVIHRHGKVRPGGNIVLVVTASAHRQAAFEAANFLMDYLKSRAPFWKKEHHADGSAWVDAKEIDDKAAGRWKAPS 158
292 4.000e-74gi|488369113|ref|WP_002438498.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Escherichia hermannii]  clstr ali  44  5.RIRVGHEGFSVGDEYQWL-ASCDEDGAVVTFTGKVRNHNESVSAMTLEHYPGMTEKALAEIVAEARQRWALQRVSVIHRIGELWPGDEIVFVGVTGAHRSQAFEAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDHQAAERW.... 150
293 4.000e-74gi|530669879|dbj|BAN68295.1| molybdopterin synthase catalytic subunit [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  42  4.RIAVQTEPFDLAEETARLSAGDATIGAVASFVGLVRGHNRDITTLILEHYPGMTEKALSRIVDAAAERWPLQAVTVIHRVGELRLGEPIVLVLTASAHRQAAFESCQFIMDILKTEAPFWKKERLPDGERWVDARESDSEAAARWLRD. 158
294 4.000e-74gi|503341713|ref|WP_013576374.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rahnella sp. Y9602]  clstr ali  44  6..IVVDAAPFSVGDEYNWL-AQSDADGAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALAEIVAKARTRWPLQRVSVYHRVGPMYPGDEIVFVGVTSAHRGMAFEANEFIMDHLKTRAPFWKREATEEGDRWVDARDSDKQAAARW.... 150
295 5.000e-74gi|500950031|ref|WP_012029605.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium sp. ORS 278]  clstr ali  42  5VTVRVQHEDFDTAAEIAALSHGRTDIGAVVSFSGLCRDHATPISALTLEHYPGMAEAEIMRHAEQAMARWPLQGLTVIHRFGRITPGENIVLVVTASSHRQAAFEAAEFLMDYLKTNAPFWKREETNDGGSWVEAKSHDDAAAARWTK.. 154
296 5.000e-74gi|496229439|ref|WP_008943474.1| molybdenum cofactor biosynthesis protein MoaE [Oceanibaculum indicum]  clstr ali  40  1.MIRVQREDFDIGAEIAALTDGNHAIGGVASFTGLVRDMAGGIGAMTLEHYPGMTEKALARIEAEAQERWPLQASLIIHRYGRLEPGDRIVLVVTASAHRQAAFDSAMFLMDYLKTQAPFWKLEETGEGAQWVDARESDDHALARW.... 147
297 5.000e-74gi|495335242|ref|WP_008059979.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. GM78]  clstr ali  38  1MTVRVQYKTFDTGQLIDRLRANDPGVGAVVNFVGYVRDINQGVTSLFLEHYPGMTERSLQKIIDNAKTRWPLKAVEIVHRIGQLSVSDPIVFVGVSSQHRQAAFDACAFIMDYLKTDAAFWKREDVASRARWVDARDSDRSAAGRWETVS 152
298 6.000e-74gi|655972127|ref|WP_029014713.1| molybdenum cofactor biosynthesis protein MoaE [Niveispirillum irakense]  clstr ali  44  1MAVRVQEADFDLGAELRALVAGNHAIGGLCSFVGLVRDLAGTVKALTLQHYPGMTEKQLAAIEAEARTRWPLADCLIIHRHGKMEPGEQIVLVACASAHREAAFEACQFLMDWLKTKAPFWKLEDTENGDRWVESRTADAQAAARW.... 153
299 6.000e-74gi|495523072|ref|WP_008247717.1| molybdenum cofactor biosynthesis protein MoaE [gamma proteobacterium BDW918]  clstr ali  41  5..VRVGEADFDVGAECRALASHSRQSGAIVQFVGLMRDSNDDVLTMELEHYPGMTERCITEIVNRAQQRWPLFAVTVIHRVGVLQPQDQIVFVGVSAAHRLDAFQSCEFIMDYLKTEAPFWKKECTLNGERWVDARQTDQQARKRWQ... 152
300 6.000e-74gi|517747006|ref|WP_018917214.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas zhanjiangensis]  clstr ali  45  3IRVYVQATPFALADGYEQVLAQRTDIGAVVSFTGLVRDFNEDVTGLTLEHYPGMTERTLESIGEQAWQRWSLQAVYIVHRVGYLTPGDPIVRVLVASAHRREAFEACDFIMDFLKTQAPFWKKEHSGQGEYWVKERTTDTQDAARW.... 150
301 6.000e-74gi|652803819|ref|WP_027099890.1| molybdenum cofactor biosynthesis protein MoaE [Comamonadaceae bacterium URHA0028]  clstr ali  40  5.RVAIQHEDFDVSAELAQLRAADHRVGAVCSFVGTVRAAAKPVLDMELEHYPGMTEKAIEAMVDEAQRRFDIFAARVVHRVGLLGPGEQIVFVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKERTPEGEHWVDARISDDAALARWGIQG 157
302 6.000e-74gi|703409091|ref|WP_033422832.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira halophila]  clstr ali  39  5..IRVQTDDFDLSHEVKALREGHKDIGAVVSFVGTVRDVNDDVAVLELEHYPGMTEKALENIRQKAHQRWPLQNSLIIHRVGEMRPCDQIVLVAVASRHREAAFEGAHFIMDFLKTHAPFWKKETLPDGTRWVDARLSDDEAKKKWLKAS 155
303 7.000e-74gi|589830241|gb|EXJ12661.1| Molybdopterin synthase catalytic subunit [Nitrincola sp. AK23]  clstr ali  36  14ITSRIQTQCFDISYEIEALHQGRTDIGALVSFLGYVRDFNEDVIALTLEHYPEMTEQALDEIQLNATQRWPLLGTRVIHRVGRLEPTDPIVLVLAVSSHRQHAFDACSFIIDQLKTQAPFWKKEHTASGDYWVSARYSDEHAAKRWN... 162
304 7.000e-74gi|492534362|ref|WP_005876201.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacter formigenes]  clstr ali  39  2ISIHVQTGDFDLTEEVNRLRSDRRDIGAVVSFLGTVRDGDETVLSMELEHYPGMTEQVLQEIAEEACRRWDVMDLAVIHRVGKLEPSDQIVLVAAGSRHRGEAFRACEYVIDQLKTRAPFWKKEETPEGSRWVAAKPDDETASRKW.... 149
305 7.000e-74gi|683406303|gb|KFZ30745.1| molybdopterin synthase catalytic subunit [Idiomarina salinarum]  clstr ali  39  4.RIQVQTTDFELSEEYQRLR-DNPACGAVVTFTGLVRELVQGLTGMTLEHYPGMTESALTDICQQAAQRWELGSITVIHRVGSLGLNDQIVFVGVAAAHRQAAFMAAEFIMDYLKTRAPFWKQEHTTAGSYWVDAKTKDQLAAARWHT.. 150
306 8.000e-74gi|661565595|emb|CDG21969.1| Molybdopterin synthase catalytic subunit [Xenorhabdus poinarii G6]  clstr ali  40  5.RINVQREVFHVGEEYQWLSQGDEE-GAIVTFTGKVRHHNDSVHSLTLEHYPGMTEKQLQNIVDEARQRWPLQRVSVIHRVGELYPGDEIVFVGVTSSHRHRAFMAAEFIMDYLKTQAPFWKKESLAEGERWVETRQSDQEAINRWSS.. 154
307 1.000e-73gi|518000315|ref|WP_019170523.1| molybdenum cofactor biosynthesis protein MoaE [Pseudaminobacter salicylatoxidans]  clstr ali  49  8..VRIQREDFDIQSEVARISDGRADIGAVVTFTGLCRDEAGRLSALELEHYPGMAEAEISRIAAEAVARWPLQGLTVIHRYGRIVPGENIVLVVAASAHRQAAFEAANFLMDYLKSRAPFWKKEHHADGTEWVEAREADDEALTRWRR.. 155
308 1.000e-73gi|656025851|ref|WP_029065093.1| molybdopterin synthase catalytic subunit [Labrenzia sp. DG1229]  clstr ali  46  9..VKVQTEDFDVRAESGLLTSGRKDVGALVSFTGLCRDEAGTLSALELEHYPGMAEGELTRIAEQAIERWPLTGLTVIHRHGKIPPGDNIVLVIAASSHRRAAFEAADFLMDYLKTRAPFWKKEHLAEGGTWVDAKTGDDKDAARW.... 154
309 1.000e-73gi|640486253|ref|WP_024926198.1| MULTISPECIES: molybdopterin synthase catalytic subunit [Mesorhizobium]  clstr ali  51  9..IKIQAQDFDIAAEIGELTAGRADIGAVVTFSGLCRDEAGALVALELEHYPGMAEAEIGRIAVEAIGRWPLQGLTVIHRHGRIRPGENIVLVVTASAHRLAAFEAANFLMDYLKSRAPFWKKEHRADGSDWVEAKDSDEAAAARW.... 154
310 1.000e-73gi|497409224|ref|WP_009723422.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. TD01]  clstr ali  43  11IAVRVQEEPFKMDDGYESLLRKRTDIGAIVTFTGLVRDFNEDVIGLTLEHYPGMTERTLTQIGEQAYQRWALQAVQIIHRIGDLTPGDPIVRVLVASAHRRDAFQACDFIMDFLKTQAPFWKKEHSRQGAYWVKERHTDQQAAERW.... 158
311 1.000e-73gi|497815607|ref|WP_010129763.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus sputorum]  clstr ali  37  6..IQVQEDNFDQNAIYQWLSAEH-SVGATTLFVGKVREMNDNVSGLYLEHYPAMTEKALQEIVAQARQRWDLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKRETTQEGERWIEGRESDQQAADKWE... 151
312 1.000e-73gi|495606615|ref|WP_008331194.1| molybdenum cofactor biosynthesis protein MoaE [Maritimibacter alkaliphilus]  clstr ali  47  3.MIRVQSEPFSLGDEAEAFAKGRTDTGAVVTFTGIVRD-TGGMARMEIEHYPGMTEKAISGIVDQAMDRWSLDDALVIHRYGSLAPGERIMMVATASRHRVAAFEAAEFLMDYLKSRAPFWKKEFGPDGAEWVAAKDEDEDALSRW.... 146
313 1.000e-73gi|499813836|ref|WP_011494570.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella denitrificans]  clstr ali  35  5VKIAVQEADFDHAQEYARIAQDN-NDGAVVTFCGKVRDFNEGITRLTLEHYPGMTESVLAQICQQALQRWSINHLTVIHRVGSLDLGEQIVFIGVSSAHRGDAFAACEYLIDFLKTKAPFWKLEATHQGERWLDARDTDEVAANTWQQG. 154
314 1.000e-73gi|495494509|ref|WP_008219168.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera nanhaiensis]  clstr ali  41  3IFVAVQSDDFCVASEYNELRRQS-GCGAIVTFSGLVRELSDNLHSMTLEHYPGMTEQALTAIAEQAQQRWQLGAVHLIHRVGTLKPHEQIVFVGIASPHRAAAFAACEFIMDYLKNRAPLWKKEHTSNGDYWVEAKTSDQHALTRWD... 149
315 1.000e-73gi|499513561|ref|WP_011200201.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [[Mannheimia] succiniciproducens]  clstr ali  35  15IKIAVQEAEFDQNSEYRWLSQSD-SVGASVIFVGKVRDLNDEVSSLYLEHYPAMTEKALNEIVDEAKSRWDIQRVVVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTKAPFWKKEKTDKGERWIESRDSDQQAAEKW.... 161
316 1.000e-73gi|635596009|dbj|BAO81166.1| molybdopterin converting factor, large subunit [Comamonadaceae bacterium A1]  clstr ali  44  11..VRIQTEDFDLSAEVAALHAADARVGAVAVFVGTVRDEGQALDCLELEHYPGMTERAIEDMVEQARQRFEIFGARVLHRVGRLGLGEQIVLVAVTAAHRGQAFQACEFLMDYLKTQAPFWKKEHGATGSRWVDARTSDDAALAKWGIAA 160
317 1.000e-73JCVI_PEP_1096671195973 /source_dna_id=JCVI_ORF_1096671195972 /offset=0 /translation_table=11 /length=172 /full_length=172  ali  44  26.RIIVSHDRFKVGDEYPWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAEIVEQARERWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTRAPFWKREATPEGERWVDARDSDREAAERW.... 171
318 1.000e-73gi|671421962|gb|KFF49771.1| molybdenum cofactor biosynthesis protein MoaE [Gammaproteobacteria bacterium MFB021]  clstr ali  43  3IDIRVQQAAFDAATMQQRLTAGRRDIGALVSFTGLVRDINEDVEALTLEHFPGMTEPALETIARDAGARWPLTGVGVVHRVGRLTPGDPIVLVMVTSAHRRAAFEACDFIMDRLKTRAPFWKKEHTASGDYWVSERQSDHDDAGRWER.. 152
319 1.000e-73gi|654839605|ref|WP_028292258.1| hypothetical protein [Oceanobacter kriegii]  clstr ali  39  9.RIQVQTADFSVDEEYQRLCCDNAADGAVVFFVGRVRDRNQGVSLLELEHYPGMTEKALQGIVDDARSRWQLGRVSVVHRVGPMNIEEQIVFVGVSSPHRGNAFEAAEYIMDYLKSRAPFWKKERILDEERWVDARDSDSAALERWE... 162
320 2.000e-73gi|501410404|ref|WP_012441970.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia tasmaniensis]  clstr ali  41  4.RIRVGDAPFSMGDEHRWLSASDLD-GAVVTFTGKVRNHNDDVNALTLEHYPGMTEKALAAIVAEARQRWAMQRVTIIHRIGELFPGDDIVLVGVSAVHRGAAFDAAEFIMDQLKTRAPFWKREATADGQRWVAARESDRHAAARWK... 150
321 2.000e-73gi|686651755|gb|KGB80616.1| molybdenum cofactor biosynthesis protein MoaE [Rhodovulum sp. NI22]  clstr ali  43  1MAVRVQHEPFDFGAEANAFAAGRSDAGAVVTFTGIVRDLARGLDRMEIEHYPGMTERALGGIEAEARARWDLRDCLIIHRFGTMVPGDMIMMVATASPHRADAFQAAEFLMDYLKSRAPFWKKEYTRDGALWVDSKDADEAALGRWAKG. 150
322 2.000e-73METAHIT V1 GL0111328 [Complete] locus=scaffold55032_4:6961:7416:+  ali  32  1VKISVQTEDFDVQKEYGELKA-NPHAGAVVMFVGNVRDINEGIEKMSLEHYPGMTEKSLTKIVKEAQERWHIQDATVIHRVGDLEINDQIVFVGVSGGHRGECFDACEFIIDYLKTEAPFWKKETIDGKGKWVDARESDDEAMSKWN... 148
323 2.000e-73gi|516541971|ref|WP_017929596.1| hypothetical protein [Loktanella hongkongensis]  clstr ali  47  1MKIRVQEAPFDAGAELDAFAHGRHEVGAVVSFTGIVRDRDGGLVHMQIEHYPGMTEKAITAIAETAKARWDLADLVVIHRFGTLPVGQPIMMVATAAPHRRAAFEAAEYLMDYLKSRAPFWKKEVTQAGEHWVEATPEDEDALSRW.... 146
324 2.000e-73JGI.Meta JGI_HUM.5609150 7002975176 C2680359__gene_119763 moaE protein [Human Tongue dorsum microbiome from visit number 2 of subject 159207311]  ali  36  6..IQVQEDNFDQNAIYQWLSAEH-SVGATTLFVGKVREMNDNVSGLYLEHYPAMTEKALQEIVAQARQRWDLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKRETTQEGERWIEGRESDQQAADKWELD. 153
325 2.000e-73gi|640622574|ref|WP_025050600.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter sp. NB-68]  clstr ali  47  1MRISVQESPFDLGKETAGFSAGRKDMGALVTFTGVVRDLGDPLQALEIEHYPGMTEAALTEIAEQAMARFSLGDALVIHRYGRLVPGEMIMMVATAAPHRNDAFDGAEFLMDYLKSRAPFWKREITATGADWVASKAEDEAALDRW.... 147
326 2.000e-73gi|508729531|emb|CCK75016.1| Molybdenum cofactor biosynthesis protein E [Oleispira antarctica RB-8]  clstr ali  34  1.MISVQNEDFDFANEYQQLRKRSLQSGAIVMFVGLVRDFSDNVSSMTLEHYPGMTENVLNGIAQQAEQRWPLDGVRIIHRVGELHAADQIVLVGVSSAHRIAAYEASQFIMDILKTEAPFWKKESTQDGERWVDAKNSDSQQAADWHTP. 155
327 2.000e-73gi|499148425|ref|WP_010861753.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Plesiomonas shigelloides]  clstr ali  39  7.RIRVSEDDFDIAAEYTWLNQDD-SCGAVVTFTGKVRNHSGSVNGLHLEHYPAMTDKALNDIISEARARWPLGRVSLIHRVGELGSGEQIVYVGVSSGHRLAAFAAAEFIMDYLKVRAPFWKKEQMPDGARWVEAKTSDQEAARRWQSE. 155
328 2.000e-73gi|640440327|ref|WP_024901232.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia andropogonis]  clstr ali  39  1MRIVVQEADFDTGQELTALRVAHPGAGAVVAFVGAVRDISGGVDMLELEHYPGMTERALADIVAQAARRWPFQGVTVIHRYGPLRPTDQIVLVAVASAHRGEAFSACEFIMDYLKTEAPFWKKEGTGGARRWVDARETDDHARSRWGGGG 153
329 2.000e-73JCVI_PEP_1096669731989 /source_dna_id=JCVI_ORF_1096669731988 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  40  1.MISVQTEDFNVAAEYTALRHQAGDAGAIVLFTGLVRDGSDRTQRLFLEHYPGMTEKQLEAISQQASKRWPLLGVRILHRVGELYPGDQIVLVATASRHRQAAFESADFIMDFLKSRAPFWKKQTSQSESRWIESRESDIDALKRWQE.. 157
330 3.000e-73gi|502478495|ref|WP_012801260.1| molybdenum cofactor biosynthesis protein MoaE [Kangiella koreensis]  clstr ali  44  1MLVKVQHEDFDLALVRDYFKQYGAEVGAVVTFTGLVRDFQERVEALTLEHYPGMTESVLTQLAEDAKSRWNLTGVVIIHRVGTLHPGDNIVLVATASAHRQDAFNSCQYIMDTLKTTAPFWKKEETDHGARWVEAKQSDHGEMDKWQASA 156
331 3.000e-73gi|657349872|ref|WP_029406552.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira sp. Milos-T2]  clstr ali  38  7..VKIQEEDFDLTSEVAALRKGHKDIGAVVSFVGTVRDINEGVSILELEHYPEMTEKALEKIRLEAHQRWELESSLIIHRIGKMYPTDQIVLVAVSSRHRENAFYASHFIMDYLKTNAPFWKKETFPDGERWVDARVTDKEAEKRWMK.. 155
332 4.000e-73gi|497056661|ref|WP_009450230.1| molybdenum cofactor biosynthesis protein MoaE [Nitratireductor indicus]  clstr ali  46  2...RVQQEDFDLSEEVAALTAGRRDVGAVVSFAGLCRDENGRLTALELEHYPGMAEAEISRIAAEALGRWPLTGLTVIHRFGKILPGGNIVLVVASSEHRRAAFEAADFLMDFLKSKAPFWKKEHTVDGTQWVTAKDSDEEDIKRWK... 147
333 4.000e-73gi|589087158|gb|AHK43914.1| putative molybdopterin converting factor subunit [Ensifer adhaerens OV14]  clstr ali  45  9VTVRVQREDFDLSAEVSKLSSGRPDIGAVVTFSGLCRDEAGTLTALELEHYPGMAEAEIERICRLAVERFGLQAATAIHRYGKINPGENIVLVITASPHRQAAFDGANFIMDFLKTSAPFWKKEHSSDGTAWVSAKDADDTARDRWKR.. 158
334 4.000e-73gi|494467368|ref|WP_007256868.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola granulosus]  clstr ali  46  1MSVRVQPEPFDAGAELNAFAARASGAGAVVTFTGLVRDISGGLAHMEIEHYPGMTERAISSIVAEATERFGLDAALVIHRHGRLAPAEPIMMVATAARHRGSAFEAAVFLMDYLKSRAPFWKKEVTADGAEWVAARDEDEAALSRW.... 146
335 5.000e-73gi|495525255|ref|WP_008249900.1| molybdenum cofactor biosynthesis protein MoaE [Limnobacter sp. MED105]  clstr ali  43  6..VLVQEADFDVTEEIRWLRQGLPEIGAVATFIGTVRDINENVSAMTLEHYPGMTEKALENILQVADARFDITSAMIIHRVGPLYPEDQIVFAAATSEHRQQAFLACEFMMDYLKTEAPFWKKEDTPEGSRWVSARDSDDSAKERWEQ.. 153
336 5.000e-73gi|518485731|ref|WP_019655938.1| molybdenum cofactor biosynthesis protein MoaE [Variovorax paradoxus]  clstr ali  40  5.RVSIQTNDFDLSREVAALRAGDKRVGAVCSFIGTVRDRNNTITSMELEHYPGMTEKAIEAMIDEAHRRFDILGARVIHRVGLLQPEDQIMMVAVVSAHRGQSFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGISA 183
337 5.000e-73gi|658428032|ref|WP_029654386.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter daepoensis]  clstr ali  40  1.MISIQTEDFCAGSEHQALRGAGPGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEQVIQGLIDEAGQRWDVQRARVIHRIGPLALSDQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITREGEHWVEQKEMDVARTQSWDQEA 151
338 5.000e-73gi|654384980|ref|WP_027863695.1| molybdenum cofactor biosynthesis protein MoaE [Massilia alkalitolerans]  clstr ali  42  1MPVRVQHEDFDLSTEIAALRAGQPGVGAVVAFVGTVREMNDAVSHMELEHYPGMTEAALEAIAQEASRRWPVADILVIHRIGALRGCDQIVLAAVAARHRGEAFAACEFVMDYLKTRAPFWKKEMRADGAHWVEARASDEAGMAKWHAGA 152
339 6.000e-73gi|655005413|ref|WP_028454567.1| hypothetical protein [Chitinilyticum litopenaei]  clstr ali  37  3VTIRVQEADFSLADEYA-LLAGRPEVGAVVAFVGLVRDVPGRLAGMTLEHYPGMTEKQLGKIVAQAGERWPLSAVTVIHRVGELKLSDQIVLLLTASAHRDAAYAASQFIMDWLKNDAPFWKKETTGEGAAWVEAKDSDAKALARWQQG. 150
340 6.000e-73gi|497590891|ref|WP_009905075.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia thailandensis]  clstr ali  44  3.TVRVQTDDFDVSAEIAALRARNPKVGAVACFVGTVRDLNEGVDALELEHYPGMTEKALAAIADDAIARWPGIDVAIVHRVGKLRPLDQIVFVATVSAHRGDAFQSCEFVMDYLKTQAPFWKKENTPAGERWVDARSADDAALARWGVES 153
341 6.000e-73gi|655389901|ref|WP_028793795.1| molybdenum cofactor biosynthesis protein MoaE [Thalassobaculum salexigens]  clstr ali  42  1MAVRVQEEDFDIGRELAALTAGNHAIGGLGVFVGLVRDIAGGVSAMSLEHYPGMTERQLEEIEREAHARWPLDASLIIHRVGDLAPGDNIVLVACASAHRQAALDATGFLIDWLKTRAPFWKREDTPDGARWVDAREADDTAAARWG... 149
342 6.000e-73gi|522079907|ref|WP_020591116.1| hypothetical protein [Kiloniella laminariae]  clstr ali  40  1.MIRVQSEDFDLALEVRKLTEGNPAIGAVTAFIGLVRDIAGDISSMTLEHYPGMTEKMLREIETEAHQRWELDASLIIHRYGQLAPGDQIVLVVTCSKHRQAAFESCEFLMDFLKTKAPFWKLEQTPEGGKWVDARDGDTEATERW.... 147
343 6.000e-73gi|655031187|ref|WP_028480010.1| molybdopterin synthase catalytic subunit [Nesiotobacter exalbescens]  clstr ali  49  9..ISVSASNFDVAAELEHLKAGRTDIGALVTFTGLCRDENGSLAALELEHYPGMAEAELQRLATSALERWPLTGLTIIHRVGRIRPGENIVLVVTASAHRRAAFEAADFLMDFLKTQAPFWKKEHPASGNEWVEAKSTDDTDAARW.... 154
344 6.000e-73gi|653031915|ref|WP_027283677.1| molybdenum cofactor biosynthesis protein MoaE [Rubritepida flocculans]  clstr ali  43  3.SIRVQEAPFDVAAEMAALTAGRTDIGALASFTGICR-VDDGLAAMVLEHYPAMTERALARIAEQAMARWPLTGCTVIHRVGRLTPGEPIVLVLTASAHRQAALEACAFLMDWLKTKAPFWKREEPREGPRWVEARESDEDAAARWTRTA 151
345 7.000e-73gi|628968315|gb|KCV80823.1| molybdopterin synthase subunit MoaE [Actibacterium atlanticum]  clstr ali  44  1MAVQVQKEAFDVGAEVNCFTAGCKDAGAVVSFTGIVRNNADGLQRMQIEHYPGMTEKALAGIEAQARDRWPLQDVLIIHRHGDLAPGEVIMMVATASKHRMAAFEAAEFLMDYLKSRAPFWKQEFTAQGSDWVAAKDVDEDALKRW.... 147
346 7.000e-73gi|495460069|ref|WP_008184761.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae bacterium HTCC2150]  clstr ali  42  1MGVRVQTDPFNAGAELKTFSSVQTNAGAVVTFTGIVRDLPDNLAFMEIEHYPGMTEKALEKICDTAIERWKLADALVIHRYGKLTAGEDIMMVATASKHRKDAFEAAEFLMDYLKSRAPFWKKEHAKDGADWVAQRSEDEDALNRW.... 147
347 7.000e-73JCVI_PEP_1096678544949 /source_dna_id=JCVI_ORF_1096678544948 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  36  5..VLIQNADFDFAYEYQSLLDNNNKDGAVVCFVGLVRDYNQGVSGLTLEHYPGMTEKALRDIVIKAKKRWPVGQVRVIHRIGELKLSEQIVFVGVTSKHREAAFAANQFIMDYLKNDAPFWKKEQTNKGDRWVEAEKKDLDAKNRWDHTS 154
348 9.000e-73gi|574575103|gb|ETW12178.1| molybdopterin converting factor subunit 2 [Roseivivax sp. 22II-s10s]  clstr ali  53  1MRIVVQEAPFDYGAECDGFATGRTDVGAVVTFAGLVRSDAD-LDRMEIEHYPGMTESALTAIAEEAARRWSLQDVLVIHRVGPMRPGERIMMVATAAPHRRDAFEAADYLMDYLKSRAPFWKKEHGPQGESWVEAKATDEDALSRW.... 145
349 9.000e-73gi|655851676|ref|WP_028958654.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter sp. 20_GPM-1509m]  clstr ali  49  1MRITVQEAAFDLGAETNAFAAGHTDMGAIVTFTGVVRDLDDPLVAMEIEHYPGMTEAALTDIATRAQERWHLGDVLVIHRYGRMAPGEAIMMVATAAPHRRDAFEAAEYLMDFLKSRAPFWKREITANGSEWVEAKDTDEDALSRW.... 148
350 1.000e-72METAHIT MH0016 GL0013392 [Complete] locus=scaffold79696_1:5117:5572:-  ali  37  7..IRVSHDDFDVSEEIAALEREGRNAGAVVTFTGVVRS-DDGVTAMHLEHYPEMTEKSLAQIVEKARARWNIEDVVIIHRVGELKAGDRIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKEVTAQGGRWVDARESDEIAKNRWGK.. 151
351 1.000e-72gi|497824569|ref|WP_010138725.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola sp. S124]  clstr ali  47  7..IRVQSAPFDPGAELSAFTAARAGCGAVVSFTGLVRDLSGGLSAMEIEHYPGMTEKALAGIAADASGRWDLGPVLILHRYGRLGAEEPIMMVATASRHRRAAFEAADFLMDYLKSRAPFWKKESTDAGASWVAAKDEDEDALSRW.... 152
352 1.000e-72gi|499900579|ref|WP_011581313.1| molybdenum cofactor biosynthesis protein MoaE [Chelativorans sp. BNC1]  clstr ali  47  7..IRVQAEDFDLAVEIDRLTDGRRDVGAVVTFTGKCRDEGGRLAALELEHYPGMAEAEMTRIARQAAERWQLSGLTVVHRYGKIRPGENIVLVVTASSHRKAALEAADFLMDYLKSRAPFWKKEHLTDAGQWVEAKAEDENALERWKK.. 154
353 1.000e-72gi|490716439|ref|WP_004579004.1| molybdenum cofactor biosynthesis protein E [Marinobacter nanhaiticus]  clstr ali  38  1.MIRIQTEDFDVGTEIAALE-NNGRSGAIATFTGLVRNRGDDVAALFLEHYPGMTENVIADLIDQARGRWTIDDARVIHRVGHLPLGDRIVFVGVSSAHRQDAFAACEFIMDALKTSAPFWKKEITADGEHWVEQKDSDREKAKGWGNG. 150
354 1.000e-72gi|647626210|ref|WP_025899732.1| molybdenum cofactor biosynthesis protein MoaE [Sneathiella glossodoripedis]  clstr ali  39  1.MVIVQQEIFDSGAVIADVAGQSTDIGAVVSFTGYVRDFNDGVKSLTLEHYPGMTEKQLEKIEQEARSRWKLTDCRIIHRFGTMELGEPIVLVVTASAHRQDAFEAAAFLMDWLKTKAPFWKLEETAQGERWVKERQSDLDAANKWK... 149
355 1.000e-72gi|655488886|ref|WP_028870385.1| molybdenum cofactor biosynthesis protein MoaE [Psychromonas arctica]  clstr ali  36  1.MISVQELDFNQQVEYDRL-KSTTKIGAIVTFTGLVRDINEGVSDLALEHYPGMTEKCLQDIVQQAQQRWNIIDFTIIHRVGQLTISDQIVFVGIASQHRGDAFAACEFIMDYLKTQAPFWKKETMANGEKWVDAREHDQHALTKWQS.. 149
356 1.000e-72gi|656019204|ref|WP_029059078.1| molybdopterin synthase catalytic subunit [Stappia stellulata]  clstr ali  43  1MTVRIQLEDFDTAREIERLSETGANVGAVVSFTGLCRDENGRLSALELEHYPGMAEAEIGRIARDAAARWPITGLTAIHRHGRIAPGENIVLVVAASRHRAAAFQAADFLMDYLKTRAPFWKKEHLRDGGSWVDAREADTRAADRWSR.. 150
357 1.000e-72T2D.3778170 [EC:2.8.1.12][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  36  4IQISVQEQPFDQNAVYQWLSEQH-SVGATVIFVGKVRDLNDEVSSLYLEHYPAMTEKALREIVEQAKARWDIQRVSVIHRVGLLHTGDEIVLVGISSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALNKW.... 150
358 1.000e-72gi|655038671|ref|WP_028487428.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira chilensis]  clstr ali  37  7..IKIQQEDFDLSTEIARLREGHADIGAVVSFVGTVRDINEGVAVLELEHYPGMTEKALEKIRLEAHERWALESSVIIHRIGKMYPTDQIVLVAVSSRHRENAFYASHFIMDYLKTNAPFWKKETLPNGERWVDARLSDKDAEKRWK... 154
359 1.000e-72gi|493339868|ref|WP_006296783.1| molybdenum cofactor biosynthesis protein MoaE [Hylemonella gracilis]  clstr ali  40  5.RVSIQTNDFNVAAEIAALRARDARVGAVCSFIGTVRDRNEGVSAMELEHYPGMTEQAIEGMIDEALQRFDIYAARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPQGARWVDARVSDDEALARWGISA 184
360 1.000e-72gi|653085499|ref|WP_027335875.1| molybdenum cofactor biosynthesis protein E [Halomonas sp. HL-48]  clstr ali  45  3ITIRVQAAPFDMAFGYEDSIAGRTDIGGIVSFTGLVRDFNEDVTGLTLEHYPGMTEATLQQIAEQAGERWSLNAVTIIHRVGYMRPGDAIVRVLVASAHRREAFEACDFIMDWLKTQAPFWKKEHGRQGDYWVKERRSDIDDAARW.... 150
361 1.000e-72gi|494185546|ref|WP_007118937.1| molybdenum cofactor biosynthesis protein MoaE [Oceanibulbus indolifex]  clstr ali  45  1MRVLVQEAPFDLAEETARFAKGEGGSGAIVTFTGVVRDNGAGLSAMEIEHYPGMTEKALCEIAEQAMARFELQDALVIHRYGRLVPGEQIMMVASAARHRRSAFEAAEFLMDYLKSRAPFWKREITAEGEAWVAAKDEDEAALERW.... 147
362 1.000e-72gi|497287652|ref|WP_009601869.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio caribbeanicus]  clstr ali  40  3IKVSVQVEDFSVSYEHQCLSEGS-HSGAVVTFCGNVRDMNLGIKGLTLEHYPGMTEKIINHICSEAISRWSIEKIRVVHRVGELNVGEQIVFVGVASGHRREAFSACEFIMDNLKTRAPFWKKERTTDSTRWIDARSSDSDAVLRWDK.. 151
363 2.000e-72gi|542099246|ref|WP_021015415.1| molybdopterin biosynthesis MoaE protein [Serratia sp. ATCC 39006]  clstr ali  44  5.RIHVGEAGFNVGEEYNWL-AQCDEDGAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALADIVAEARSRWPLQRVSVIHRIGAFYPGDEIVFVGVTGAHRSTAFDAAQFIMDYLKTRAPFWKREATPEGDRWIESHDSDKQAAERW.... 150
364 2.000e-72gi|652343366|ref|WP_026740563.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Lonsdalea quercina]  clstr ali  42  5.RIRVGEAAFSVGDEYAWLAACD-EDGAVVTFTGKVRNHNENVSALTLEHYPGMTEKALAEIVEEARERWPLQRISVVHRIGALYPGDEIVFVGVTGAHRGAAFDAAEFIMDQLKTRAPFWKRESTDEGERWXASRDSDRLAAKRWTR.. 152
365 2.000e-72gi|654396465|ref|WP_027872543.1| molybdenum cofactor biosynthesis protein MoaE [Melitea salexigens]  clstr ali  40  1MKVLVQVEDFDAGAEVAQLR--STASGAIVQFVGVMRDNNQGVASMHLEHYPGMTESSIERILVEASERWSLLGCTVIHRVGTVLPGEQIVLVAVSAAHRHAAFQACEFVMDYLKTQAPFWKKEQLHNGERWVDARESDDRAAARW.... 147
366 2.000e-72gi|653402919|gb|KEA51831.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Mangrovibacter sp. MFB070]  clstr ali  42  6.RIGVGHGNIDVGAEYQWLAACD-DDGAVVTFTGKVRNHNDNVSALCLEHYPGMTEKALEEIVATARERWPLQRVTVLHRIGEMYPGEEIVFVGVTGAHRSSAFAAAEFIMDYLKTRAPFWKRESTEQGARWVEARESDKVAAERW.... 151
367 2.000e-72gi|655493052|ref|WP_028874459.1| molybdenum cofactor biosynthesis protein MoaE [Tepidiphilus margaritifer]  clstr ali  41  3.TVRVQVEDFDAGAEGERLQRVSPEVGAVVSFVGTVR--GGEVRAMTLEHYPGMTEKSLEALVEEARRRWSLVAATVIHRVGRLMPGERIVFVGVASRHRSEAFAACEFLIDRLKTEAPFWKKEETNDSTRWVEAKEGDEARARRW.... 145
368 2.000e-72gi|517138569|ref|WP_018327387.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobium giardinii]  clstr ali  43  6VTVRVQRDDFDLAAEVRALSASRHDIGAVVTFSGLCRDEAGTLSALELEHYPGMAEAEIARICRQAIDRFGLQAATAIHRYGKILPGENIVLVVTASPHRQAAFDGANFIMDFLKTSAPFWKKEHATDGSAWVSAKDADDGARDRWSK.. 155
369 2.000e-72gi|505310883|ref|WP_015497985.1| molybdopterin-converting factor subunit MoaE [Octadecabacter antarcticus]  clstr ali  41  1.MIRVQAMPFDPGGELNVFSASVAGAGAIVSFTGVVRDVAGGLSGMEIEHYPGMTEKALSAIRGEAMQRWDLADALVIHRIGQLEAHESIMMVATASQHRKSAFEAAEFLMDYLKSRAPFWKKEITLDGSDWVDSKAEDEDALSRW.... 145
370 2.000e-72gi|495445205|ref|WP_008169899.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter manganoxydans]  clstr ali  36  1.MISVQSEDFDVAEEYAALRDSGAGTGAIATFTGLVRDSGDGVTGLYLEHYPGMTEQVIQGLIDDASKRWDVREARVIHRVGRLALCDQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEIASDGEHWVEQKESDLARSEGWE... 148
371 3.000e-72gi|544803740|ref|WP_021220895.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas alcaligenes]  clstr ali  46  1MGIRVQATAFDPGTELNALHAANVGVGAVVGFVGYVRDFNEGVSGMFLEHYPGMTEKALEKIAEEARQRWPLLKVDILHRIGRLEPGEPIVFVGTASAHRQAAFDACNFIMDYLKTRAPFWKKEDTAEGPRWVEGRCSDQAAAQRWEGD. 151
372 3.000e-72gi|517166714|ref|WP_018355532.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pasteurella pneumotropica]  clstr ali  36  4INISVQEAEFDQNEVYQWLSAQH-SVGAVVIFVGKVRDLNDDVSSLYLEHYPAMTEKALREIVFEAKQRWDIQRVAVIHRVGLLHTGDEIVLVGVSSAHRGNAYQANEFIMDYLKSKAPFWKKEQTKKGERWIESQDSDKKALEKW.... 150
373 3.000e-72JCVI_PEP_1096666532085 /source_dna_id=JCVI_ORF_1096666532084 /offset=0 /translation_table=11 /length=179 /full_length=179  ali  35  28.RLRIQTEDFDLATEYQFLRQPSSSVGAVVTFTGLVRDFEGSIDSLSLQHYPGMTEKLLQEIVDQANSRWNLIGTTVIHRVGKLLPCDQIVFVGVASQHRADAFEAAQFIMDYLKTKATFWKKVDQDGQQHWVESKDSDQAASQRWTTD. 177
374 3.000e-72gi|646612159|ref|WP_025563127.1| molybdenum cofactor biosynthesis protein MoaE [Psychromonas sp. SP041]  clstr ali  35  1.MISVQEQDFNQQEEYDRL-KCKTSVGAIVTFTGLVRDINNGVSDLSLEHYPGMTEKCLIDIVEQAKQRWNIIESTVIHRVGHLAISDQIVFVGIASQHRGDAFAACEFIMDYLKTQAPFWKKETMSNGEQWVDAREVDQDALSKW.... 147
375 3.000e-72gi|548225197|ref|WP_022444148.1| molybdopterin biosynthesis MoaE protein [Sutterella sp. CAG:351]  clstr ali  41  6..VIVRHEDFDVSREMEELRKGSGSAGAMVAFTGVVRNRNDDIFALTLEHYPGMTESAITAIADKARARWELDDIVVIHRVGRLEVGDQIVLCLVTSAHRGEAFEACEYIMDWLKTEAPFWKKEETPSGSRWVDARESDEKAKARWQ... 152
376 3.000e-72gi|654531879|ref|WP_027999968.1| molybdopterin synthase catalytic subunit [Sinorhizobium arboris]  clstr ali  44  5ITVRVQRDNFDIAAEVSALCRGRTDIGAVVTFSGLCRDEAGALSALELEHYPGMAEAEMERICREAIERFRLQAATAIHRFGRMAPGENIVLVITASPHRQAAFDGANFIMDFLKTSAPFWKKEHHADGSAWVSAKDADDAARGRWTRG. 155
377 3.000e-72gi|550980096|ref|WP_022728204.1| molybdenum cofactor biosynthesis protein MoaE [Fodinicurvata sediminis]  clstr ali  39  1MTVRIQEEDFDPGSELEKLTGGQTAIGGVTSFIGLVRDMAGDVTGMTLEHYPGMTEKMLERIEAEAHERWPLNASLIIHRVGPLEAGDRIVMVATASAHRQATFDSCHFLIDWLKTKAPFWKAERTREGQEWVEARESDDEASERWNR.. 151
378 3.000e-72gi|490450177|ref|WP_004321067.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Thauera]  clstr ali  44  12..VSVQHEDFDVGGEIARLGEGRRDVGAVASFVGLVRDANDGVRAMTLEHYPGMTERALEEIVEQAKARWSLLSVRVIHRYGRLEPADRIVFVGVTSAHRGEAFAACEFIMDYLKTRAPFWKCEETPQGARWVDARESDD.......... 151
379 4.000e-72gi|501020732|ref|WP_012073403.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Actinobacillus succinogenes]  clstr ali  34  4IRIAVQEAEFDQNAEYRWLSENH-SIGATTIFVGKVREMNDEVASLYLEHYPAMTEKALREIVEEAKQRWDIQRISVIHRVGLLQTGDPIVLVGVSSAHRGDAYAANEFIMDYLKTRAPFWKKEQTAQGERWLESRDSDHQAVGKWSRE. 153
380 4.000e-72gi|506352194|ref|WP_015871913.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Edwardsiella ictaluri]  clstr ali  43  6..IVVSAAPFSVAEQYQWL-AQRDEDGAVVTFSGKVRNHNDDVSALTLEHYPGMTEKALAEIVALARRRWPLGRIAVYHRVGPMFPGEEIVFVGVTSAHRGMAFEAAEFIMDYLKTRAPFWKRETSEGADRWVDARDSDRQAAERW.... 150
381 4.000e-72gi|517744099|ref|WP_018914307.1| hypothetical protein [Thiomonas sp. FB-6]  clstr ali  41  4..VRIQTEAFDAGAESRRLRAGRIDIGALVVFEGICRDHAEGVQSLELEHYPEMTRASIERMVGQARVRWPLQGAVVVHRVGLLHPGDPIVLVVVASSHRHDAFEACAFLMDYLKTQAPLWKKEATPQGAQWVDAREADDEALARWGIES 154
382 4.000e-72JCVI_PEP_1096681330255 /source_dna_id=JCVI_ORF_1096681330254 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  36  1.MISVQRDDFDHCEQYQALKEEADGDGAVVTFTGLVRDFNGAVSGIHIEHYPGMTEKSLMHICSEARKRWQLGQIRVIHRVGTIGPQEQIVFVGVTSKHRKNAFEACEFIIDYLKTSAPLWKQEGTSEGMKWVTSRSSDQEAMDRWANTA 151
383 4.000e-72gi|692342821|gb|AIS16437.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas rhizosphaerae]  clstr ali  46  1MSVRVQHEPFDPGSELNALHQANTGVGAVVGFVGYVRDFNDGVRGMLLEHYPGMTEKALDKIVFEAAQRWPLLRLEILHRVGALEPGEPIVFVGVASAHRQAAFQACDFVMDYLKTRAPFWKKENTEDGPRWVQGRESDEQAAQRWE... 149
384 5.000e-72gi|495149543|ref|WP_007874350.1| molybdopterin (MPT) converting factor, subunit 2 [Ochrobactrum sp. CDB2]  clstr ali  43  11..VSVRSEDFDVAEEIHKLGEGRKDIGAIVTFTGLCRDEGGKLSALELEHYPGMAEAEIRRIVDEAISRWPLSGISIIHRYGLVKPGENIVLVVTASAHRQAAFEAASFLMDFMKTGAPFWKREHLIDGGSWVESKAEDDQSRERWQK.. 158
385 5.000e-72gi|518504281|ref|WP_019674488.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera perlucida]  clstr ali  43  3IFVAVQSDDFCLASEYSELRR-NAACGAIVTFSGLVRELHDTVHGMTLEHYPGMTEQALTQIATDALNHWQLAAVHVIHRVGRLKPNEQIVFVGVASAHRPAAFAACEFIMDYLKNRAPFWKKEHTAEGDYWVEAKASDQHALARWE... 149
386 5.000e-72gi|652362093|ref|WP_026758213.1| molybdenum cofactor biosynthesis protein MoaE [Sediminimonas qiaohouensis]  clstr ali  44  1MTIRVQEQPFDLGEEANAFADAQDDAGAVVTFTGIVRDGGAGLDRMVIEHYPGMTEKALGQIAADARTRWELADVLIIHRYGEMRAGERIMMVAAAARHRKNAFDAAEFLMDYLKSRAPFWKKEHTTDGGDWVAARDEDEDALKRW.... 148
387 5.000e-72gi|647629902|ref|WP_025902916.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Tatumella sp. UCD-D_suzukii]  clstr ali  39  6.MIRVGEAPFSLADVYQWLSASD-EDGAIVTFTGKVRNHNAGIATLTLEHYPAMTDKVLHDIATRARERWPLQQVAIIHRVGCLAPGDEIVLVGVSSAHRSSAFAAASYIMDILKTQAPFWKREATAQGDRWVSSRESDEQAAKRWEDP. 154
388 5.000e-72gi|654633724|ref|WP_028097821.1| molybdenum cofactor biosynthesis protein MoaE [Dongia sp. URHE0060]  clstr ali  41  1MTVRVQTEDFDIGAELEQLSTGNHQVGGVASFVGLVRDGSGASSSMTLEHYPGMTEKRLAAIETEAQRRWPLAAVLIIHRYGRLEPGDRIVLVATASSHREAALESCAFLIDWLKTEAPFWKLEEGPEGPRWVEAKGSDDDRKAAWKKK. 153
389 5.000e-72gi|653000343|ref|WP_027252547.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium halotolerans]  clstr ali  39  4.RIVVGPKPFDTQAEYNWL-AGDDQDGAVVTFHGKVRNLGDDVSKLALEHYPGMTEKALRDIIEQARQRWTLNRVTIIHRVGELGAGEDIVMVGVSSAHRNNAFAAAEFMMDILKTQAPFWKRESTPDGERWLDARDSDHQAVKRW.... 149
390 5.000e-72gi|653079650|ref|WP_027330233.1| hypothetical protein [Marinimicrobium agarilyticum]  clstr ali  40  1.MISVQREPFDVAHEYKQLTGGDVESGAAVFFVGRVRARNDGVSGLSLEHYPGMTEKALEAIVSDARERWPLERVRVIHRVGPMALGEEIVFVGVTSSHRDASFQAAEFIMDYLKNRAPFWKQEQTEEGPTWVEAKAKDHEALGRWQ... 148
391 6.000e-72JGI.Meta JGI_HUM.0554194 7070023873 SRS047634_LANL_scaffold_56701__gene_65197 moaE protein [Human Supragingival plaque microbiome from visit number 2 of sub  ali  36  10..IAVQEQPFDQNAVYLWLSESH-SVGASVIFVGKVRDLNDGVSSLYLEHYPAMTAKALRDIVTEAKSRWDIQRVAVIHRIGLLHTGDEIVLVGVSSAHRGDAYSANEFIMDYLKTKAPFWKKEQTDKGERWIESRDSDKQAADKW.... 154
392 6.000e-72gi|522834206|ref|WP_020746788.1| molybdenum cofactor biosynthesis protein E [Alteromonas macleodii]  clstr ali  36  1.MISVQRGDFDHCEQYQALKEEADGDGAVVTFTGLVRDFNGAVSGIHIEHYPGMTEKSLMHICSEARKRWQLGQIRVIHRVGTIGPQEQIVFVGVTSKHRKNAFEACEFIIDYLKTSAPLWKQEGTSEGMKWVTSRSSDQEAMDRWANTA 151
393 6.000e-72gi|502737286|ref|WP_012972270.1| molybdenum cofactor biosynthesis protein MoaE [Allochromatium vinosum]  clstr ali  38  4..IRIQTEPFDIRAEQEALFQDNPRVGALVTFVGLMRDLNEGVARMMLEHYPGMTEKALSALVAEAGERWDLEGIRLVHRVGTLEPLDPIVFVGVVSQHRGDSFRACEFLIDALKTRAPFWKKELTETGERWVEERATDLEAARRW.... 149
394 7.000e-72gi|491430314|ref|WP_005288109.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Edwardsiella tarda]  clstr ali  41  5.RIVVNTAHFAVADEYSWL-AQCDEDGAVVTFTGKVRNHNDDVSALTLEHYPGMTEKALAQIVEQARARWPLGRVSVYHRIGPMQPGEEIVFVGVTSAHRGMAFQAAEFIMDYLKTRAPFWKREASNGHERWVDARDSDRQAAERW.... 150
395 7.000e-72gi|672865470|gb|KFI08329.1| molybdenum cofactor biosynthesis protein MoaE [Massilia sp. BSC265]  clstr ali  40  1MQVRVQREDFDLSTEIAELRAGQRDIGAVLAFVGTVREMNGAVSHMELEHYPGMTEAALKAIAIEASQRWSITDILVIHRIGSLQACDQIVLTAVAARHRGEAFAACEFVMDYLKTKAPFWKKETTERGAQWVEARASDEASLAKWHTTA 152
396 7.000e-72JGI.Meta JGI_HUM.4755234 7071923912 C5470264__gene_149455 moaE protein [Human Stool microbiome from visit number 2 of subject 764002286]  ali  39  10..IRVGEADFSLDEELSRIMRESPSAGGVASFVGLVRNKNDGVSRMTLEHYPGMTEKSLAKIAAAARERFHLVDVIVVHRVGELKVGDRIVLCLTSAEHRGDAFAGCEYIMDWLKTEAPFWKKEQTPDGERWVDARESDDKARERW.... 155
397 8.000e-72gi|503148712|ref|WP_013383373.1| molybdenum cofactor biosynthesis protein MoaE [Ketogulonicigenium vulgare]  clstr ali  48  1MDIRVTEQPFDGGAELNAFSARVAGAGAVVTFNGVVRDVPGSLQMLEVEHYPGMTELALREAAAQAITRWSLVDVLIIHRYGRLSAGEQIMMVATAAPHRLGAFEAAEFLMDYLKSRAPFWKKEVTADGEAWVEARCSDEEALKRWS... 147
398 8.000e-72gi|491889064|ref|WP_005654170.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus influenzae]  clstr ali  36  4IQIAVQEQSFDQNAVYQWLSELH-SVGATVIFVGKVRDLNDAVSSLYLEHYPAMTEKALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALEKW.... 150
399 8.000e-72gi|691202513|gb|KGF63508.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas lutea]  clstr ali  45  1MSVRVQAAAFDPGAEVNAMHDANVGVGAVVSFVGYVRDFNDGVAGMFLEHYPGMTEKALLKIVDEARQRWPLLKLEVIHRVGELEPGEPIVFVAAASAHRQAAFESCDFVMDYLKTRAPFWKKESTAQGPRWVEGRDSDHKAADRWK... 149
400 9.000e-72gi|692294329|ref|WP_032115349.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Arsenophonus endosymbiont of Nilaparvata lugens]  clstr ali  41  5.RLLIQQANFNVGEQYEWL-AQCYDDGAVVTFTGKVRNHNDSINTLTLEHYPVMTEKALQDIANEARGRWQLQRICIIHRIGTLQPGEEIVFVGVTSDHRSSAFLAAEFIMDYMKTKAPFWKKEHLAQGSRWVEARASDQAAFQRW.... 152
401 9.000e-72gi|692175163|ref|WP_032093858.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Necropsobacter rosorum]  clstr ali  38  6..IAVQPQPFDQNAVYQWLAAPD-SVGAAVVFVGKVRDLNDPVSTLYLEHYPAMTEKALKDIVAQAKRRWTIQRVSVIHRVGLLHTGDEIVLVGVSAAHRGDAYHANEFIMDYLKSNAPFWKKERTDKGERWIEQRKSDNDALKKWQQ.. 152
402 9.000e-72gi|494263908|ref|WP_007153551.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter algicola]  clstr ali  40  1.MIRVQQQDFDPAEEYRALRNSGSGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEQVIEGLVLEASRRWDVRDARIIHRVGSLALADQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITGDTEHWVEQKAADLDRTQSWD... 148
403 9.000e-72gi|518928701|ref|WP_020084576.1| hypothetical protein [Hyphomicrobium zavarzinii]  clstr ali  42  1MAVRVQREAFDVAEEIRLLTDRRTDVGGIVTFTGLVRGEAGGLQTLTLEHYPGMTELELGRIDDEARERFGLTGSLVVHRFGELKPGDPIVLVITLSAHRRAAFEAAEFLMDYLKSRAPFWKKESFADGTEWVDERASDGAALARWTGAS 153
404 1.000e-71gi|494065601|ref|WP_007007671.1| molybdenum cofactor biosynthesis protein MoaE [Nitratireductor aquibiodomus]  clstr ali  49  9..VRVQAGDFDLATEARRLTDGRRDVGAVVSFTGLCRDEDGRLEALELEHYPGMAEAEIGRIADEAAQRWPLSGLTVIHRFGRIAPGENIVLVVAASAHRRAAFEAADFLMDYLKSRAPFWKKEHAAGETEWVEAKDRDQEDMKRWER.. 156
405 1.000e-71gi|491992601|ref|WP_005709952.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus paraphrohaemolyticus]  clstr ali  35  6..VKVQTEPFDQNEVYHWLSE-HHSVGATTIFVGKVREMNDDVSGLYLEHYPAMTEKSLHEIVEEARSRWELQRIAVIHRIGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTNHGERWIEGRDSDQQAAVKW.... 150
406 1.000e-71gi|501088948|ref|WP_012139194.1| molybdenum cofactor biosynthesis protein E [Marinobacter lipolyticus]  clstr ali  37  4.SVSVQQEDFDVATEYRALRGSDAGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTERVIEDLIEQAAERWDVRKARVLHRVGELALCDQIVFVGVCSAHRGDAFAACAFIMDALKTSAPFWKKEITESGEHWVEQKDADLARSQGWE... 151
407 1.000e-71gi|518796256|ref|WP_019952210.1| hypothetical protein [Kushneria aurantia]  clstr ali  41  1.MIIIQQQPFDIGELHERVAGESTSLGAVVSFIGRVRDFNEDVQALTLEHYPGMTEKALGSIVEQAQSRWRIERALVVHRIGYMVPGDNIVAVLTASSHRQDAFDACAFIMDYLKIRAPFWKKEHTASGAYWVRERGSDLASLSRWEQ.. 149
408 1.000e-71gi|518126945|ref|WP_019297153.1| molybdenum cofactor biosynthesis protein MoaE [Phaeobacter gallaeciensis]  clstr ali  48  1MRISVQEAPFELGAESDAFAAGVNNAGALVTFTGVVRDADGGLQAMEIEHYPGMTEKALTAIAEEAMSRWSLADALVIHRHGRLAPGERIMMVATAARHRKDAFEAAEYLMDYLKSRAPFWKKEILSGGSAWVAAKDTDEDALKRW.... 148
409 1.000e-71METAHIT MH0068 GL0004978 [Complete] locus=scaffold10735_12:6632:7087:+  ali  37  5.TIRVGEADFSVSDELAKL-NDQADCGAVVSFLGVVRRANEGVYAMTLEHYSAMTEKALAGIVERARARWQLGDITVIHRVGRLLPGDQIVLVAVAASHRGEAFQACEFIMDWLKTEAPFWKKEETPDGARWVDARVSDDEAKRRWE... 151
410 1.000e-71JCVI_PEP_1096684705035 /source_dna_id=JCVI_ORF_1096684705034 /offset=0 /translation_table=11 /length=161 /full_length=161  ali  38  1MSVRVQTEDFDVGVESRALQADS--VGGIALFVGTVRGLDNGVTAMTLEHYPGMTEGELERIEADAMDRWPLERVTIIHRVGRLLAGEQIVLVATASAHRQAAFDAAQFIMDFLKTDAPFWKAEERDGKTSWVEARDSDTAARDKWHDDS 150
411 1.000e-71gi|654381077|ref|WP_027859817.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacterium jannaschii]  clstr ali  41  6..VLVQSENFDTGALTEQLRCDDARSGAVVTFTGIVRELDHSLKGLYLEHYPGMTEKALEKIVAQARERWELGNVIVLHRVGRMALNENIVFVGVASAHRKNAFEASQFIMDYLKRDAPFWKKEITAQGESWVDQKATDLSAAESWKS.. 153
412 1.000e-71gi|659667736|emb|CDG48749.1| Molybdopterin synthase catalytic subunit [Serratia symbiotica SCt-VLC]  clstr ali  42  5.RIRVGEAPFSIGDEYQWL-AQRDDDGAVVTFIGKVRNHNLGVSALTLEHYPGMSEKALAEIVAQARGRWPLQRVTVIHRVGVLFPGDEIVFVGVTSAHRNMAFAANAFIMDDLKTRAPFWKCETTSQGDRWVDARASDHRAAGSWRRG. 153
413 2.000e-71gi|653063604|ref|WP_027314919.1| molybdopterin synthase catalytic subunit [Microvirga flocculans]  clstr ali  45  4.TIRIQAEPFDTAAETASLTGGRADIGAVVAFTGLCRDEGGRLAALELEHYPGMAEAEIGRIAAQAETRWPLLGLTIVHRFGRILPGDEIVLVLAASAHRQAAFEAAAFLMDYLKTHAPFWKREHLKDGTVWVEAKEADDRATERWG... 151
414 2.000e-71gi|497491553|ref|WP_009805751.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola batsensis]  clstr ali  53  1MKVAVQEAAFDLGAEANAFAAGHREMGAVVTFSGLVRA-DGGLAALEIEHYPGMTEKAIRTIAEEARDRWSLGDVLVIHRHGRLEPGEAIMMVATAAPHRRDAFEAAEFLMDYLKSRAPFWKKEIGAEGTAWVAAKDEDEAALGRW.... 145
415 2.000e-71gi|506247936|ref|WP_015767711.1| molybdenum cofactor biosynthesis protein MoaE [Candidatus Accumulibacter phosphatis]  clstr ali  43  1MVVRVQEADFDVGAELAALRGKDPQIGALASFVGLVRELNDGVSELTLEHYPGMTERALQAIVSEACRRWAIIDALVIHRVGRLLPTDQIVLVAVAGAHRGDAFAACQFIMDYLKTRAPFWKRELTPEGARWVAAHAADDEAAERWQT.. 150
416 2.000e-71gi|499889404|ref|WP_011570138.1| molybdenum cofactor biosynthesis protein MoaE [Roseobacter denitrificans]  clstr ali  46  1MRVVVQDAPFDFGHEAQAFARGHTSMGAIVTFTGVVRDTNEALEAMEIEHYPGMTEAALTDIAEQAISRWSLGNALVIHRHGRLVPGEMIMMVATAARHRKDAFEAAEFLMDYLKSRAPFWKREITSQGASWVAARDEDEAALERW.... 147
417 2.000e-71gi|493005383|ref|WP_006086549.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella baltica]  clstr ali  38  7..VRVQEVDFSVADEYRQLAQDDSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTEAVLEQIVVEARSRWPLNKVTVIHRVGTMALGEQIVFIGVTSAHRKGAFAACEFLIDFLKTKAPFWKLEAGEQGKSWVEAKDADEQAAELWQ... 152
418 2.000e-71JCVI_PEP_1096666341427 /source_dna_id=JCVI_ORF_1096666341426 /offset=0 /translation_table=11 /length=153 /full_length=153  ali  33  4..IIVQSEDFDITTEVALAKASNSNIGAIVSFVGTVRDESKNLNTMTLEHYPGMTEKSLKSIVDKAKDKWELQSVTIIHRIGKLDVNDQIVLVISASRHRQEAFDSCNFIMDFLKTDAPFWKKESTTKSENWVKSRSQDEEKKKHWKNE. 151
419 2.000e-71gi|657916625|ref|WP_029618476.1| molybdopterin synthase catalytic subunit [Rhizobium sp. MGL06]  clstr ali  43  6.TIRVQAQDFDLQAEIDALAKGRLDIGAVVTFTGLCRDEQGSLTALELEHYPGMAEAEMRRIADLAIKRFSLIGLAAIHRFGKILPGENIVLVIAAAPHRQAAFDGASFMMDYLKTSAPFWKKEHLADGSSWVAAKDADDRAREKWRT.. 154
420 2.000e-71gi|499634993|ref|WP_011315727.1| molybdenum cofactor biosynthesis protein MoaE [Nitrobacter winogradskyi]  clstr ali  42  5ITIRLQEADFDLAHEVAALSRGRTDIGAVVTFSGICRGDEDGIAALTLEHYPGMAEAEIARHAEEAVSRWPLTGITVIHRYGRIVPGENIVLVVTASSHREAAFQGAEFLMDYLKTKAPFWKREEGASGSGWVDAHDRDDTAAARWAKP. 155
421 2.000e-71gi|499802387|ref|WP_011483121.1| molybdenum cofactor biosynthesis protein MoaE [Polaromonas sp. JS666]  clstr ali  41  5.RVLITTEDFNLADEVAVLRANDSRVGAVCTFTGTVRDRNGEVLSMELEHYPGMTEKAIEAMIDEAMVRFDIFGVRVIHRVGLLQPLDQVVMVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALAKWGIQA 185
422 2.000e-71gi|563755296|ref|WP_023786748.1| molybdenum cofactor biosynthesis protein MoaE [Hyphomicrobium nitrativorans]  clstr ali  43  1MAVRVQHEPFDAVAEVEALTRGRIDVGGIVTFTGLVRGDVDGLISLTLEHYPGMTEAELGRIEVEARKRFDLVDCVVVHRVGELTPGEGIVLVVALSRHRQAAFEAAEFLMDYLKTRAPFWKKETFADGANWVDARDSDSRAEARWGGES 153
423 3.000e-71JGI.Meta JGI_HUM.5006440 7012385415 SRS024289_LANL_scaffold_19784__gene_24256 moaE protein [Human Supragingival plaque microbiome from visit number 2 of sub  ali  36  6..ISVQEAEFDQNAVYHWLSESH-SVGATVIFVGKVRDLNDDVSSLYLEHYPAMTEKALQEIISEAQSRWNIQRVSVIHRVGLLHTGDEIVLVGISSAHRGDAYHANEFIMDYLKSKAPFWKKEQTNKGERWIEARDSDKEALKKW.... 150
424 3.000e-71gi|446467347|ref|WP_000545201.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Salmonella enterica]  clstr ali  46  5.RIVVGPAPFSVGEEYSWL-AARDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGARWVEARDSDQQSAKRW.... 164
425 3.000e-71gi|504013640|ref|WP_014247634.1| molybdenum cofactor biosynthesis protein MoaE [Azospirillum lipoferum]  clstr ali  45  1MAIRVQAEDFDVGAEYAAFTAGRTSVGGVAMFVGLVRDIAGGVSAMTLEHYPGMTEKQLEAIEEEARRRWPLDDVLVIHRHGRLEPGDRIVMVATASAHRDAAFESCRFLMDWLKTKAPFWKLEATPEGERWVEAKDSDDAAAARWSE.. 150
426 3.000e-71gi|496119860|ref|WP_008844367.1| molybdopterin synthase catalytic subunit [Glaciecola lipolytica]  clstr ali  34  8ISINIQKNDFDHGLEYTQLKEHSDQHGAIVTFTGLVRDMNLGVTGLFLEHYPGMTEKVLQKLAAEAAQKWSLGAITIIHRIGQLDVNQQIVFVGVTATHRGEAFDACQFLMDFLKTQAPFWKKEQRGSSAHWLDKRLSDEFAAKKWKE.. 157
427 3.000e-71gi|575449879|gb|AHG81919.1| Molybdopterin-converting factor subunit 2 [Bibersteinia trehalosi USDA-ARS-USMARC-188]  clstr ali  35  5..IKVQTENFDQNAVYRWL-AENHRVGATTVFVGKVREMNDSVSGLYLEHYPAMTEKALNEIVAEARQRWELERVAVIHRVGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTAQGDRWVEERESDLQAAEKWQ... 150
428 3.000e-71gi|519018444|ref|WP_020174319.1| hypothetical protein [Methyloferula stellata]  clstr ali  43  10VSVRVQAETFDAAAEAQRLTEGRTDLGAIVTFTGLCRDESGTLAALEIEHYPGMAEAEILRVVEEARSRWPLQGALVIHRFGKIKPGEPIVLVVTTSTHRTEAFEAAAFLMDYLKTRAPFWKKEHLADQSSWVAAKDQDEAAAGRWK... 158
429 3.000e-71gi|518868988|ref|WP_020024878.1| hypothetical protein [gamma proteobacterium SCGC AAA076-D02]  clstr ali  32  4..IIVQSEDFDLTTEVALAKVSNSNIGAIVSFVGTVRDESKNLNTMTLEHYPGMTEKSLKLIVDKAKNKWELQSVTIIHRIGKLDVNDQIVLVITTSRHRQEAFDSCNFIMDFLKTDAPFWKKESTTKSENWVKSRSQDEEKKKHWKNE. 151
430 3.000e-71gi|516742628|ref|WP_018077462.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  47  1MKIVIQCEAFDLGAEVDAMRRGRTGIGAIASFIGLARDCNEGVHAMTLEHYPGMTEKALAALVDEANSRWTLLDVTVIHRIGRLLPGDPIVLVAVASQHRGEAFAACEFIMDYLKTQAPFWKKEATPEGERWV................. 135
431 4.000e-71JCVI_PEP_1096676808227 /source_dna_id=JCVI_ORF_1096676808226 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  45  7..ISIQAEPFSLADESAALARSTGDVGAVATFTGYCRSEGGRLSALELEHYPGMAEEEIQRVVDEAVTRWPLMAVRVIHRFGRMTPGDEIVFVGTVSTHRREAFAACEFLMDYLKTRAPFWKKEYLADGGEWVEAKAADDVATLRWAKP. 155
432 4.000e-71gi|703885056|gb|KGQ70849.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Chelonobacter oris]  clstr ali  38  5IRIAVQTEAFDQSAVYQWLSEP-KSSGAVVLFIGKVREMNDSVQTLYLEHYPAMTEKALHEIVAEACRRWELQRVELIHRVGKLQTGDEIVLVGVSSAHRGNAYQANEFIMDYLKTRAPFWKKELTDRGERWIEERDSDKQAAGKW.... 151
433 4.000e-71gi|494452462|ref|WP_007243365.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus pittmaniae]  clstr ali  36  4IQIAVQSQTFDQNAVYQWLSESH-SIGASVIFVGKVRDLNDNVSSLFLEHYPAMTEKALREIVEEACSRWQLERVSVIHRVGLLHTGDEIVLVGTASAHRGDAYAANEFIMDFLKSKAPFWKKEQTDQGERWIEARDSDKQALTKW.... 150
434 4.000e-71gi|494914105|ref|WP_007640143.1| molybdopterin synthase catalytic subunit [Glaciecola psychrophila]  clstr ali  33  7..ISVQTQDFDFAYQYQKLRDSNNSDGALVTFVGLVRDMNQSVSGLFLEHYPAMTEKVLNDIVETARVKWHLGSVSVIHRVGQLKVSDQIVFVGVTSQHRQSAYHANEFIMDYLKTQAPFWKKETTTQGDKWIEAKISDIQKSKDWS... 153
435 4.000e-71gi|498009035|ref|WP_010323191.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacterium stanieri]  clstr ali  42  3.RIEISTKDYDLTEVQNWLKQGDTPCGATVTFTGLVRDEEGGLDGLYLEHYPGMTQNALDNIIQQARQRWSLGPVCIHHRIGWLTPGDNIVLVALASPHRAEAFEAAEFLMDYLKRDAPFWKKERINGEEHWVEQKESDRQAAKRWQTE. 151
436 4.000e-71gi|494051213|ref|WP_006993323.1| molybdopterin synthase catalytic subunit [Glaciecola mesophila]  clstr ali  36  5..IAVQTEDFDHSALYNALRQDSLSNGAIVTFSGLVRDFNQGVGDLFLEHYPAMTQISLQQIVAQARARWGLGKIILIHRVGHLAQGDQIVFVGVTSMHRKAAFEGAQFIMDYLKTEAPFWKKESTELGDKWVQANVSDTTARQRWTGD. 153
437 4.000e-71gi|654565557|ref|WP_028032838.1| molybdopterin synthase catalytic subunit [Chelativorans sp. J32]  clstr ali  47  7..IRVQAGDFDLAAEVNRLSAGRKDVGAVVTFTGRCRDEDGRLAALELEHYPGMAEAEIARIAREAADRWSLSGLTVIHRYGRIEPGENIVLVVTASSHRKAALEAADFLMDYLKSRAPFWKKEHPATAARWVEAKAEDEDALARWKK.. 155
438 5.000e-71gi|502358598|ref|WP_012771500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Aggregatibacter aphrophilus]  clstr ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGASVIFVGKVRDLNDKVSSLYLEHYPAMTHKALLDIAQQAKVRWDLQKISIIHRVGQLNTGDEIVLVGTSSAHRGDAYHANEFIMDYLKTQAPFWKKEQTTKGERWIEGRDSDYVAAEKWK... 151
439 5.000e-71gi|494680767|ref|WP_007438102.1| molybdenum cofactor biosynthesis protein MoaE [Acetobacteraceae bacterium AT-5844]  clstr ali  41  3.TIRVQEAPFDQAAETAALTAGRVDVGGVASFLGLCRA-DDGLAALVLEHYPGMTEKALGDIAAEAESRWPLTGCTVIHRYGRILPSEPIVLVLAASRHRTAALEACAFLIDWLKTGAPFWKREEFADGSRWVEARESDDAAAAKWG... 148
440 5.000e-71gi|517815409|ref|WP_018985617.1| hypothetical protein [Methylophilus methylotrophus]  clstr ali  40  9..VSVQPEDFDTGHELKQLKAATPQAGALVNFVGLVREASGHLSEMVIEHYPGMTEKALQKIALQATERWPLLGVRMIHRVGTLTAQSQIVLVATTSLHRQAAFEACAFMMDYLKTEAPFWKKEIGDFGEHWVEARASDEQAKQQWKQP. 157
441 5.000e-71gi|493994900|ref|WP_006937573.1| molybdenum cofactor biosynthesis protein MoaE [Labrenzia aggregata]  clstr ali  50  7..VRVQAEDFDLQAESLRLTEGRKDVGALVTFTGLCRDEAGTLAALELEHYPGMAEAELTRIAGEAAARWPLTGLTVIHRFGKIAPGHNIVLVIAASSHRRAAFEAADFLMDYLKTRAPFWKKEHPAEGGSWVEAKTEDDTDAARW.... 152
442 6.000e-71gi|692227366|ref|WP_032109118.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus sp. FF7]  clstr ali  37  4VRIAVQQQPFDQNAVYQWL-AEPKSVGAAVVFVGKVRDLNLGVSSLYLEHYPAMTEKALKEIVTQAQSRWDIQRVSLIHRVGLLHSGDEIVLVGVSSAHRGDAYHANEFIMDYLKMQAPFWKKECTDSGERWLERRESDADALQKWTQ.. 152
443 6.000e-71gi|653445069|ref|WP_027536993.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium sp. URHA0002]  clstr ali  41  5VTIRIQQADFDIGHEIAALTRSRTDVGAVVTFSGICRENGEPIAALTLEHYPGMAEAEIQRHADEAMARWPLTGLTVIHRVGRITPGENIVVVLAASQHRQAAFQAAEFLMDYLKANAPFWKREESQNGTNWIEARGHDETAAKRWTK.. 154
444 6.000e-71gi|516416876|ref|WP_017806274.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Avibacterium paragallinarum]  clstr ali  34  4IQIAVQSEPFDQNAVYRWVAEPH-SVGAAVIFVGKVREMNDNVSSLFLEHYPAMTEKALREIVEEACQRWQLLRIAVIHRVGLLYTGDEIVLVAVSSPHRGEAYQANEFIMDFLKSKAPFWKKEQTENGERWVEHRESDSAALRKW.... 150
445 6.000e-71gi|648625375|ref|WP_026317126.1| molybdopterin synthase catalytic subunit [Ahrensia kielensis]  clstr ali  47  7..ISVQASDFDLQSEVDKLTQGRKDIGAVVTFTGLCRDEGGKLKALELEHYPAMAEAQLNQIAQKAAKRWPLTGLTIIHRFGKIEPGANIVLVVTASSHRRAAFEAADYLMDYLKSEAPFWKKEHLADAEDWVQSKQADIDDLKRW.... 152
446 7.000e-71JCVI_PEP_1096679717643 /source_dna_id=JCVI_ORF_1096679717642 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  41  2.SVKVQSEDFDIGGELAALTDGNMDIGGMVSFVGLVRDGDDALKAMTLEHYPGMTEKMLREIEAEANERWDLEASLIVHRYGRLEPGDRIVLVATASAHRQEAFDACAFLIDWLKTKAPFWKLEESDQGAQWVESKETDDRAAERWERD. 152
447 7.000e-71gi|494164133|ref|WP_007103867.1| molybdopterin synthase catalytic subunit [Glaciecola polaris]  clstr ali  36  5..IDVQTDDFDQNALYNALRQDSASQGAIVTFSGLVRDFNQGIGGLFLEHYPAMTMHSLTNIVGQARQRWTLGKIIVIHRVGHLAQGDQIVFVGVTSAHRKDAFDGAQFIMDHLKTEAPFWKKETTECGPRWVEANPNDEKARAKWGND. 153
448 7.000e-71gi|703286355|ref|WP_033394631.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira arctica]  clstr ali  38  5..IKIQQADFDLTVENAKLRTGHKDIGAVVSFVGTVRDINEGVAILELEHYPGMTEKALEKIRLEAHDRWSLEASLIIHRIGKMYPADQIVLVAVASRHRENAFHAAHFIMDYLKTNAPFWKKETLPDGDRWVDSRVSDKEAEARW.... 151
449 8.000e-71gi|640631623|ref|WP_025059623.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter donghicola]  clstr ali  45  1MRVSVQSEPFDLGQESTTFASGHRNMGAIVTFTGIVRDLDDPMDAMEIEHYPGMTEKAIATITKEAIERFSLGDALVIHRHGRLHPGEMIMMVATAARHRKDAFEAATYLMDYLKSRAPFWKRELSASGAAWVAAKDEDEAALERW.... 147
450 8.000e-71gi|503512715|ref|WP_013747234.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Gallibacterium anatis]  clstr ali  38  4IEISVQTEPFDQNAIYQW-SSASAESGATVIFVGKVRDMNDNVSGLYLEHYPAMTEKALREIAEQAAQRWQLQRIYIVHRVGQLYTGDEIVAVAVSSAHRGSAYQANEFIMDFLKTKAPFWKKETTKSGDRWLDSRESDQQAAHRWE... 151
451 9.000e-71gi|696543210|ref|WP_033076155.1| hypothetical protein [Thalassotalea sp. ND16A]  clstr ali  37  5.SIKVQQQDFDFAKEVDTLEENNLVDGATVTFVGRVRNNNDGVKHLFLEHYAGMTEKCLFDISQQARERWQLGNISVIHRYGKLALGEKIVFVGVTSKHRQDAFMAAEFIMDYLKVSAPFWKKELTEQGERWVAAKAKDSKEANKW.... 151
452 9.000e-71gi|515999887|ref|WP_017430470.1| hypothetical protein [Halomonas jeotgali]  clstr ali  45  23IRVSVQREPFAGEDDSRELSRGRHDIGAVVCFTGLVRDFNEDVTGLTLEHYPGMTEKTLEDIAGQAWQRWSLNAVRVVHRVGYMTPGDGIVRVSVASAHRRDAFEACDFIMDFLKTRAPFWKKEHARHGDYWVSERGTDHADADRWD... 171
453 9.000e-71gi|494591715|ref|WP_007350308.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter sp. ELB17]  clstr ali  36  14.SVSIQNADFDAAQEYAQLRDSGAGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEQVISDLIAQAGQRWDVRKARVIHRIGRLPLQSQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKELTDAGEHWVEQKASDVARAEGW.... 160
454 1.000e-70gi|640617774|ref|WP_025045836.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter sp. MM-124]  clstr ali  48  1MRISVQEQPFDLGAESAAFASGRKDMGAIVTFTGVVRDLDDPLEAMEIEHYPGMTEAALSEIATQAVTRFELGDALVIHRYGRLLPGEMIMMVATAARHRKSAFEGAEFLMDYLKSRAPFWKREITAAGADWVASKAVDEDALKRW.... 147
455 1.000e-70gi|517728518|ref|WP_018898726.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobium sp. 2MFCol3.1]  clstr ali  42  6.TIRVQREDFDLQAEVELLSKGKPGIGAVVTFSGLCRDEGGTLDALELEHYPGMAEAEMMRIAEMAIERFKLNGLTAIHRYGKIAAGENIVLVIAAAPHRQAAFDGANFVMDFLKTSAPFWKKEHGKDGREWVEAKGHDDAARDKWK... 153
456 1.000e-70gi|687250303|gb|KGD73486.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Tatumella morbirosei]  clstr ali  38  6..IRVGEASFSVTEAHQWLSENDAD-GAIVTFTGKVRNHNDSVATLTLEHYPSMTEKVLESIAAEARRRWQLQRIVIIHRVGSLTAGEQIVFVGVSSAHRNSAFAGAEYIMDILKTRAPFWKRETTPQGDRWLDAKESDHQAAKRW.... 150
457 1.000e-70gi|695755500|gb|KGK79515.1| molybdenum cofactor biosynthesis protein MoaE [Thalassobacter stenotrophicus]  clstr ali  44  1MRIVVQEQDFSAATETADFGKG-PDVGAVVTFSGIVRDLDDPLQQMVIEHYPGMTEKALTKIAQEASARWDLRDVLVIHRYGALSPGEQIMMVATAARHRAQAFEAAEYLMDYLKSRAPFWKKEVTAASADWVDAKDSDEAALDRW.... 146
458 1.000e-70JGI.Meta JGI_HUM.1370826 7030754592 C3544874__gene_274945 moaE protein [Human Supragingival plaque microbiome from visit number 2 of subject 159510762]  ali  34  4IRIAVQEAEFDQNAVYHWLSEQN-SVGAAVIFVGKVRELNDDVSSLYLEHYPAMTEKALKEIVAEAKQRWEIQRVAVIHRVGLLQTGDEIVLVGVSSSHRGEAYRANEFIMDFLKSKAPFWKKEQTDKGERWIDARTSDKQALEKW.... 150
459 1.000e-70gi|575443418|gb|AHG75600.1| Molybdopterin-converting factor subunit 2 [Mannheimia varigena USDA-ARS-USMARC-1296]  clstr ali  37  6..IEVQEAEFDQNQIYRWLSEYH-SVGATTLFIGKVREINDNVSGLFLEHYPAMTKKALQAIVDEARQRWDLQRVAVVHRIGQLNTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKREQTQEGERWIEGRDSDQQAAEKWK... 151
460 2.000e-70gi|550953922|ref|WP_022702312.1| molybdenum cofactor biosynthesis protein MoaE [Pseudorhodobacter ferrugineus]  clstr ali  42  1MQIRVQSEPFDMGAESNAFAQSATGAGAIVTFTGITRDSAGDLAVMEIEHYPGMTERALTSIAEQAMQRWHLTDCLVIHRYGALAPTDPIMMVATASRHRANAFAAAEFLMDYLKSRAPFWKKEITASKTDWVAARAEDEAALKRW.... 147
461 2.000e-70gi|640083504|ref|WP_024792154.1| molybdopterin synthase catalytic subunit [Candidatus Ruthia magnifica]  clstr ali  31  4..IIIQQQDFDLSTEIVLIKNNHSDIGAVVSFVGFVRDLDDSIQKMTLEHYPEMTEKALKSIIDEAKKRWSIGNITLIHRVGDLNINDQIVLVITSSKHRQSAFASCEFIMDYLKTQAPFWKKEYAQNKSKWVKAKSSDKNQKNRWE... 149
462 2.000e-70gi|550963850|ref|WP_022712161.1| molybdenum cofactor biosynthesis protein MoaE [Pseudochrobactrum sp. AO18b]  clstr ali  47  4.TILVSQDDFDAAALTARMTEGRTDIGAVVSFTGFCRDENKTLQALELEHYPGMAEAQLARIAAEAMQRWPLQGITIVHRSGLIKAGEQIVFVATASKHRRAAFEAAEFLMDYLKSDAPFWKKEHLENGSGWVKAKASDEDMKKRWQ... 157
463 2.000e-70gi|564608520|ref|WP_023849777.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae bacterium PD-2]  clstr ali  50  1MRVVVQEAPFDFGAEAAGFAAGRTDMGAVVTFTGVVRDTGGDLDRMEIEHYPGMTEKALETIAAEAVARWSLGDALVIHRFGRMAPGEQIMMVATAAPHRKDAFEAAEYLMDYLKSRAPFWKKEHGRDGTSWVAAKDEDEEALTRW.... 147
464 2.000e-70gi|655050101|ref|WP_028498682.1| molybdenum cofactor biosynthesis protein MoaE [Microvirgula aerodenitrificans]  clstr ali  40  5..IRVSHDDFDTAAEIARYQ--RPGIGAVTAFVGLVRDFGDGVVALELEHYPGMTESELAAIIDDAGRRWPLDGVTVIHRVGRLELSERIVLVVTASAHRRAAFEGCEFVMDWLKTRAPFWKREWGADGSRWVDAKDSDDSATARWE... 150
465 2.000e-70gi|495095233|ref|WP_007820056.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobium sp. CF142]  clstr ali  43  6.TIRVQREDFDLQTEVDRLSKGKPGIGAIVTFSGLCRDEGGTLSALELEHYPGMAEAEMTRIGELAIERFGLSGLTAIHRFGKIAAGENIVLVVAAAPHRQAAFDGASFVMDFLKTSAPFWKKEHGKDGGDWIAAKDADDTARDRWK... 153
466 2.000e-70gi|492856084|ref|WP_006010038.1| molybdopterin synthase catalytic subunit [Glaciecola pallidula]  clstr ali  35  8..ISIQAHDFDHACVYAKIQKNADSDGAIVTFTGLVRELTGNLHYMTLEHYPEMTQKSLMNICEQARQRWPLGAINIIHRIGKLTPDEQIVFVGVSSKHRKAAFAATEYIMDFLKTKAPFWKKEVSSEGEFWVQAKLSDKQKADDW.... 153
467 2.000e-70gi|499247710|ref|WP_010945250.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus ducreyi]  clstr ali  35  6..IEVQQAPFDQHAIYQWLSEPH-SVGATTIFVGKVREMNDNVSGLYLEHYPAMTKKALQEIVNQARQRWELQRIAVIHRIGQLHTGDEIVLVGVSSAHRGDAYLANEFIMDYLKTKAPFWKRETTAEGERWIESRESDEQQLEKW.... 150
468 2.000e-70gi|653100679|ref|WP_027350770.1| hypothetical protein [Halotalea alkalilenta]  clstr ali  44  3.TIAIQTEGFDLGAVESSLIQGRSDLGAMVSFVGRVRDFSDGVRALTLEHYPGMTEAVLDALADEAVARWRLGGVAIIHRVGRLSPGDEIVLVAVACAHRKAAFEACEFIIDRLKTQAPFWKKEHSDEGDRWVGERMSDRWASERWEE.. 151
469 2.000e-70gi|516409682|ref|WP_017799080.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia toletana]  clstr ali  42  4.RIRVGHQPFSMAEEYQWLAACD-EDGAVVTFTGKVRNHNDDVSALTLEHYPGMTEKALEEIVAEARQRWPLQRVTLIHRIGELFPGDEIVMVGVTGAHRSAAFAAAEFMMDYLKTRAPFWKREATPQGDRWVDARDSDKQAARRWE... 150
470 2.000e-70gi|497290896|ref|WP_009605113.1| molybdenum cofactor biosynthesis protein MoaE [SAR116 cluster alpha proteobacterium HIMB100]  clstr ali  41  4..ITITTDNFNAGDEIEALR--LAGVGAIVTFTGIVRDKAEDLTAMTLEHFPGMTEQEIQAIIDEARTRWPLQGVRVIHRVGRLLPQENIVFVGTASAHRQAAFDSASFIMDYLKTKAPFWKKEETPAGASWVEARDCDDKALEKWQ... 148
471 3.000e-70gi|648490559|ref|WP_026182310.1| molybdenum cofactor biosynthesis protein MoaE [Leeia oryzae]  clstr ali  39  1MRIRVSEADFDLQEEQQALLELTAEAGAVVSFTGYVREFSSGLETMLLEHYPGMTESALEMIAQEASQRWSLKAVNIIHRIGRLGPKARIVLVQVVSRHRGDAFSACEFVMDYLKTRAPFWKKEFPLEGQYWVEAKETDEAALARW.... 149
472 3.000e-70gi|549964994|ref|WP_022571211.1| molybdopterin converting factor, large subunit [Rhodobacteraceae bacterium HIMB11]  clstr ali  45  1MKISVQAEPFDYGALSNAFAQGHTHVGAVVTFCGIVRDDDGGLSTMEIEHYPGMTEKAIRAHAKTAKDRFSLAEVLVIHRYGSLKPGEMIMMVATAAPHRNDAFKGAEFLMDYLKSRAPFWKKEIVNGEPRWVDAKPEDEDALSRW.... 147
473 3.000e-70gi|640415632|ref|WP_024897366.1| molybdopterin synthase catalytic subunit [Ochrobactrum rhizosphaerae]  clstr ali  45  11..ISIRDTDFDIAEEIRQLSEGRKDIGAIVSFTGLCRDEGGKLSALELEHYPGMAEAEIRRIAHDAIERWPLSGVSIIHRFGLIKPGENIVLVVTASAHRQAAFEAASFLMDFMKTGAPFWKREHLIEGGDWVESKAEDEQSRGRWQR.. 158
474 3.000e-70gi|492859005|ref|WP_006012055.1| molybdenum cofactor biosynthesis protein MoaE [Brucella ovis]  clstr ali  41  10.SISVRSEDFDIAAEIDRIGKNRREIGAIVTFTGLCRDEDGQLAALELEHYPGMAQAEISRMAKQALERWPLNDLTIIHRYGLIKPGENIVLVVAASRHRHAAFEAASFLMDYMKTNAPFWKREHLADGTAWVSSKEEDEESRKRWEEP. 159
475 3.000e-70gi|502871381|ref|WP_013106357.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Thiomonas]  clstr ali  44  4ITIRIQTEPFDLGAELQALRAGRLDVGAIASFVGLCRDHHPGVQAMELEHYPGMTERAIADMVHEAQARWPLLGVTVIHRVGRLLPGDDIVLVLVASAHRAAAFAACEFLMDYLKTQAPFWKKETTPEGGQWVDARESDDAALRRWGVES 159
476 3.000e-70gi|518808009|ref|WP_019963963.1| hypothetical protein [Pannonibacter phragmitetus]  clstr ali  45  6.RVIVQPGPFDAEAESRQLSAGRADVGAIVSFTGLCRDEDGRLEALVLEHFPGMAEKELERIAREALTRWPLTGLTVIHRHGRILPGEQIVLVTAASRHRRAAFEAADFLMDFLKSRAPFWKKEILREGGGWVAAKAEDETALDRWN... 153
477 3.000e-70JGI.Meta JGI_HUM.0297187 7062616834 SRS017227_Baylor_scaffold_97884__gene_125030 moaE protein [Human Supragingival plaque microbiome from visit number 1 of  ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGATVMFVGKVRDMNDEVSSLYLEHYPAMTHKALMDIAQQAKVRWDLQKISIIHRVGELNTGDEIVLVGTASAHRGDAYHANEFIMDYLKNQAPFWKKEQTEKGERWIEGRDSDYAAADKWK... 151
478 3.000e-70gi|664808188|gb|KES21133.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. AAC]  clstr ali  42  1MSICVQQQGFDAGELIERLRGRSGGAGALVSFVGYVRDLDGGVSELFLEHYPGMTQRSLEQIAAAARERWALLDLEVLHRVGALAAAEPIVFVGVTSRHRRDAFEACEYIMDQLKTRAPFWKRERTPHGWQWVAARETDSQAAARW.... 148
479 3.000e-70gi|594395232|gb|EXU73485.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia mallotivora]  clstr ali  41  4.RIVVDAAPFSVDEAYRWLSASD-EDGAVVTFTGKVRNHNDKVAALTLEHYPGMTEKALAAIVAEARQRWTVQRVMVIHRTGELFPGEEIVLVGVSAAHRSGAFAAAEFIMDQLKTRAPFWKREATTEGERWVAARDSDQQAAARWK... 150
480 3.000e-70gi|501463678|ref|WP_012487123.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Cellvibrio japonicus]  clstr ali  40  4.SIAVQEADFDVGTEYQALIVGDTRAGAHVLFVGRVRDMNMEVQGLFLEHYPGMTEQVLQSLVDDARKRWELLGVRLIHRVGYLRPGDQIVLVATSSAHRAHAFEAAEFLMDLLKTKAPFWKKEHSSGGAVWLESRAQDNEAGKRW.... 150
481 3.000e-70gi|670458148|ref|WP_031406947.1| molybdenum cofactor biosynthesis protein MoaE, partial [Thiomonas sp. FB-Cd]  clstr ali  40  5...RIQSEVFDAGAELRALRETRRDIGAVVCFEGVCRDSSADVQAMELEHYPGMTEQSIAAMVAEAQSRWSLLGVTVIHRVGRLLPGDPIVLVLVASVHRAAAFCAGEFLMDYVKTQAPFWKKETTTLGPAWVDARESDDTALQRWGIDA 158
482 4.000e-70gi|655000981|ref|WP_028450172.1| hypothetical protein [Chitinibacter tainanensis]  clstr ali  41  6..IRVQSADFDVAHEYQRL-AGQPQIGAVVMFVGRVRDLNADLHALHLEHYPAMTERALQQLVQAARARWQLDAVTIIHRVGRLAPAEQIVLVLTASPHRDTAYEANRYLMDYLKTAAPFWKKEITRHGEAWVEARASDEQARARWET.. 152
483 4.000e-70gi|511822593|ref|WP_016401808.1| molybdenum cofactor biosynthesis protein MoaE [Agarivorans albus]  clstr ali  37  1.MIKVQLEDFDVGEEYQRLRE-RASAGAIVFFVGLVRDMNQQVKGLQLEHYPGMTELQLEKIVAEAKTRWPIQDASIVHRVGDLDVSDQIVFVGVNSAHREASFEACHFIMDYLKTKATFWKKERTLGGDVWLDARESDLKAKDKW.... 146
484 4.000e-70gi|619155009|gb|KAJ54057.1| molybdenum cofactor biosynthesis protein MoaE [Actibacterium mucosum KCTC 23349]  clstr ali  45  1MTVRVQENPFDFGAEAQAFATGRTDAGAVVTFTGIVRDLVQSLHEMMIEHYPGMTERALSGIEADARTRWDLRDVLIIHRHGILRPGDMIMMVATASPHRKDAFEAAEFLMDFLKSRAPFWKKERTGEGEEWVASKSEDEYALSRW.... 147
485 4.000e-70JCVI_PEP_1096669575741 /source_dna_id=JCVI_ORF_1096669575740 /offset=0 /translation_table=11 /length=151 /full_length=151  ali  35  1MKIYIQKEDFDISFLIQELKKKSNSVGAIASFIGLMRDINDGIQSMTLEHYPEMTKKTLEDICIKAKDKWKIIDLVVAHRYGVININDNIVFVGVASQHRKDAFEACEFIMDFLKTNATFWKKELHLDGSSWVESRKSDDDALNRWQ... 150
486 5.000e-70gi|497258115|ref|WP_009572332.1| molybdenum cofactor biosynthesis protein MoaE [Celeribacter baekdonensis]  clstr ali  45  5VRISVQAEDFDLATELSGF-GHAANTGATVTFTGLVRDDTGALQHMEIEHYPGMCEDAIRKIADEAANRWALTDCLVIHRFGRLVPGEQIMMVATAARHRSEAFAAAEFLMDYLKSRAPFWKKEVTREGAEWVAAKDSDEDALSRW.... 149
487 5.000e-70gi|652863920|ref|WP_027133819.1| molybdenum cofactor biosynthesis protein MoaE [Geminicoccus roseus]  clstr ali  42  1MAVRVQAEPFDLGAEIAELTRGRTEIGGVATFTGLVREFAGGLTSMTLEHYPGMTERELERVEAEALDRWPLDASLIVHRYGKMLPGEPIVLVATASAHRQAALESCAFLIDWLKTRATFWKFEEGEDGGLWVEAKEADDEAARKWH... 149
488 6.000e-70gi|501130914|ref|WP_012179764.1| molybdenum cofactor biosynthesis protein MoaE [Dinoroseobacter shibae]  clstr ali  44  1MTVRVQQAPFALGAELDSFAAGRTDMGAIVSFTGVVRDATGDLDVMEIEHYPGMTERAIGKIVDEAKARWSLGDALVIHRYGRMGPGDRIMMVATAAPHRVDAFAAAEFLMDYLKSRAPFWKKEISGAGASWVAATDEDEAALTRW.... 147
489 7.000e-70gi|497515811|ref|WP_009830009.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae bacterium HTCC2083]  clstr ali  39  1MKILVQDAAFDAGAELNDFTKAQSNMGAVVSFTGIVRDLDAGLKQMDIEHYPGMTERALEKIASDAMGRWNLGDVLVIHRFGALKPEDVIMMVATASKHRKDAFEAADFLMDFLKSRAPFWKKEQTGAAQDWVNSKQEDEDALTRWE... 147
490 8.000e-70gi|502585698|ref|WP_012823477.1| molybdenum cofactor biosynthesis protein MoaE [Halothiobacillus neapolitanus]  clstr ali  37  1MKISVQTEDFDVNSVLAELRGRCAHVGAVACFLGTVRDMNDDVAVLTLEHYPGMTERALERVATEAKSRWPVAGVTIVHRYGALFPSDQIVLVAVASAHRHDALDACAFMMDYLKTHAPFWKKETDSSGATWVDARESDAVARARW.... 149
491 8.000e-70gi|506298013|ref|WP_015817788.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Teredinibacter turnerae]  clstr ali  36  1.MIRVQQADFDVAGEYRNLQQ-HGLAGAIVTFSGLVRDFAGDTSRFFLQHYPGMTESVLNKIVSQAQSRWPLLAVTVIHRVGHLQAGDQIVFVGVSSAHRKSAFAACEYIIDLLKTEAPFWKKE----GRQWVDAKQSDQAAADRW.... 141
492 8.000e-70gi|495069796|ref|WP_007794621.1| molybdenum cofactor biosynthesis protein MoaE [Pelagibaca bermudensis]  clstr ali  47  8.RVVVQEAPFDFGVEAERFAAGRTDLGAVVTFTGVVRDVAGGLEGMEIEHYPGMTEKALTKIASEAQARWSLGEVLVIHRYGKMAAGERIMMVATASAHRQHAFEAAEYLMDYLKSRAPFWKKESAGGDQSWVAAKDEDEAALDRW.... 152
493 9.000e-70gi|657912928|ref|WP_029614992.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. ICMP 17674]  clstr ali  42  1MAIRVQQAVFDAGYELNALHAANVGVGAVVGFVGYVRDFNDGVAGMFLEHYPGMTEKALGKIVDEAQQRWPLLKVEVLHRIGALEPGEPIVFVGVASAHRQAAFDACNFIMDYLKTRAPFWKKETTQEGPRWVEGRQSDQDAVERWQ... 149
494 9.000e-70gi|497484578|ref|WP_009798776.1| molybdenum cofactor biosynthesis protein MoaE [Nitrobacter sp. Nb-311A]  clstr ali  44  5VTIRLQKEDFDVAREVAALSRGRTDIGAVVSFSGICRGEGDAIAALVLEHYPGMAEEEIARHAEEAVSRWPITGLTVIHRFGRIAPGDNIVLVVTASAHREAAFHAAEFLMDYLKTRAPFWKREEGSSGSSWVDAHDRDDTAAARWAK.. 157
495 9.000e-70gi|672895035|gb|KFI24762.1| molybdenum cofactor biosynthesis protein MoaE [Paenirhodobacter enshiensis]  clstr ali  48  1MRVSVQPDRFDPAAEMAGFGTG-PTTGAVVTFTGIVRDDTGRMQALEIEHYPGMTEAVIADYARAAAERFGLSDVLVIHRHGRLAIGEPIMMVATAARHRQAAFEAAEYLMDWLKSRAPFWKKEVGADGESWVAAKDSDEDALGRW.... 145
496 1.000e-69gi|489900301|ref|WP_003803739.1| molybdenum cofactor biosynthesis protein MoaE [Alcaligenes faecalis]  clstr ali  35  1.MVRIQTEDFDVAALNAELRATAGGAGAMVTFTGYVRDQADGTTTLFLEHYPGMCEREIETVCEQARQRWPILDTLVVHRVGELHLTEQIVYVGVTSAHRGDAFRACEFIMDVLKTRAPFWKRETLADGKRWVQQRDSDAQKTDSWNNSA 153
497 1.000e-69gi|494366553|ref|WP_007196846.1| molybdenum cofactor biosynthesis protein MoaE [Hoeflea phototrophica]  clstr ali  45  20VTVRIQAEDFDIASEIAALAEGRADIGAVATFTGLCRDEGGRLSSLELEHYPGMAERAIRTIANEAAKRFALTGITAIHRYGKIAPGCNIVLVVATAPHRQAAFDGASFLMDYLKTEAPFWKKEHRKGGGEWVSAKDSDDRAKARWDK.. 169
498 1.000e-69gi|652476222|ref|WP_026870909.1| molybdenum cofactor biosynthesis protein MoaE [Inquilinus limosus]  clstr ali  48  1MTVRVQEADFDPGAEIAALSDGRTDVGGVACFVGLVRDIASGVRAMTLEHYPGMTERQLAEIEAEARDRWPLLEVRIVHRIGRLEPGDRIMFCGVASAHRGAAFEACAFLMDWLKTQAPFWKKEETPEGERWV................. 135
499 1.000e-69gi|494077435|ref|WP_007019487.1| molybdenum cofactor biosynthesis protein MoaE [Neptuniibacter caesariensis]  clstr ali  41  6..VLVQTEDFNIGELSERVRAEDATSGAIVTFTGIVRNTDASLDALYLEHYPGMTEKALEKIADQARQRWELGNIVIAHRVGTLPLNENIVFVGVGSAHRVNAFEAAQFVMDYLKRDAPFWKKEISSQGESWVEQKQSDLDAAEDW.... 152
500 1.000e-69JCVI_PEP_1096676121441 /source_dna_id=JCVI_ORF_1096676121440 /offset=0 /translation_table=11 /length=153 /full_length=153  ali  35  2..IRVQAEDFDIGNEISIITNQNQNIGGICSFTGLVREFNPNIQAMTLEHYPGMTEKQLSKIENEAHERWDLSDSLIIHRFGCLKPKDRIVLVITASAHRKAAFESCQFLMDWLKTQAPFWKMEETATGSHWVVAKSSDNLEVEKWSAK. 150
501 1.000e-69gi|655019930|ref|WP_028468883.1| molybdenum cofactor biosynthesis protein MoaE [Neptunomonas japonica]  clstr ali  37  11..IEVQTEDFSIGELYDWLKSDDASSGAVVTFTGIVREHVETMQEMFLEHYPGMTERALEQIVEQARQRWQLGNVVVIHRVGRLSLNDNIVFVGVASGHRVNAFAAAQFIMDYLKKDAPFWKKEINAESEAWVEQKTSDLDAANQW.... 155
502 1.000e-69gi|652977178|ref|WP_027229783.1| molybdopterin synthase catalytic subunit [Phyllobacterium sp. UNC302MFCol5.2]  clstr ali  44  8..VRIQGEDFDTASEIARLTENRRGIGAIVTFSGLCRDEAGTLAALEIEHYPGMAEAEITRIADEALARWSLDGLTVIHRYGFIKPGENIVLVVAASAHRQAAFEAASFLMDYLKNAAPFWKKQHGRDGESWVEAKATDKEALRRWQKK. 157
503 1.000e-69gi|503714533|ref|WP_013948609.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Hyphomicrobium]  clstr ali  39  1MTVRVSTDDFDISEEMAKLSDGDTAIGGVALFVGKVRGDVKGLVSMTLEHYPGMTEAELARIETEACARFKLSASLIIHRVGELKPGDNIVLVIACAPHRQDAFAGAEYLMDYLKTRAPFWKKETLGDGSQWVDARESDEDAAAAW.... 149
504 1.000e-69gi|504304870|ref|WP_014491972.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium japonicum]  clstr ali  39  10VTIRIQQDDFDIAREIAILTGSRTDIGAVVSFSGICRGDEDSIAALTLEHYPGMAEEEIKRHADEATSRWPLNGVTIIHRVGRFMPGQNIVLVLAASQHRQAAFQAAEFLMDYLKTSAPFWKKEESATGTGWVEAHARDDEAAARWTR.. 159
505 2.000e-69gi|590082462|gb|EXL08765.1| molybdopterin synthase catalytic subunit [Aquamicrobium defluvii]  clstr ali  40  8..IRIQTADFDVAAEIARLTSGRSDIGAVVTFTGLCRDEAGRLSGLELEHYPGMAEAEVLRIAGDVCGRWPLQGITVIHRYGKLEPGDNIVLVATASTHRQAAFDAACFMMDFLKSRAPFWKREHVAGGAEWVAAREADEAAIANWRK.. 155
506 2.000e-69gi|494946969|ref|WP_007672997.1| molybdenum cofactor biosynthesis protein MoaE [alpha proteobacterium BAL199]  clstr ali  37  1MSVRVQEEDIDIGAELAEMTVGNHAIGGLGVFVGLVRDIAGEVAGMTLEHYPGMTERQLEAIEAEACARWPLQASRIVHRVGRLEPGDNIVLVACASAHRQAALDATAFLIDWLKTKAPFWKLEETRAGAHWVDARESDDAAAARWSR.. 150
507 2.000e-69gi|655498866|ref|WP_028880185.1| molybdenum cofactor biosynthesis protein MoaE [Terasakiella pusilla]  clstr ali  42  1.MIRVQAENFDVGAEINALSNGNTAIGGICSFVGLVRDFQHRVSAMTLEHYPGMTEKKLQEIEEIARNRWPLEDVLIIHRYGRMEPGENIVLVVTASAHRKAAFEACEFLMDYLKTKAPFWKLEEDEKGESWVDAREADDAAAQKWDPSA 156
508 2.000e-69gi|515597139|ref|WP_017029746.1| hypothetical protein [Vibrio breoganii]  clstr ali  36  4..VLVQEQDFDLGE-EYSLLSESSSIGAVVTFVGKVRDFNDDVIGLNLQHYPVMTEKALHEICSEARSRWPLDRVTIIHRVGDLDIADQIVLVGVSSAHRDAAFAGCEFIMDFLKTKAPFWKKERLKDSSRWLDSRESDQISMKRWS... 149
509 2.000e-69gi|515480733|ref|WP_016914001.1| hypothetical protein [Halomonas stevensii]  clstr ali  45  13..VEVTEDSFSMAHGYEQALRGRTDIGAVVSFTGLVRDFNEDVLGLTLEHYPGMTERSLMEIAEQAWQRWSLQAVRIIHRVGDLALGDPIVRVLVASAHRRDAFLACDFIMDYLKTQAPFWKKERARQGTYWVKERKTDHQDAERWS... 159
510 2.000e-69gi|575470098|gb|ETX15750.1| molybdenum cofactor biosynthesis protein MoaE [Roseivivax halodurans JCM 10272]  clstr ali  49  1MPVSVQDAPFDYGAECERFASGRADMGAVVTFAGIVRGDGD-LARMEIEHYPGMTEKALGEIAEKARRRWSLGDVLVIHRYGMLTPGERIMMVATAAPHRRNAFEAADFLMDYLKSRAPFWKKEHMADGEAWVAAKDEDEDALSRW.... 146
511 2.000e-69gi|517115239|ref|WP_018304057.1| hypothetical protein [Wenxinia marina]  clstr ali  43  1MSVLVTEAAFDAGAELKDFTAGAEGAGGVVSFTGVVRDVAGGLSHMEIEHYPGMTERAIAAMRDDAMARFSLTAARVIHRHGRLAPGETIMMVLTAAPHRGDAFAAAEFLMDWLKSRAPFWKKEVTADGAEWVAAKDADEDALTRW.... 146
512 2.000e-69gi|492137317|ref|WP_005759086.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pasteurella bettyae]  clstr ali  36  4VKIAVHEAEFDQNAEYRWLSEPN-SVGAAVVFVGKVRDLNDEVSSLYLEHYPVMTEKALREIVDEAIQRWQLQRVSVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDY<