current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

CCNA.00016
Query: ACL93483.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# E-value Template Links and tools%idFirst MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARALELEAYPGFTDAAITEIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPFWKKEHGPEGPRWIEPTARDRTDAQRWDQEALast
1 7.000e-85gi|489554885|ref|WP_003459470.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas pseudoalcaligenes]  clstr ali  46  22MTIRVQAQPFDPGTELNALHAANLGIGAVVTFVGYVRDFNEGVGGMFLEHFPGMTEKALAKIADEARERWPLLGIEIIHRIGRLEPGEPIVFVGTSSAHRQAAFDACNFIMDYLKTRAPFWKKEDTSEGPRWVEGRCSDQSAAERWK... 170
2 1.000e-83gi|497209655|ref|WP_009523917.1| molybdenum cofactor biosynthesis protein MoaE [Ralstonia sp. PBA]  clstr ali  43  1MPIRVQTEDFDLGREIAALRAGSPQVGAVASFIGTVRDINDGVSAMELEHYPGMTEKALEQIVAAARQRWEIIDALVIHRVGPLRPLDQIVLVAVTSAHRGEAFAACEFIMDYLKSEAPFWKKEQTPAGARWVDARVSDDAALKRWGIE. 151
3 2.000e-83gi|498172430|ref|WP_010486586.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. S9]  clstr ali  44  1MSIRVQPDAFDPGDELSRLHAQNLGVGAVVTFVGYVRDFNEGVGGMFLEHFPGMTEKALGKIVDEATQRWPLLKVELIHRIGRLEPGEPIVFVGTSSAHREAAFEACAFIMDYLKTRAPFWKKEDTADGPRWVEGRCSDQQAAQRWKQD. 151
4 3.000e-83gi|501027072|ref|WP_012079173.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium sp. Marseille]  clstr ali  41  1MPVRVQTENFDVSHEVAALRAHSPQVGAVVTFIGTVRDMNDGVAEMELEHYPGMTEKALQNIVEQAKARWPIFDALVIHRIGPLLPLEQIVLVAVTSAHRGEAFSACEFIIDYLKTDAPFWKKEQTPQGARWVDARTTDDTALAKWKQPS 152
5 4.000e-83gi|491919901|ref|WP_005672414.1| molybdenum cofactor biosynthesis protein MoaE [Lautropia mirabilis]  clstr ali  43  8..IHVQTQDFDVGAELKRLQALTREVGAVASFVGYVRDSNDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRHRDAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQ... 155
6 1.000e-82gi|495920852|ref|WP_008645431.1| molybdopterin synthase, large subunit [Cupriavidus sp. HMR-1]  clstr ali  46  1MAVRVQHEDFDLGAEVVALRAGNPGVGAVASFIGTVRDVSEGVSTMELEHYPGMTEKALETIEAAARERWPLLGVTIVHRVGLLQPLDQIVLVAVSSAHRGAAFAACEFIMDYLKSEAPFWKKEDTPEGARWVDARVSDDAALRRWGIES 152
7 1.000e-82gi|490764300|ref|WP_004626536.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Ralstonia]  clstr ali  44  1MSVRVQEADFDLGAEIAALRAGRPNIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALADIVSAAMQRWELIDALVIHRVGKLKPQDQIVLVAVASKHRGESFAACEFIMDYLKSEAPFWKKEQTPEGARWVDARVTDDKALARWG... 149
8 1.000e-82gi|503772213|ref|WP_014006289.1| molybdenum cofactor biosynthesis protein MoaE [Collimonas fungivorans]  clstr ali  36  3MPIRVQAEDFDFAAELAQLRLSNPKIGAVVSFLGTVRDLSDGVAQMELEHYPGMTEKALSAIIDQAKQRWEIFDALVIHRIGPLLPLDQIVLVAVSSAHRGDAFAACEYIIDYLKTEAPFWKKEHTEQGARWVDARSTDDEALAKWEQDA 154
9 1.000e-82gi|558878730|ref|WP_023534283.1| moaE family protein [Pseudomonas putida]  clstr ali  46  1MAVRVQEGAFDPGVETNALHAANVGVGAVVSFIGYVRDFNDGVAGMMLEHYPGMTEKALAKIVDEAQQRWPLLKVEVLHRVGYLAPGEPIVFVGVASAHRQASFEACNFIMDYLKTRAPFWKKETTGQGDRWVEGRQSDQDAAGRWGQSG 152
10 1.000e-82gi|490886456|ref|WP_004748425.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio tubiashii]  clstr ali  41  4.RVSVQFEDFSVGSEYEALAQG-TSAGAVVTFTGKVRDMNDNVTGLSLEHYPGMTEKALGEICNEAEQRWPLLNIRVIHRVGDLDIGDQIVFVGVSSAHRGAAFEACEFVMDYLKTKAPFWKKERTTESTRWVDSRDSDAKAAERWQQKS 153
11 2.000e-82gi|516020402|ref|WP_017450985.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum seropedicae]  clstr ali  39  1MPVRVQTADFDLSTEVAQLRLSNPRVGAVVSFVGTVRDLNEGVSAMELEHYPVMTERALEQIVQQAKARWPIFEALVIHRVGPLQPCEQIVLVAVTSPHRGEAFAACEFIMDYLKTQAPFWKKEQTPQGARWVDARESDDTALAKWTQQ. 151
12 3.000e-82gi|446272232|ref|WP_000350087.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio albensis]  clstr ali  42  4.RVSVQTEDFSVAQEYEALAQGS-QAGAVVTFVGKVRDMNDNVVGLHLEHYPGMTEKSLLEICDMAQERWPLQRVRIIHRIGDMLSGDQIVLVGVTSAHRNAAFAACEFIMDYLKTRAPFWKKELTTEASRWIDSRDSDHQAAQRWEQQ. 152
13 4.000e-82gi|515698157|ref|WP_017130757.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas agarici]  clstr ali  44  1MAIRVQTEAFDPGLEVNALHAANLGIGAVVSFVGYVRDFNDGVAQMFLEHYPGMTERALNKIVVQAQERWPLLGLEVVHRVGSLEPGEPIVFVGVTSAHRQAAFDACNFVMDYLKTQAPFWKKETTADGSRWVEGRASDQTAAGRWK... 149
14 4.000e-82gi|499462771|ref|WP_011149916.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio vulnificus]  clstr ali  39  4.RISVQVEDFDIAAEYAWLSQGS-AAGAIVTFVGKVRDMNDNVTGLSLEHYPGMTEKALGEICDQAEQRWPLLNVRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTETTRWVESRESDAQAAERWQS.. 151
15 4.000e-82gi|495387736|ref|WP_008112439.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum sp. YR522]  clstr ali  40  1MPVRVQTADFDLSTEVARLRLANPGVGAVVTFLGTVRDLNEGVSTLELEHYPAMTERALQQIVDQARARWPIFDALVIHRVGPMQPQEQIVLVAVTAPHRGEAFAACEFIMDYLKTQAPFWKKEQTPDGARWVDARESDDIARDKW.... 148
16 5.000e-82gi|498494624|ref|WP_010795360.1| molybdopterin synthase catalytic subunit [Pseudomonas sp. HPB0071]  clstr ali  51  1MTIRVQAEAFDPGVETSAMHAANVGVGAVVTFIGYVRDFNDGVSGLYLEHFPGMTEKSLAKIAQEANSRWPLLKVDIIHRVGRLEPGEPIVFVGTASAHRQAAFEACAFIMDYLKTRAPFWKKEDTPQGPRWVEGKSSDISAAQRWK... 149
17 6.000e-82gi|545467332|ref|WP_021703833.1| molybdopterin synthase catalytic subunit [Vibrio proteolyticus]  clstr ali  40  4.RVSVQQQDFSVGDEYQRLALGS-AAGAVVTFVGKVRDMNDNVTGLSLEHYPGMTEKSLLNICDQAEQRWPLLHTRVIHRVGDLDIGDQIVFVGVVSAHRGAAFEACEFIMDYLKTQAPFWKKERTTNQTRWVESRDSDTQAAKRWQK.. 151
18 6.000e-82gi|517970511|ref|WP_019140719.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum massiliense]  clstr ali  39  1MPIRVQTEDFDLSTEVARLRAGNPAIGAVASFIGTVRDVNDGVTGMELEHYPGMTEKALEAIVEQARQRWRVIDALVIHRVGPLKPLDQIVLVAVASAHRGDAFAACEFIMDFLKTQAPFWKKEQTAQGARWVDARVADDKALARWGENS 152
19 8.000e-82gi|520810561|ref|WP_020298409.1| molybdopterin converting factor, subunit 2 [Pseudomonas sp. CF161]  clstr ali  44  1MAIRVQCAAFDPGAEVNALHAANVGVGAVVSFVGYVRDFNDGVAGMFLEHYPGMTEKALAKIAAEAQERWPLLRLEVLHRIGELLPGEPIVFVGVASAHRQAAFEACAFVMDYLKTRAPFWKKENTCDGPRWVQGRDSDHAAADRWK... 149
20 1.000e-81gi|490372462|ref|WP_004252066.1| molybdopterin biosynthesis MoaE protein [Thauera sp. 63]  clstr ali  43  10.SVSVQQADFDVGGEIAALSEGRRDVGAIASFVGLVRDLNDGVSAMTLEHYPGMTEKALEEIVEQARQRWSLQGVRVIHRFGRLEPADRIVFVGVASPHRGEAFAACEFIMDYLKTRAPFWKCEETPGGARWVDARESDDSAAARWQ... 157
21 1.000e-81gi|515276746|ref|WP_016835080.1| molybdenum cofactor biosynthesis protein MoaE [Herbaspirillum lusitanum]  clstr ali  38  1MPIRVQTADFDLSAEIAALRLNNPKVGAVVSFVGTVRDLNDGVQEMELEHYPGMTEKALGQIVIDAKARWEIFDALVIHRVGPLQPLEQIVLVAVTAKHRGVAFAACEFIMDYLKTQAPFWKKERTPEGARWVDARESDDQALSKWQAD. 151
22 1.000e-81gi|498082618|ref|WP_010396774.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium lividum]  clstr ali  40  3ISVRVQQADFDLGQEIAQLRAGNPKVGAVVGFVGTVRDMNDGVAAMELEHYPGMTEKAILAIVEQARARWPVSAALVIHRVGPLLPQEQIVLVAVSSAHRGEAFAACEFIIDYLKTEAPFWKKEDTPEGARWVDARDSDATALDKWTAP. 153
23 2.000e-81gi|495646718|ref|WP_008371297.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. M47T1]  clstr ali  46  1MGVRVQPDAFDPGAEVNAMHAANVGVGAVVSFVGYVRDFNDGVSGMCLEHYPGMTEKALGKIVIEAEQRWPLLKVEVLHRVGALEPGEPIVFVGVASAHRQAAFDACNFIMDYLKTRAPFWKKEQTGEGERWVEGKASDNQAADRWQ... 149
24 2.000e-81JCVI_PEP_1096690715751 /source_dna_id=JCVI_ORF_1096690715750 /offset=0 /translation_table=11 /length=183 /full_length=183  ali  43  10MSVRVQEADFDLGAEIAALRAGRPNIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALAGIVSAAMQRWELIDALVIHRVGKLKPQDQIVLVAVASKHRGESFAACEFIMDYLKSEAPFWKKEQTPQGARWVDARVTDDKALVRWGIAS 161
25 2.000e-81gi|501368777|ref|WP_012400343.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia phymatum]  clstr ali  40  1MTVRVQTEDFDLSTEVAALRAQNPKVGAVACFVGTVRDINEGVETMELEHYPGMTEKSLEAIVDAARERWPGTEVLIVHRVGKLQPLDQIVLVATTSKHRGNAFASCEFVMDYLKTQAPFWKKEKTESGERWVDARVADEQALARWGLES 152
26 2.000e-81gi|519012700|ref|WP_020168575.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Methylotenera]  clstr ali  38  1MSIQVQTEDFDVGLLLNQLRLANPSAGALVSFVGQVRDMNDGVNTLTLEHYPGMTETALAAIETQAHARWNLIDTLVIHRVGTLKPLDQIVLVAVLSAHRGEAFKACEFIMDYLKTQAPFWKKEITPTGERWVDAKLSDDESLEKWSK.. 150
27 3.000e-81gi|512439510|ref|WP_016415330.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas anticariensis]  clstr ali  49  1.MIRVQHEPFDPGREQRALIQGRSDIGAVVSFTGLVRDFNEEVEALTLEHYPGMTESALTDIVKEAESRWPLQGVCVIHRVGRLTPGDPIVLVVVASAHRREAFEACDFIMDYLKTRAPFWKKEHTSSGHYWVAERASDQRDARRWEEP. 150
28 3.000e-81gi|504003220|ref|WP_014237214.1| molybdenum cofactor biosynthesis protein MoaE [Azospira oryzae]  clstr ali  42  1MSVRVQQEDFDLSAEVAALRAGQPGVGAVAAFVGLVRDMNEGVSEMALEHYPGMTEKALEAIVAEARARWDILGARIIHRVGTLQPCDQIVLVAVSSAHRGEAFAACEFIMDYLKTRAPFWKREVTPAGARWVDARETDDSAAARWEKGG 152
29 3.000e-81gi|496497410|ref|WP_009205946.1| molybdenum cofactor biosynthesis protein MoaE [Sulfuricella denitrificans]  clstr ali  40  1MEVRIQTEDFDLGAEILNLRRGNPGIGAVASFVGLVRDLNHSVTEMTLEHYPGMTEKALAEIMGEAKQRWNIIGALVIHRIGPLKPTDQIVLVAVSSAHRGDAFAACEFIMDYLKTRAPFWKKEQTEAGAHWVDARESDETAAQRWTAP. 151
30 3.000e-81gi|498503125|ref|WP_010803823.1| molybdopterin converting factor large subunit [Pandoraea sp. SD6-2]  clstr ali  39  1MPIRVQTEDFDLSEEIRQLRAGDLRVGAVASFVGTVRDLNDGVSRMTLEHYPGMTEKALEAIVVQARERWRLFDALVIHRYGDLGPGDQIVLVAVTSAHRGDAFAACEFIMDYLKTEAPFWKKESTPQGERWVDARETDTAARDRW.... 148
31 3.000e-81gi|515528283|ref|WP_016961500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio norvegicus]  clstr ali  40  1.MISVQHEDFSLAEEYQRLNDSDSD-GAIVTFIGKVRDMNDNVTGLTLEHYPGMTEKSLNEIVLQAKQRWPLTHIRVIHRVGALNIGDQIVFVGVTSAHRNAAFEACEFIMDYLKTRAPFWKKERLNDDERWVEARESDDTAANRW.... 146
32 3.000e-81gi|645567635|gb|KDP84409.1| molybdenum cofactor biosynthesis protein MoaE [Cupriavidus sp. SK-3]  clstr ali  46  1MSVRVQREDFDLGAEVAALRHGQPGVGAVASFIGTVRDMNDGVSAMELEHYPGMTEKALARIEAVARERWELLGVTIVHRVGPLLPLDQIVLVAVASAHRGNAFAACEFIMDYLKSEAPFWKKEQTPEGARWVDARVTDESALARWGIRS 152
33 3.000e-81gi|552548479|ref|WP_023006460.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. PBN3]  clstr ali  48  1.MIRVQQAPFDAGEEQRALLAGRTDIGAVVSFTGLVRDFNEEVAALTLEHYPGMTEAALAAIVDEARERWPLDGVSVIHRVGRLAPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHASDGDYWVSERDSDHADARRWE... 148
34 3.000e-81gi|499934847|ref|WP_011615581.1| molybdenum cofactor biosynthesis protein MoaE [Cupriavidus necator]  clstr ali  47  1MSVRVQREDFDLGAEVAALRAGNPAVGAVASFIGTVRDVSDGVSAMELEHYPGMTEKALAQIEAAACARWALLGVTIIHRVGPMQPLDQIVMVAVASAHRGNAFAACEFIMDYLKSEAPFWKKEDTPEGARWVDARVTDEAALQRWGIAS 152
35 4.000e-81gi|499607723|ref|WP_011288457.1| molybdenum cofactor biosynthesis protein MoaE [Dechloromonas aromatica]  clstr ali  43  1MTVRVQGADFDVGAELAALRAGDARVGALASFLGLVRDLNDGVSEMTLEHYPGMTEKALEEIVAEARGRWELYDALVIHRVGPLKPCEQIVLVAVTSAHRGEAFAACEFIMDYLKTRAPFWKREATPDGGRWVDARETDDSAAARWQK.. 150
36 5.000e-81gi|545464537|ref|WP_021701145.1| molybdopterin synthase catalytic subunit [Pseudomonas alcaligenes]  clstr ali  48  1MAVRVQVEAFDPGVEVNALHAANLGIGAVATFIGYVRDYNDGVRGMFLEHYPGMTEKALAGIIGEAEQRWPLLRVEVLHRVGRLQPGEPIVFVGIASAHRQAAFDACNFIMDYLKTRAPFWKKEDTPEGARWVEGRDSDQDAAARWSRS. 151
37 6.000e-81gi|503556070|ref|WP_013790146.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas fulva]  clstr ali  44  1MGIRVQQAVFDPGLETNAVHAANTGVGAVACFVGYVRDFNDGVAGMFLEHFPGMTEKALAGIESQARERWPLLGVEVIHRVGRLEPGEPIVFVGVASAHRQAAFQACEFIMDYLKTRAPFWKKEDTPSGPRWVEGRDSDQASARRWQADS 152
38 7.000e-81gi|647646214|ref|WP_025918140.1| molybdenum cofactor biosynthesis protein MoaE [Herminiimonas sp. CN]  clstr ali  40  1MPVRIQTEDFDLTTEVSQLRVANPKVGAVVAFVGTVRDLNDGIASMELEHYPGMTEKALEEIVQQARSRWVFFDALVIHRVGPLAPLDQIVLVAITSAHRGEAFAACEFIMDYLKTAAPFWKKEQTPNGARWVDARESDDQALAKWGISS 152
39 9.000e-81gi|505234450|ref|WP_015421552.1| molybdopterin biosynthesis protein MoaE [beta proteobacterium CB]  clstr ali  39  6..IRIQEQDFDLTSEVKALRKDDPRVGAVVTFVGTVRDMNDGVKGMTLEHYPGMTEKSLEVIIKQARSRWDLYKTLVIHRVGPLLPEDQIVLVAVTSAHRGEAFAACEFIMDYLKTAAPFWKKEDTPEGSKWVDARVTDDAAMARWN... 152
40 9.000e-81gi|653577431|ref|WP_027591052.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. RL]  clstr ali  46  1MSVRVQTASFDPGAELNALHAAQLGIGAVVGFVGYVRDYNDGVAGMYLEHYPGMTEKALAKIVTEAEARWPLLQVEVLHRVGALTPGEPIVFVGTASAHRQAAFAACDFIMDYLKTRAPFWKREDTAEGARWVEGRDSDQQAAARWDQ.. 150
41 1.000e-80gi|491624876|ref|WP_005482416.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio parahaemolyticus]  clstr ali  40  4.RVSVQVEDFSVDQEYQRLSEG-TASGAVVTFIGKVRDMNDNVIGLHLEHYPGMTEKSLSDICDEAEARWPLLGVRVIHRVGDMDSGDQIVFVGVSSAHRGAAFDACEFIMDYLKTKAPFWKKERTTNEDRWIESRDTDHQAARRWEN.. 151
42 1.000e-80gi|571266976|emb|CDG82223.1| moaE family protein [Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628]  clstr ali  43  4..VRIQTDDFDLSSEVARLRAGQPQVGAVVTFVGTVRDMNDGVSEMELEHYPGMTEQAITAIVEQAKQRWPLYGALVIHRVGPLKPLEQIVLVATSAAHRGEAFAACEFIIDYLKTEAPFWKKEQTPQGARWVDARVSDDIALSKW.... 149
43 1.000e-80gi|653585552|ref|WP_027598488.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. MOIL14HWK12:I2]  clstr ali  46  1MAIRVQAAAFDPGQELNALHAANTGIGAVVGFVGYVRDFNDGVGGLFLEHFPGMTEKALARIVEEAKQRWPLLGVDILHRVGRLEPGEPIVFVGTASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGPRWVEGRASDQDAAGRWAKE. 151
44 1.000e-80gi|489535383|ref|WP_003440110.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Pseudomonas]  clstr ali  44  1MTVRVQAAAFDPGAQVNALHAANLGVGAVVSFVGYVRDFNDGVAGMFLEHYPGMTEKALDKIVLEAEQRWPLLRLEVLHRVGALEPGEPIVFVGVASAHRQAAFDACAFVMDYLKTRAPFWKKEQTGDGPRWVEGRVSDEEAADRWKK.. 150
45 1.000e-80gi|499798751|ref|WP_011479485.1| molybdenum cofactor biosynthesis protein MoaE [Methylobacillus flagellatus]  clstr ali  38  1MTVRVQEQDFDVGEEITRLRLQYPQAGAVVSFTGQVRDLNDGVASLKLEHYPGMTEKSLAAIVEQARKRWPIFDAVVIHRIGTLAPQAQIVLVVVASAHRGDAFAACEFIMDYLKTEAPFWKKEATPEGEKWLDSRESDQAARGRWQ... 149
46 1.000e-80gi|546180324|ref|WP_021821045.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. BJGMM-B45]  clstr ali  46  1.MIKVQYEPFDAGQEQQSLLAGRTDIGAVVSFTGLVRDFNEDVEALTLEHYPGMTEASLVQIADEAHQRWSLSGLTLIHRVGRLAPGDPIVLVIVASEHRRAAYEACEFLMDYLKTRAPFWKKEHTASGDYWVSEREQDHADAQRWE... 148
47 1.000e-80JGI.Meta 7062523745 SRS017227_Baylor_scaffold_27253__gene_31941 moaE protein [Human Supragingival plaque microbiome from visit number 1 of s  ali  42  53.HVCVQTGDFDVGAELRRLQRLTLETGGVASFVGYVRDTNQGIGGLTLEHYPGMTERSLERICAQAEARWPLLGVTVIHRVGPLAPGDQIVLVATASRHRDAAFESCRFIMDYLKTEAPFWKKESTPDGERWVDARDSDEAARRRWEQ.. 201
48 2.000e-80gi|515577318|ref|WP_017010076.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio calviensis]  clstr ali  40  1.MISVQRDDFSVAEEYQWLN-DNASDGAVVTFVGKVRDMNDNVTGLTLEHYPGMTEKSLEEICNDAKTRWPLGKVRVIHRVGALNLGDQIVFVGVSSAHRKAAFDACEFIMDFLKTRAPFWKKEKLVDDERWIEARDSDDEAANRW.... 146
49 2.000e-80gi|517253955|ref|WP_018442773.1| hypothetical protein [Burkholderia sp. JPY347]  clstr ali  43  1MTVRVQTADFDLTAEVAALRAQNPKVGAVACFIGTVRDLNEGVAAMELEHYPGMTEKALEAIVDEARLRWPGSDVLIVHRVGKLYPLDQIVLAAATASHRHDAFAACEFVMDYLKTQAPFWKKETTEAGERWVDARASDDEALARWGLSA 152
50 2.000e-80gi|494074662|ref|WP_007016718.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bermanella marisrubri]  clstr ali  34  4..IAVQEADFDIAQEYQAMRQDNPNDGAIVFFTGLVRDFNQGVTGLFLEHYPGMTEKSLENIVEQAKQRWPINRVSLIHRIGQLHISDQIVFVSASSPHREAAFDACRFIMDYLKHEAPFWKKETTQEGDRWVKANQKDKDALKKW.... 149
51 2.000e-80gi|498314166|ref|WP_010628322.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. KM-1]  clstr ali  48  1.MIRVQEAPFDAGVEQQRLLADRSDIGAVVSFTGLVRDFNEDVTALTLEHYPGMTEAALGEIVNQAEARWSLQGVRVIHRVGRLTPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHSITGDYWVAERESDYRDASRWESE. 150
52 2.000e-80gi|502912950|ref|WP_013147926.1| molybdenum cofactor biosynthesis protein MoaE [Methylotenera versatilis]  clstr ali  42  1MTVRVQTQDFDAGFEISLLRNARKDTGAVVSFIGQVRDLNEGVSQLTLEHYPGMTEKALEAIVNQAQSRWDIFDAIVIHRVGILQPTDQIVLVAVSSAHRGEAFKACEFIMDYLKTEAPFWKKEVTSQGERWVDAKLTDDDARERWK... 149
53 2.000e-80gi|493273383|ref|WP_006231194.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium profundum]  clstr ali  38  1.MISVQFDDFSVAEEYALLSEG-TDAGAVVTFIGKVRDFNDDVTGLSLEHYPGMTEKSLEEIVVQARERWPLLKTRVIHRVGDLGLGDQIVFVGVTSAHRGAAFEACEFIMDFLKTRAPFWKKEQTSNETRWVDARDTDTSAADRWQNK. 149
54 2.000e-80gi|506312188|ref|WP_015831963.1| molybdenum cofactor biosynthesis protein MoaE [Methylotenera mobilis]  clstr ali  40  1MTVRVQTADFDIGAEINQLRQARKNVGAVVSFVGLVRDLNDGVSQLTLEHYPGMTEKSLAAIIEQAKNRWSIMDALIVHRVGTLQPSDQIVLVIVTSAHRGDAFSACEFMMDYLKTEAPFWKKEANSTGEHWIEAKSADDTARDRWNIE. 151
55 3.000e-80gi|504859354|ref|WP_015046456.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Simiduia agarivorans]  clstr ali  40  4.HIAVQTEDFDHTSLYQRLLSDTPEIGAIVTFTGLVRDLNDAVAGLFLEHYPGMTEKSLQAIVDEARQRWPIMRVELIHRVGQLAPADQIVYVGVSASHRGDAFAACEFIMDYLKTRAPFWKREATPEGDRWVDARDSDHQAATRWK... 151
56 3.000e-80gi|488498503|ref|WP_002541945.1| Molybdenum cofactor biosynthesis protein MoaE [Grimontia sp. AK16]  clstr ali  40  1.MISVQEQDFSVADEYQRL-NDHAGDGAIVTFIGKVRDMNDNVTGLTLEHYPGMTEKSLAEIVEQAKSRWPLTHVRVIHRVGALDIGDQIVFVGVSSAHRGAAFEACEFVMDYLKTKAPFWKKERLTDQERWIEARDSDEDAAKRW.... 146
57 3.000e-80gi|490864602|ref|WP_004726636.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio furnissii]  clstr ali  42  4.RVSVQTQDFSVADEYAQLSAG-TQAGAVVTFVGKVRDMNDNVAGLHLEHYPGMTEKALLEICDEAARRWPLQNVRVIHRVGDMDIGDQIVFVGVSSAHRSASFEACEFVMDYLKTKAPFWKKERTTEATRWVDSRESDAKAAERWQQ.. 151
58 4.000e-80gi|501325853|ref|WP_012357488.1| molybdenum cofactor biosynthesis protein MoaE [Polynucleobacter necessarius]  clstr ali  35  25MSIRIQEGDFDLSFEIASLRKGDPRVGAAVAFLGTVWDMNDGIKGMTLEHYPGMTEKSLQEILDQAKARWDIYHTLVIHRIGSLLPEDQIVLVAVTSAHRGEAFAACEFIMDYLKTAAPFWKKEDTPDGARWVDARVTDEAAMARWKK.. 174
59 4.000e-80gi|495338036|ref|WP_008062772.1| molybdenum cofactor biosynthesis protein MoaE [Methyloversatilis universalis]  clstr ali  44  3VSVSVQQADFDIGAEIDALLAGRTDVGAVATFTGLVRDINDGVHAMTLEHYPGMTEAALEDIVAQAKARWDILAVRVIHRVGTLQPADRIVLVIVAGSHRGEAFSACEFIMDYLKTRAPFWKREDTPDGSRWVDARDSDDSAAQRWMQQG 154
60 4.000e-80gi|503207844|ref|WP_013442505.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Methylovorus]  clstr ali  40  1MTIRVQADDFDVGAEINRLRQQRPDIGAVAAFVGQVRDLNQGIAGMTLEHYPGMTEKSLEAIVQQAKARWDIMDAVVIHRIGELKPLDQIVLVAVAGAHRGEAFHACEFIMDYLKTEAPFWKKEQTPEGERWVDARSSDDAARARWQ... 149
61 4.000e-80gi|491911942|ref|WP_005666787.1| molybdopterin synthase catalytic subunit [Massilia timonae]  clstr ali  40  4..VRVQAGDFDLGQEVARLRANDARIGAVVSFVGTVRDLNDGVSEMELEHYPGMTEKSLEAIAARACERWPLYGTLVIHRVGPLAPLDQIVLVACSAAHRGDAFAACEFIMDYLKTEAPFWKKEQTPDGARWVDARVTDDSAKARWEAP. 152
62 4.000e-80gi|518547882|ref|WP_019718089.1| molybdenum cofactor biosynthesis protein MoaE [Ralstonia solanacearum]  clstr ali  43  3.TIRVQEADFDLGAEIAALRAGRPQIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALANIVDAAMQRWDLIDALVIHRVGKLRPEDQIVLVAVASGHRGEAFAACEFIMDYLKSEAPFWKKEQTAQGARWVDARVTDERALARWG... 150
63 6.000e-80gi|551344449|ref|WP_022963861.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas pelagia]  clstr ali  41  1MAITVQTASFDPGAMLNRLHAQQLGVGAVVGFTGYVRDFNDGVAGMLLEHYPGMTEKALQIIVDEAQGRWPLLSVEVLHRVGRLEPGEPIVFVGVSSAHRAAAFDACQFIMDYLKTRAPFWKKEDSADGPRWVDARDSDSQALDKW.... 148
64 6.000e-80gi|517436410|ref|WP_018607297.1| hypothetical protein [Uliginosibacterium gangwonense]  clstr ali  40  1MSVSVQHTDFDLDAETAHLASVSHNVGAVATFLGYVR-GDDALAAMTLEHYPGMTEKSLADIVSQAQARWPLLAVRVIHRIGRLLPGERIVFVGVASRHRGAAFDACEFIMDYLKTRAPFWKKEETEQGARWVDARDSDESALEKWGK.. 147
65 8.000e-80gi|500232694|ref|WP_011902287.1| molybdenum cofactor biosynthesis protein MoaE [Polynucleobacter necessarius]  clstr ali  39  6..IRIQEQDFDLSAEIVALRKGDARVGAVVSFLGTVRDLSDGVKGMTLEHYPGMTEKSLQAILDQAATRWNIFQTLVIHRVGLLLPEDQIVLVAVTSAHRGEAFSACEFIMDYLKTAAPFWKKEDTPEGSRWVDARVTDETAMARWNKS. 154
66 8.000e-80gi|516387084|ref|WP_017776760.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia kururiensis]  clstr ali  41  1MTVRVQTEDFDLSAEVAALRAQNPRIGAVACFVGTVRDLNEGVEAMELEHYPGMTEKALADIVDAARDRWRGVDVLIVHRVGKLYPLDQIVLVATTSAHRGDAFASCEFVMDYLKTQAPFWKKEKTAAGECWVDARESDDAALARWGIKS 152
67 2.000e-79gi|518389273|ref|WP_019559480.1| molybdenum cofactor biosynthesis protein MoaE [Caldimonas manganoxidans]  clstr ali  43  5.RVRIQTEDFDLGAEVAALRAGDPAVGAVAVFVGTVRDHNDGVRCMELEHYPGMTEKAIEAMIDEAQRRFEIRAARVIHRVGLLQPQDQIVYVGVTSAHRAEAFRACEFLMDYLKTQAPFWKKETTPAGARWVDARLSDDEALRRWGIEA 155
68 2.000e-79gi|505248350|ref|WP_015435452.1| molybdenum cofactor biosynthesis protein E [Azoarcus sp. KH32C]  clstr ali  45  1MSVSVQESDFDVGAEIAALSEDRREVGAVASFVGLVRDISEGVAAMTLEHYPGMTEQALEEIVAEARSRWSLHAVRVIHRYGRLEPGDRIVFVGVAGAHRGESFAACEFIMDYLKTRAPFWKKEETPDGARWVDARDSDDSAARRWER.. 150
69 2.000e-79gi|496181812|ref|WP_008906319.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. NO-1]  clstr ali  38  5.RVSIQTEDFDLSTEVAALRRENKGIGAVCSFIGTVRDRNEGVSSMELEHYPGMTEKSIEAMVDEAFRRFDIFGARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEETPQGARWVDARVSDDAALARWGITA 155
70 2.000e-79gi|519208746|gb|EPM92880.1| molybdenum cofactor biosynthesis protein E [Pseudomonas syringae pv. actinidiae ICMP 19070]  clstr ali  43  1MTIRVQAAAFDPGTEVNALHAANLGIGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALAKIVEEAEQRWPLLRLDVLHRVGALEPGEPIVFVGVASAHRQAAFEACDFVMDYLKTRAPFWKKENTSQGPQWVEGRDSDQAAXS...... 146
71 2.000e-79gi|550701364|ref|WP_022639464.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. CMAA1215]  clstr ali  46  1MGIQVQQQAFSLDALNTALQAGDPAVGAVVTFVGYVRDLNQAVQSLFLEHYPGMTERSLRGIVAQAEQRWPLLRVELVHRVGLLRVGEPIVFVGVASAHRQAAFEACDFIMDYLKTRAPFWKREVTDSGEHWVEGRASDQQAASRWQQP. 151
72 2.000e-79gi|515607741|ref|WP_017040341.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio genomosp. F10]  clstr ali  41  4.RISVQQTDFSVADEYEKLSQG-TEPGAVVTFIGKVRDMNDNVTGLSLEHYPGMTEKALSEICDKAEERWPLLALSVIHRVGDLDIGDQIVFVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTQTTRWVESRDSDAQAALRWK... 150
73 3.000e-79gi|503112490|ref|WP_013347223.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Ferrimonas balearica]  clstr ali  37  1.MIAVQTQDFSVADEYAKL-ADNPGCGAVVTFVGKVRDFGDGVSAMTLEHYPGMTEAVLHQIEAEARQRWPLDEVTIIHRVGELQLCDQIVFIGVSSAHRKAAFAACEFLIDFLKTRAPFWKKETSDDGTVWVDAKDADQQAAEQWQR.. 148
74 3.000e-79gi|640742941|ref|WP_025164997.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas taeanensis]  clstr ali  46  1MAIRVQLDAFDPGVETNALHAANVGVGAVVSFVGYVRDFNDGVGGMFLEHFPGMTEKALTKIAVEAEQRWPLLNIQIIHRIGRLEPGEPIVFVATASAHRQAAFDACAFVMDYLKTRAPFWKKEDTSEGPRWVEGRSSDQSAAERWHK.. 150
75 3.000e-79gi|516564861|ref|WP_017940047.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas thermotolerans]  clstr ali  47  1MAIRVQSETFDPGLELNALHAANRGIGAVVGFVGYVRDFNDGVAALFLEHAPGMTEKALARIVAEAEQRWPLLGVEVLHRVGHLQPGEPIVFVGTASAHRQAAFEACNFIMDYLKTRAPFWKKEDTPEGPRWVEGRDSDLAAAERWRR.. 150
76 3.000e-79gi|515593072|ref|WP_017025711.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio rumoiensis]  clstr ali  39  6.MVSVQFDDFDIGLEYQHLSQG-TQAGAVVTFVGKVRDMNDSVTGLSLEHYPGMTERSLIQICEQAKSRWPLLNIRVIHRVGDLDLGDQIVFVGVSSAHRNAAFEACEFVMDYLKTQAPFWKKERTTDDVRWVESRDSDAKAADRWK... 152
77 4.000e-79gi|646773965|gb|KDR43811.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia glathei]  clstr ali  42  6.RVRVQEADFDISTEVAALRAQNPKVGAVACFVGTVRDLNEGVETMELEHYPGMTEKSLEAIAAQARERWPGSDVLIVHRIGKLKPLDQIVLVATTAMHRADAFESCAFVMDYLKTQAPFWKKEKTEAGERWVDARESDDSALARWGVEA 156
78 4.000e-79gi|517332721|ref|WP_018508213.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus thioparus]  clstr ali  47  1MKILVQSEAFELGAEVDALRRGRTDIGAIASFVGLARDMNDGVAAMTLEHYPGMTEKALAALVEEAQSRWTLLDVTLIHRVGRLLPGDPIVLVAVAGSHRGEAFAACEFIMDYLKTRAPFWKKEVTPEGERWVEARASDDVAATRWGK.. 150
79 4.000e-79gi|492969924|ref|WP_006072953.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio shilonii]  clstr ali  39  4.RVSVQHEDFSVGAEYDALAEG-TASGAIVTFTGKVRDMNDNVTGLSLEHYPGMTERSLEKICDEAEERWMLNGIRVIHRVGDMDAGDQIVFVGVSSAHRGSAFEACEFIMDYLKTKAPFWKKERTTESTRWVESRDSDAEAAARWQEK. 152
80 6.000e-79gi|501401258|ref|WP_012432824.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia phytofirmans]  clstr ali  41  1MPVRVQTEDFDLTAEVAALRARNPKIGAVACFVGTVRDLNDGVETMELEHYPGMTEKSLEAIIVSARERWPGIEVSIVHRVGKLYPLDQIVMVATTAAHRGEAFVSCEFVMDYLKTQAPFWKKEKTEAGERWVDARVTDDAALARWGIKS 152
81 7.000e-79gi|517757558|ref|WP_018927766.1| MULTISPECIES: hypothetical protein [Pseudomonas]  clstr ali  41  1.MIRVQTERFEPGTEINALQALSLNVGAVVSFVGYVRDTNQEVAGMFLEHYPGMTEKVLGKIADEARQRWPLLGLVLIHRIGALQPGDPIVFVGVSSSHRQAAFDACAFVMDYLKTRAPFWKKEQVAESSHWVEARHSDREAAQRWE... 148
82 9.000e-79gi|493460101|ref|WP_006415335.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia multivorans]  clstr ali  44  4.TVRVQTDDFDLNAEVAALRARNPKIGAVACFVGTVRDLNEGVAALELEHYPGMTEKALEKIAAEAGRRWPGIDVAIVHRVGKLYPLDQIVMVATVAAHRGDAFASCEFVMDYLKTDAPFWKKETTPNGERWVDARSTDDAALARWGIES 154
83 1.000e-78gi|577704125|gb|EUJ10271.1| molybdopterin converting factor, large subunit [Methylophilaceae bacterium 11]  clstr ali  36  15..VKVQIEDFDVGEVLASVRRDHPQIGAIVSFVGLVRDMNDSVTTLTLEHYPEMTEKSLQAIVDQAQQRWDIMDAVVIHRVGTLKPLDQIVLVVISSAHRQAAFSACEFVMDYLKTQAPFWKKETNNESERWVEAKSSDDQAQARWQS.. 162
84 1.000e-78gi|499826640|ref|WP_011507374.1| molybdenum cofactor biosynthesis protein MoaE [Chromohalobacter salexigens]  clstr ali  48  2IEVRVQSAVFDVGEEQQRLLSGRHDVGAVVTFTGLVRDFNEDVEALSLEHYPGMTEAALHDIARQATARWPLDGIRIVHRIGRLSPGDPIVLVMVASAHRRAAFEACDFLMDYLKTRAPFWKKEHTASGTYWVSARDSDAQDAARWE... 150
85 1.000e-78gi|501315412|ref|WP_012347047.1| molybdenum cofactor biosynthesis protein MoaE [Leptothrix cholodnii]  clstr ali  43  5.RVTIQQADFDLSAEVAALRAGDGGVGAVASFIGTVRDRSDGVSAMELEHYPGMTERSIEAMIDTALQRFDIRAARVIHRVGLLQPQDQIVLVAVSSAHRGQAFQACEFLMDYLKTEAPFWKKETTPEGARWVDARVSDDDALRRWG... 152
86 1.000e-78gi|647595513|ref|WP_025872151.1| molybdenum cofactor biosynthesis protein MoaE [Methylobacillus glycogenes]  clstr ali  38  1MTVRVQAEDFDLGAEVRQLRLQSAGAGAVVSFVGQVRDLNENVASLTLEHYPGMTEKALQAIVTQAQARWPILNALVIHRIGTLQPLDQIVLVAVASAHRGDAFAACEFIMDYLKTEAPFWKKESSSKGEQWLEALGTDHQARERW.... 148
87 1.000e-78gi|497206393|ref|WP_009520655.1| molybdenum cofactor biosynthesis protein MoaE [Hydrogenophaga sp. PBC]  clstr ali  38  6.RVSIQTADFDLSTEVARLREQDKGVGAVCSFIGTVRDRNDGVSAMELEHYPGMTEKAVEAMIDEAFRRFQILGARVIHRVGPLQPLDQIVLVVVSSAHRGQSFQACEFLMDYLKTQAPFWKKEETPEGARWVDARVSDDAALARWGIQA 156
88 1.000e-78gi|497352952|ref|WP_009667165.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium IMCC9480]  clstr ali  40  1MTIRIQQADFDMSTELANLRAGSPQVGAIVSFVGTVRDLNDGVSQMELEHYPGMTEKSIAVIVERARAHWPIADALVIHRIGPLLPTEQIVLVAVAAAHRGEAFAACEFIMDYLKTEAPFWKKEQTPEGARWVDARAVDDAALAKW.... 148
89 2.000e-78gi|518358900|ref|WP_019529107.1| hypothetical protein [Dasania marina]  clstr ali  39  5..VRVQTADFDVSTELNLLRQQSLQTGAVVNFVGTVRDIHNGIANMELEHYPGMTEKSIQDITLQAAQRWQLLAATVIHRVGLLQPGEQIVLVAVSSQHRGEAFQACEFIMDYLKTQAPFWKKEQTEQGAQWLDARESDGEAAKRWQ... 151
90 2.000e-78gi|505449036|ref|WP_015636138.1| molybdopterin synthase catalytic subunit MoaE [Pseudomonas protegens]  clstr ali  44  1MSIQVQTQALSLDQLNAGLQAGDASVGGVVTFVGYVRDLNEAVHSLFLEHYPGMTERSLQRIVEQAQARWPLNRVSLVHRVGLLQVGEPIVFVGVASAHRQAAFEACAFIMDYLKTRAPFWKREVTPAGERWIDGRESDRQAAERWGVE. 151
91 2.000e-78gi|556740201|ref|XP_005965647.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Pantholops hodgsonii]  clstr ali  42  23.RVSIQTEDFDVSAELAALRSGDARVGAVCSFIGTVRDRNEGVASMELEHYPGMTEKSIEAIIDEAVQRFGIHGARVIHRIGPLQPMDQIVLVAVTASHRGMAFQACEYIMDYLKSLAPFWKKEQTPEGARWVDARVSDEEALARWRQ.. 171
92 2.000e-78METAHIT O2 GL0072640 [Complete] locus=scaffold47540_3:1953:2417:+  ali  41  8..ILVTTEPFDIGEETARIREGSPDMGAIVTFTGVVRNVNDGVTAMTLEHYPGMTQKSLAKIVETARGRWPLGDVTVIHRVGRMVVGEEIVLVAVASRHRHAAFEAASFIMDWLKTEAPFWKKEETPEGARWVDARESDDLAKARWG... 154
93 2.000e-78gi|584383274|gb|EWH00247.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. BC04]  clstr ali  48  7..VQVRHEPFDAGVEQQRLLADRSDIGAVVSFTGLVRDFNEDVTALTLEHYPGMTESALSDIVTEAEMRWPLQGVRLIHRVGRMTPGDPIVLVVVASAHRREAFEACDFIMDYLKTRAPFWKKEHSVSGDYWVAERESDHQDASRWEGD. 155
94 2.000e-78gi|517819956|ref|WP_018990164.1| molybdenum cofactor biosynthesis protein MoaE [Azoarcus toluclasticus]  clstr ali  48  1MTVSVQAEDFDVGAEIAALSAGRNEVGAVATFLGLVRDVSGGVGAMTLEHYPGMTEASLEEIVVQARARWSLYAVRVIHRFGRLEPGDRIVFVGVAGAHRGETFAACEFIMDYLKTRAPFWKLEETPEGARWVDARDSDDSAAARWEQGG 152
95 2.000e-78gi|516713441|ref|WP_018059390.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium JGI 0001004-K23]  clstr ali  40  4..VRVQTADFDVSAELAALRAGDARVGALVTFVGTVRDMNEGVAEMELEHYPGMTERAIETIVEQARARWPLFAALVIHRVGPLKPMEQIVLVACTAAHRGEAFAACEFIIDYLKTEAPFWKKEQTPDGARWVDARVSDDQALRKWSAS. 152
96 2.000e-78gi|515618893|ref|WP_017051493.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio genomosp. F6]  clstr ali  38  5.RVSVQYDDFSIADEYEILAKG-TSAGAVVTFVGKVRDMNDNVIGLRLEHYPGMTEKSLAEICDQAEARWPLLGVRVIHRVGDLDIGDQIVYVGVSSAHRGASFEACEFIMDYLKTSAPFWKKERTTQESRWVESRDSDAKAAERWEN.. 152
97 2.000e-78gi|492901543|ref|WP_006031949.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Moritella sp. PE36]  clstr ali  40  5.TIQIQTEDFDLATEYAALGKSH-STGAVVTFIGKVRDFNQGVSGLTLEHYPGMTEKSLAKILIEAETRWSIQGVKVIHRIGELALGDQIVFVGVASMHRGDAFQACEFIMDYLKTQAPFWKKEATQAGSHWVDARETDTTAADRWK... 151
98 2.000e-78gi|544667940|ref|WP_021101295.1| Molybdenum cofactor biosynthesis protein MoaE [Thalassobacter arenae]  clstr ali  42  1MRVLVQEALFDAGAELNAFAKGDTDIGAVVSFTGVTRDVSGGLSRMLIEHYPGMTERALTQICEEAQTRWSLADVLVIHRFGTMEPGDNIMMVATASRHRADAFAAAEFLMDYLKSRAPFWKKEITADGSEWVAAKDSDEDALDRWS... 147
99 3.000e-78gi|500842046|ref|WP_012005758.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia proteamaculans]  clstr ali  42  6.RIRVGEAPFNVGEEYQWLAQCDDD-GAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALAEIVDEARSRWPLQRATVIHRVGELFPGDEIVFVGVTSAHRSMAFEASEFIMDYLKTRAPFWKREAVGQGDRWVDARDSDRQAAERWHK.. 153
100 3.000e-78  ali  41  8..ILVTTEPFDIGEETARIREGSPDMGAIVTFTGVVRNVNDGVTAMTLEHYPGMTQKSLAKIVETARGRWPLGDVTVIHRVGRMVVGEEIVLVAVASRHRHAAFEAASFIMDWLKTEAPFWKKEETPEGARWVDARESDEEAKARWS... 154
101 3.000e-78gi|502599921|ref|WP_012837296.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas testosteroni]  clstr ali  40  15.RVSIQTQDFDLSAEIAALRAGDARVGAVCSFVGTVRDRNEGVSSMELEHYPGMTEKSIEAIIDKAVARFGIYGARVIHRIGLLQPMDQIVLVAVSSAHRGKSFEACEYIMDYLKSEAPFWKKEQTEQGARWVDARVSDEQALARWATP. 164
102 3.000e-78gi|500255449|ref|WP_011912357.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  45  1MAVRVQQGSFDPGAELNALHAANLGIGAVAGFVGYVRDFNDGVAGMFLEHAPGMTEKALEKIVQEAEQRWPLLRLDVLHRVGSLEPGEPIVFVGAASAHRDAAFDACRFVMDYLKTRAPFWKKENTSAGPRWVEGRASDQLAAERWNEES 152
103 3.000e-78gi|501059842|ref|WP_012111193.1| molybdenum cofactor biosynthesis protein MoaE [Parvibaculum lavamentivorans]  clstr ali  43  1.MIRIQTEDFDIGAEIAALTEGRTDIGAVVTFSGLVR-ETGGIASMELEHYPGMTEKKLARIESEATARWPLQATLIIHRVGKLLPGDNIVLVVAASAHRQAAFDAASFLMDYLKTRAPFWKREQTGDKSHWVDARESDGTAAAKWD... 145
104 3.000e-78gi|503623182|ref|WP_013857258.1| MULTISPECIES: molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio]  clstr ali  40  5.RISVQISDFSVDAEYRDLSQG-TSAGAVVTFIGKVRDMNDNVIGLTLEHYPGMTEKALSDICDQAQARWPVQKIRVIHRIGDLDIGDQIVFVGVSSSHRGAAFEACEFVMDYLKAKAPFWKKERTTEQTRWVESRDSDAQAAQRW.... 150
105 3.000e-78gi|499630805|ref|WP_011311539.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  48  1MKIAVQNEAFDLGSEVAALTHGRRDVGAVASFVGLARDINEGVAAMTLEHYPGMTEKALAALVDEACARWALLDVSVVHRVGRLLPGDPIVLVAVASAHRGEAFAACEFIMDALKTRAPFWKKEETPDGERWVEARASDEAAAGRWEK.. 150
106 4.000e-78gi|499558804|ref|WP_011239587.1| molybdenum cofactor biosynthesis protein MoaE [Aromatoleum aromaticum]  clstr ali  45  1MSVSVQQADFDVGAEIAALSQGRHEVGAVASFVGLVRDVSGGVAAMTLEHYPGMTERSLEDIVGEARRRWQLDGVRVIHRYGRLEPGDRIVFVGVAGAHRGEAFAACEFVMDYLKTRAPFWKLEETPDGAHWVDARDSDDSAAARWD... 149
107 7.000e-78gi|503305880|ref|WP_013540541.1| molybdenum cofactor biosynthesis protein MoaE [Variovorax paradoxus]  clstr ali  40  5.RVSIQTGDFDLSQELGALRAGDKRVGAVCSFIGTVRDRNDGVASMELEHYPGMTEKAIEAMIDEAHKRFDILGARVIHRVGLLQPLDQIMMVAVISAHRGQSFEACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGISA 155
108 7.000e-78gi|492768500|ref|WP_005958651.1| molybdenum cofactor biosynthesis protein MoaE [endosymbiont of Riftia pachyptila]  clstr ali  41  6..IRVQSEPFDPNVEVDLLRNHSPSIGGVVSFIGQVRDFNDDVLAMTLEHYPGMTEKALAAIVDEANARWELMGVRVVHRVGRMLPKDPIVLVAVASSHRGEAFQACEFIIDYLKTRAPFWKREESVEGARWVDARESDDHAEARWK... 152
109 7.000e-78gi|653279354|ref|WP_027475777.1| molybdenum cofactor biosynthesis protein MoaE [Curvibacter gracilis]  clstr ali  40  6.RVAIQTADFDVSAELAALRAHDRRVGAVCSFVGTVRGGNEGVLSMELEHYPGMTERAIEAMIDQAHQRFDLYGARVVHRVGLLQPGEQIVLVAVTSAHRGQSFLGCEFLMDYLKTQAPFWKKEQTPQGAHWVDARVSDDAALARWGIEA 159
110 8.000e-78gi|518762895|ref|WP_019920184.1| hypothetical protein [Duganella zoogloeoides]  clstr ali  39  10..VRIQTEDFDLTTEVARLRAANPKIGAVVTFVGAVRDLNDGVAEMELEHYPGMTEQSIAAIIEQARLRWPTFGALVIHRVGPLKPLDQIVLVAATAAHRGEAFAACEFIIDYLKTDAPFWKKEVTPDGARWVDARVSDDAALAKWRGAA 159
111 8.000e-78gi|652565514|ref|WP_026959003.1| hypothetical protein [Aliagarivorans taiwanensis]  clstr ali  40  1.MISVQKEDFDVAALYQALQQ-NPSSGAVVTFTGLVRDLNLGVNALFIEHYPGMTERALSDIVEQAKQRWPINDVAVVHRVGRLEVNQQIVFVGVNSAHRQAAFDACEFIMDYLKTSAPFWKKELSDQGEQWLEQRESDRVASKRWS... 147
112 8.000e-78gi|648566472|ref|WP_026258223.1| molybdenum cofactor biosynthesis protein MoaE [Endozoicomonas elysicola]  clstr ali  43  1MRISIQVEDFNLGHEYERL-EGNKSSGAIVTFTGTVRDMNDEVGGLFLEHYPGMTEKALQEIIDEAMERWELQVVRVIHRIGQMHPGDRIVFVGVVSAHRKEAFAACEFIMDYLKTRAPFWKKETTPEGDRWVDERESDQEAADRW.... 149
113 9.000e-78gi|504058685|ref|WP_014292679.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Oceanimonas sp. GK1]  clstr ali  39  1.MIRVQTEDFCLATEYAALSQSH-QTGAVVTFVGKVREMNQGVSGMTLEHYPGMTEHALAQIVSEAQGRWPLLECRVIHRVGALELGDQIVFVGVASAHREAAFAACHFIMDYLKTRAPFWKKERTADGERWVDAKDSDTDAARKW.... 146
114 9.000e-78gi|651335424|ref|WP_026458667.1| molybdenum cofactor biosynthesis protein MoaE [Aeromonas enteropelogenes]  clstr ali  39  9.RILVQQADFSLADEYARL-ATRADTGAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALIEIVAEARRRWPLQECTLIHRIGELMLGDQIVLVAVSSAHREAAFDACHFIMDFLKTRAPFWKKELTADGKRWVDAKESDNAAAARWQQPG 159
115 1.000e-77gi|644514489|ref|WP_025326414.1| molybdenum cofactor biosynthesis protein MoaE [Aeromonas hydrophila]  clstr ali  42  12.RILVQRADFSLGEEYERL-ATRHDTGAIVTFVGKVRDFNQGVKGLSLEHYPGMTEKALADIVAQARARWPLQECTLIHRIGDLLLGDQIVLVAVSSAHRDAAFEACHFIMDFLKTRAPFWKKELTAEGQRWVEAKQSDDAAAARWRQ.. 160
116 1.000e-77gi|543577454|ref|WP_021025925.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas sp. B-9]  clstr ali  40  5.HIAVQTADFDVSEELRLLRAADGRIGAVCSFVGTVRDRNAGVATMELEHYPGMTEKSIAQMVEAASQRFDIFGARIIHRVGLLAPGEQIVLVAVSSAHRGESFQACEFLMDYLKTEAPFWKKEDTPEGARWVDARVSDEAAMARWGLP. 154
117 1.000e-77gi|489380450|ref|WP_003287142.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  43  1MSVRVQQAAFDPGAELNALHAANLGIGAVAAFVGYVRDFNDGIAGMFLEHAPGMTEKALGKIIAEAETRWPLLGIDVLHRVGALEPGEPIVFVGVTSAHREAAFEACRFVMDYLKTRAPFWKKESTPAGERWVDGRDSDQAAAERWQR.. 150
118 1.000e-77gi|503667651|ref|WP_013901727.1| molybdenum cofactor biosynthesis protein MoaE [Ramlibacter tataouinensis]  clstr ali  40  6.RVVIQEQDFDLSAEVAALRGRDTGVGAVCCFVGTVRDRNDGVSTLELEHYPGMTEKAIEAMIDEAMRRFDIRAARVVHRIGPLQPQEQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEQTPTGARWVDARVSDDAALARWGIAS 156
119 1.000e-77gi|492246237|ref|WP_005788105.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas synxantha]  clstr ali  47  1MPIQVQTELLDLGELTRSVHAEDPGVGAVATFVGYVRDINQGVSALFLEHYPGMTERALQLIVDQAHERWPLQRVSIVHRVGPLKVGEPIVFVGVASQHRLDAFEACAFLMDYLKTRAPFWKREQTPAGERWVEGRESDRLAQERW.... 148
120 1.000e-77gi|522194885|ref|WP_020702352.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium AB_14]  clstr ali  36  9..VRIQTEDFDLSTELARLRAANPKVGAIVNFVGTVRDLNEGVAEMELEHYAGMTEQSILAIIEQARQRWPVFGALVIHRVGPLKPLEQIVLVAVTSAHRGEAFAACEYIIDFLKTEAPFWKKEQTPAGARWVDARVSDDVALKKWSIE. 157
121 1.000e-77gi|639200847|ref|WP_024539282.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas badia]  clstr ali  39  5..VSIQTEDFDVSREIARLRAEDARVGAVCCFVGTVRDGSGQVSSMELEHYPGMTEKSIAAMIDEARRRFDFYGVRVIHRVGLLQPEDQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEATPEGTQWVDARESDDAALRRWGIQA 154
122 2.000e-77gi|517848139|ref|WP_019018347.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas lutea]  clstr ali  46  1.MISVQTAPFDVGTEQQVLTRKRTDIGAVVSFTGLVRDFNEDVQALTLEHYPGMTEQALQDIVAEAEARWALQGIRLIHRVGRLEPGDPIVMVAVASAHRRHAFEACDFIMDYLKTRAPFWKKEHTVSGHYWVAERNTDIEDAKRWE... 148
123 2.000e-77gi|497323402|ref|WP_009637615.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia sp. M24T3]  clstr ali  42  5.RIVVDAAPFSVGEEYQWLAQSDSD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKALAEIVEEARQRWPLQRVSVYHRVGALFPGDEIVFVGVTSAHRGMAFDATEFIMDYLKTRAPFWKREATEQGDRWVESRESDKTAASRWSSSS 154
124 2.000e-77gi|635198149|gb|KDE39093.1| Molybdenum cofactor biosynthesis protein MoaE [Nitrincola lacisaponensis]  clstr ali  44  4..IRVQAQRFDCGVELEALSQQRTDVGAVASFIGYVRDFNEDVVALTLEHYPGMTEQQLRLIAEQAARRWPVLAATIIHRVGRMEPGDPIVLVAVASAHRQAAFDACNFIMDYLKTEAPFWKKEHTRTGDYWVSSRESDTLAAQRWEK.. 151
125 2.000e-77gi|494432180|ref|WP_007225486.1| molybdenum cofactor biosynthesis protein MoaE [marine gamma proteobacterium HTCC2143]  clstr ali  40  6MSVSVQQQDFDVSAELRRLRDQSAQVGAVASFVGVVRDINDSVSVLELEHYPGMTEQSIADIIIMAGERWQLVGARVIHRVGKLLPTDQIVLVAVTSRHRGDAFAACEFIMDYLKTRAPFWKKEQTEEGARWLDARSADQAAVDRWEQS. 156
126 2.000e-77gi|498913082|ref|WP_010848258.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus nematophila]  clstr ali  40  5.RIRVQRERFHVGDEYQWLSQCDED-GAVVTFTGKVRNHNDNVNALTLEHYPGMTEKMLQKIADEARQRWPVQRITIIHRIGELYPGDEIVFVGVTSSHRNMAFTAAEFMMDYLKTKAPFWKKESLAEGERWVEIKQHDQEAANRWQS.. 152
127 2.000e-77gi|589626515|gb|EXI96902.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-91]  clstr ali  45  1.MVRVQAADFDPGAELAAMRLGKPQIGALASFVGLVRELNDGVSELTLEHYPGMTEKALEEIIAEARRRWTLIDVLLIHRVGRLLPTDQIVLVAVASAHRGEAFAACEFIMDYLKTRAPFWKREVTAAGARWVEARLADEQAAERW.... 147
128 2.000e-77gi|574956830|dbj|BAO45673.1| molybdenum cofactor biosynthesis protein E [gamma proteobacterium Hiromi1]  clstr ali  41  5..IAIQTEIFDPAHEEQQLRQGNPRVGAVVSFLGLMRDINDGVYAMTLEHYPGMTEKALDAIVDEAGQRWDLEGIRVIHRVGELLPEEPIVLVMTASRHRGEAFRACEFIIDYLKTRAPFWKKENTGDGERWVEARHSDKDAESRWDS.. 152
129 2.000e-77gi|499783477|ref|WP_011464211.1| molybdenum cofactor biosynthesis protein MoaE [Rhodoferax ferrireducens]  clstr ali  40  9.RVSIQTADFDLSTEVALLRAQDPRVGAVCSFIGTVRDRTAGISSMELEHYPGMTEKSIEAMMDAALKRFDIYGARVIHRVGLLQPLDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGIAA 161
130 2.000e-77gi|503463614|ref|WP_013698275.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Burkholderia]  clstr ali  43  5.RARVQTGDFEVGAELAALRARNPKIGAVACFVGTVRDLNEGVAALELEHYPGMTEKALEAIADEAIARWPGIEVAIIHRVGRLLPLDQIVFVATVAAHRGDAFASCEFVMDYLKTEAPFWKKESTPSGERWVDARSSDDAALARWGLRS 155
131 2.000e-77gi|504006495|ref|WP_014240489.1| molybdenum cofactor biosynthesis protein MoaE [Azospirillum brasilense]  clstr ali  44  1MTVKVQSEDFDVGAELAAMTGGKTGIGGVTLFVGLVRDMAGGVSAMTLEHYPGMTERQLEAIEAEARARWPLDDALIIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTKAPFWKMEATPEGERWVEAKESDDTAAARWTKPA 152
132 2.000e-77gi|544832997|ref|WP_021248775.1| hypothetical protein [Thauera terpenica]  clstr ali  44  10.RVSVQEADFDVGAEVGSLHGGSGQVGAVASFVGLVRDEGDGVTAMTLEHYPGMTEKALEEIVAQARERWALLGVSVIHRFGRFVPTDRIVFVGVASAHRGEAFAACEFIMDYLKTRAPFWKREETPAGARWVDARDSDDSAAARWQTAG 160
133 3.000e-77gi|589827366|gb|EXJ09872.1| Molybdopterin synthase catalytic subunit [Nitrincola sp. AK23]  clstr ali  41  2IRIRVQPEVFNAGQEIDAITHARSDIGAVVNFIGYVRDFNEDVVALTLEHYPGMTEQSLQEIAKSAQERWPLEAITIIHRIGRLTPGDPIVLVAVASAHRQAAFDACNFVMDYLKTQAPFWKKEHSRSGDYWVAARHSDSDAVRRWEN.. 151
134 3.000e-77gi|518171972|ref|WP_019342180.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas stutzeri]  clstr ali  44  1MGVRVQQGPFDPGAELNALHAANLGIGAVTGFVGYVRDFNDGVAGMFLEHAPGMTEKALQKIIDEAADRWPLLTLEILHRVGRLEPGEPIVFVGAASAHREAAFDGCRFVMDYLKTRAPFWKKEDTSEGTRWVEGRCSDQAAADRWRQ.. 150
135 3.000e-77gi|545471522|ref|WP_021707894.1| molybdopterin synthase catalytic subunit [Vibrio azureus]  clstr ali  41  4.RVSVQLEDFSLELEHQRLSAAH-AAGAVVTFTGKVRDTNLGVTGLHLEHYPGMTEKSLIDICNQAESRWPLLGVRIVHRIGDLDIGEQIVFVGVSSAHRAAAFEACEFIMDYLKTKAPFWKKERTRTESRWIESRQSDQQAALRWK... 150
136 3.000e-77gi|570729127|gb|AHF00347.1| molybdenum cofactor biosynthesis protein MoaE [Thioalkalimicrobium aerophilum AL3]  clstr ali  41  6..VRVQEADFDLSTEVNWLREQHADVGAVVSFIGTVRDINQGVNQLELEHYPGMTEKALEAIRQQAHQRWQLESSLIIHRIGKMQPKDQIVLVAVASRHRENAFHAAHFIMDYLKTNAPFWKKEWTPEGERWVDARLSDEQAMQRW.... 151
137 3.000e-77gi|495318206|ref|WP_008042953.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Reinekea blandensis]  clstr ali  38  4..IRVQQDDFSVQREYDGLCRENTDDGAVVFFVGRVRDLNEGVTGMFLEHYPGMTEKTLQSIADEARHRWPLNRIRIVHRVGALNPSDQIVFVGVSSPHRGAAFDGAQYIMDFLKTRAPFWKKESTPEGDRWVDARSSDTEQENRW.... 149
138 4.000e-77gi|491501732|ref|WP_005359416.1| molybdopterin converting factor subunit 2 [Aeromonas diversa]  clstr ali  40  1.MIRVQREDFSLAAEYERLS-GDPACGAIVTFVGKVRDMNQGVAGLSLEHYPGMTEKALAAIVDEAKTRWALQGCTLIHRVGDLLLGDQIVLVAVSSAHREAAFAACHFIMDYLKTRAPFWKRELSTDGRRWVEAKESDNEAAARWHE.. 149
139 4.000e-77gi|648287459|ref|WP_026068608.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas smyrnensis]  clstr ali  46  3.RVRVQQQAFDAGEEQRRLIEARTDIGAVVGFTGLVRDFNEEVQALSLEHYPGMTEAALEAIVDEAESRWPLQGVRVIHRIGRLAPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHTASGDYWVAERQTDHRDAERWEVSS 153
140 4.000e-77gi|515590231|ref|WP_017022891.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Aliivibrio logei]  clstr ali  39  1.MISVQEHDFNVGDEYT-LLAEGTASGAVVTFIGKVRDMNDDVTGLSLEHYPGMTEKSLNDIVAQSKERWPLLKVKVIHRVGDLELGDQIVFVGVSSAHRGAAFESCEFIMDYLKTNAPFWKKERTTKEVRWVESRDTDKSAAQRWEK.. 148
141 4.000e-77gi|499705415|ref|WP_011386149.1| molybdenum cofactor biosynthesis protein MoaE [Magnetospirillum magneticum]  clstr ali  44  1MAVRVQREDFDPGAELERFSSGKTSVGGICLFVGLVRDYAGAVNAMTLEHYPGMTERQLEAIEAEARQRWPLDDTLVIHRFGRLEPGERIVLVAASSAHRDAAFEACRFLMDWLKTKAPFWKVEHTPEGDAWVEAKQSDDAAASRWDK.. 155
142 5.000e-77gi|516488026|ref|WP_017876470.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium sp. CG3]  clstr ali  40  3.RVRVQTGDFDLSAEVARLRAANPKVGAVVSFVGTVRDLNEGVAEMELEHYPGMTEQSIEAIIEQAMRRWPLFDALVIHRVGPLKPMEQIVLVLTTAAHRGVAFAACEYIIDYLKTEAPFWKKEQTPDGARWVDARVSDEAALSKWAR.. 151
143 5.000e-77gi|490543038|ref|WP_004408162.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio nigripulchritudo]  clstr ali  36  4..VSVQKEDFSLADEYD-VLAQGTSSGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLESLCEQAKQRWSIENIRVIHRVGDLDIGDQIVFVGVSSAHRGDAFNACEFVMDYLKTQAPFWKKERTTDSVRWVESRESDAAAASRWAEQG 152
144 6.000e-77  ali  41  5.RVLIQTQDFDVSAELAALRAGDARVGAVCCFVGTVRDRNEGVSAMELEHYPGMTEKSIEAIIERATERFGIHAAKVIHRIGPLQPMDQIVFVGVTSAHRGMSFQACEFIMDYLKSEAPFWKKEQTPEGARWVDARVSDEEALARWQ... 152
145 6.000e-77JCVI_PEP_1096690520567 /source_dna_id=JCVI_ORF_1096690520566 /offset=0 /translation_table=11 /length=169 /full_length=169  ali  41  6.SVQIQYEDFDLCREVAQLRQPDPGVGAVVSFLGTVRDRDEGIQGLELEHYPGMTESAIQAMIDQARSRFDIRAVRIIHRIGVLNPQDQIVLVAVASAHRGQAFDACEFLMDYLKTQAPFWKKQSSPEGAAWVDARQSDDTAAHRWGLPG 157
146 6.000e-77gi|640516401|ref|WP_024950939.1| hypothetical protein [Cobetia crustatorum]  clstr ali  41  13.SVSIQVDDFDIRAEQRYLTNTRGQVGAIVAFTGLVRDFNQDVVALTLEHYPGMTERSLEQLLDEARERFSLNGARIIHRVGRLEPGDNIVLVLVASAHRQAAFAACDFLMDNLKSRAPFWKKEHTASGDYWVRERTSDRDALMRWQLP. 162
147 6.000e-77gi|558558187|ref|WP_023489228.1| molybdopterin synthase catalytic subunit [Serratia sp. DD3]  clstr ali  43  5.RIRVGAAPFSVGEEYPWLAECNDD-GAVVTFTGKVRNHNDQVSALSLEHYPGMTEKALGEIVAQARSRWSLQRVTVIHRVGDLFPGDEIVFVGVSGAHRSEAFDAAEFIMDYLKTRAPFWKREATGQGERWVEARDSDQQAAKRW.... 150
148 6.000e-77gi|521067945|ref|WP_020399896.1| hypothetical protein [Kordiimonas gwangyangensis]  clstr ali  40  3.SISVQADDFDITGEINALKADRVDIGAIVTFTGTVRDLDGSLTSMTLEHYPGMTERELQAVADEAEARWPLQACRVIHRYGTLSPGENIVLVITMSAHRHAAFQAADFLMDFLKSRAPFWKKEETGEGATWVDARESDELALKRWNS.. 149
149 7.000e-77gi|489029126|ref|WP_002939523.1| molybdopterin biosynthesis MoaE protein [Thauera sp. 27]  clstr ali  43  6..VCVQEDDFDVGAEIAALSQERADVGAVASFVGLVRDVNDGVSAMTLEHYPGMTERALEEIVIEARARWSVLDACVIHRHGRLMPAERIVFVGVASAHRGDAFAACEFIMDYLKTRAPFWKREETPDGGRWVDAREADDSAAARWS... 152
150 8.000e-77gi|490193711|ref|WP_004092283.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Hafnia alvei]  clstr ali  42  7.RIRVGQENFSVGDEYQWLSQC-EDDGAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALGEIVAEARERWPLQRISLIHRVGAMYPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATEQGDRWVDARDSDHQAAKRW.... 152
151 8.000e-77gi|495194158|ref|WP_007918948.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Pseudomonas]  clstr ali  43  1MAIRVQHKSFDVGQLTADLHARNPRVGAVVNFVGYVRDLNMGVNELFLEHYPGMTEKALEQIAEEARERWPLLGVEIVHRVGALSVSEPIVFVGVSSKHRHMAFEACAFIMDVLKTRAPFWKRETTPEGSHWVEGRESDRDAALRWS... 149
152 8.000e-77gi|499718234|ref|WP_011398968.1| molybdenum cofactor biosynthesis protein MoaE [Hahella chejuensis]  clstr ali  40  5IRIDVTTDDFDLGEETRRLTDGDTAVGAVCSFVGLVRDFSDDVKGLYLEHYPAMTEKSLTKIAKEAFQRWDLNGVRVIHRVGELWAGDQIVLVVTASAHRGDAFAACEFIMDYLKVQAPFWKKELTAEGEHWVEAKESDQVRAGEWSSE. 155
153 8.000e-77gi|500130315|ref|WP_011806320.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. JS42]  clstr ali  40  3.RVSIQTHDFDVSTELAALRARDARVGAVCCFVGTVRDRNEGVASMELEHYPGMTEKSIEAMVDAAFARFNLYGVRVIHRVGLLAPLDQIVMVAVTSAHRGESFQACEFVMDYLKTQAPFWKKEQTPDGARWVDARVSDDAALARWGIAA 153
154 9.000e-77gi|575852866|emb|CDL80496.1| Molybdopterin synthase catalytic subunit [Xenorhabdus cabanillasii JM26]  clstr ali  42  5.RICVQKEMFNVGAEYQWLAQCDED-GAVVTFTGKVRNHNDDVRALILEHYPGMTENMLQKIADEARQRWRLQRINIIHRIGKLYPGDEIVFVGVTSTHRSMAFAAAEFLMDYLKTQAPFWKKEFLNDGERWVEAKESDREAASRW.... 150
155 9.000e-77gi|505301507|ref|WP_015488609.1| molybdenum cofactor biosynthesis protein E [Thalassolituus oleivorans]  clstr ali  36  3.SITVQTNDFNIADEYQALCGQNTEAGAIVFFSGLVRDRNEGVTGLFLEHYPGMTERSLEDIVKQARLRWPILQVRLIHRIGQLDINDQIVFVGVSSAHREAAFDACRFIMDFLKTEAPFWKKETRTDGHHWIESQTKDQEAKTRWNK.. 151
156 9.000e-77gi|503200500|ref|WP_013435161.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia rhizoxinica]  clstr ali  43  1MTVSVQARDFDVTTELARLRARNPRIGAVVSFVGTVRELSDGISALELEHYPGMTERALEAIVAEAERRWAGIDVCVVHRYGRLDAGEQIVLVAVAAAHRGDAFAACEFVMDYLKSNAPFWKKERTEQGERWVDARATDDAALARWGIAS 152
157 9.000e-77gi|498123029|ref|WP_010437185.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio cyclitrophicus]  clstr ali  38  10.RVVVTAEDFSVGDEYDYLAQG-TAAGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLSEICDQAEARWPIEKMRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFVMDFLKTKAPFWKKERTTETTRWVDSRDSDAKAAERWEK.. 157
158 9.000e-77gi|260072594|gb|ACX30493.1| molybdenum cofactor biosynthesis protein E [uncultured SUP05 cluster bacterium]  clstr ali  38  4..INIQKKDFDLTLEVNLARGDDSDIGAVVSFVGTVRDLDDAIQKMTLEHYPGMTEKALESIATQAQGRWPLGNITIIHRVGDLDINDQIVLVVTTSKHRKSAFEACEFIMDYLKTQAPFWKKEHTTNESKWVEAKDNDNDAASRW.... 148
159 1.000e-76gi|504592137|ref|WP_014779239.1| molybdenum cofactor biosynthesis protein MoaE [Thiocystis violascens]  clstr ali  43  3.RVQIQTEPFDIAAEQESLWHGNPRVGALVTFVGLMRDLHEGVSRMTLEHYPGMTEKALAEIAEEANARWKLEGVTIVHRLGKLEPQDPIVFVGVASHHRGDAFRACEFLIDYLKTRAPFWKKEQTEQGERWVESKVSDDVAARRW.... 149
160 1.000e-76gi|545478845|ref|WP_021714905.1| molybdopterin synthase catalytic subunit [Vibrio ezurae]  clstr ali  37  3.RVVVQEEDFDLSKEYARL-GESPSIGAVVTFVGKVRDFNDNVLGLHLQHYPQMTEKALHEICTLARSRWPLDKVTVIHRVGDLDIADQIVLVGVSSAHREAAFSACEFIMDYLKTKAPFWKKERLSNASRWIESRESDQESMQRW.... 148
161 1.000e-76gi|494152251|ref|WP_007091994.1| molybdenum cofactor biosynthesis protein MoaE [Thalassospira xiamenensis]  clstr ali  45  3.RVSVQENDFDPGAELAALTDGRTDIGAAVSFVGLVRDGGDQVSALTLDHYPGMTERELENIVDEAARRWPLDDVRIVHRFGRMLPGERIVLVITLSAHRRAAFEACDFIMDFLKTRAPFWKREQTPKGDHWVTAKASDDADAERWNTD. 152
162 1.000e-76gi|577074894|gb|EUD11073.1| molybdopterin converting factor, subunit 2 [Providencia alcalifaciens 205/92]  clstr ali  41  5.HIAVQTENFSVGEQYSWLAQCDSDSGAVVTFTGKVRNHNDSVAALTLEHYPGMTEKALSDIVMQSRERWSLQRVSVIHRIGTLQPGEEIVFVGVTSAHRNAAFQAAEFIMDYLKTKAPFWKKESLPDNERWVEAKESDEASANRW.... 152
163 1.000e-76gi|495142255|ref|WP_007867062.1| molybdenum cofactor biosynthesis protein MoaE [Polaromonas sp. CF318]  clstr ali  42  5.RVLITTDDFNLADEVAALRAGDKRVGAVCTFTGTVRDRNDGVSSMELEHYPGMTEKAIEAMIDEAMARFDIFGARVVHRVGLLQPLDQVVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVADDAALAKWGITA 155
164 1.000e-76gi|505131366|ref|WP_015318468.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium australicum]  clstr ali  52  8.TVRIQRQDFDVAAEIAALTQGRVDIGAVVTFSGLCRDEQGALSALELEHYPGMAEAEIGRIATEASERWPLQGLSVIHRHGKIAPGENIVLVVAASAHRQAAFEAADFLMDYLKSRAPFWKKEHRTDGSEWVEAKETDAQAAQRWKRP. 157
165 1.000e-76gi|519023381|ref|WP_020179256.1| hypothetical protein [Methylopila sp. M107]  clstr ali  44  1MAIRIQTEPFDLGSEVAALTQGLTDQGAVVTFSGLCRDRGDGLVALTLEHYPGMTEDELARIEAEARSRWPLADALVVHRVGRILPGEPIVLVVTVSAHRKAAFEAAEFLMDYLKTSAPFWKSEETAEGASWVAAKQSDDDSAERWRRDG 153
166 1.000e-76gi|519073914|ref|WP_020229789.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. MR-S7]  clstr ali  41  3.SVSIQTDDFDVSAELAALRAQDGRVGAVCCFVGTVRDRSDGVASMELEHYPGMTEKSIEAMVAEARRRFDLFGVRVIHRVGLLAPLDQIVLVAVTAAHRGESFQACEFLMDYLKTQAPFWKKEDTPQGVRWVDARVSDDAALARWGIAA 153
167 2.000e-76gi|502353039|ref|WP_012770224.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Dickeya zeae]  clstr ali  41  4.RIRVGQEPFSVGDEYAWLATSDMD-GAVVTFTGKVRNHNDHVSALTLEHYPGMTEKALAEIVDDARQRWPIQRVSLIHRVGALFPGDEIVFVGVSGAHRQASFDAAQFIMDYLKTRAPFWKREATSDGDRWVDARDSDRQAAERWS... 150
168 2.000e-76gi|648404398|ref|WP_026096149.1| molybdenum cofactor biosynthesis protein MoaE [Ideonella sp. B508-1]  clstr ali  40  11.RVRIQTADFDLGQEVASLRADDGGVGAVVSFLGTVRDQAGEVSAMELEHYPGMTEKAIEAMIDAAHARFDIRAARVIHRVGPLRPCDQIVLVVVSSAHRGEAFQACEFLMDYLKTQAPFWKKETTAEGARWVDARVADDQALARWGIAS 163
169 2.000e-76gi|652944086|ref|WP_027197566.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia sprentiae]  clstr ali  41  1MPVRVQTEDFDLSAEVAALRARNPKIGALACFVGTVRDVNEGVETMELEHYPGMTEKSLEAIVERARERWRGIEVLIVHRVGKLYPLDQIVLVATTAAHRGDAFASCEFVMDYLKTEAPFWKKEKTDAGERWVDARVTDDAALARWRTEA 152
170 2.000e-76gi|589625396|gb|EXI95956.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-91]  clstr ali  43  1MMVRVQEADFDVGAELAALRRDRPQIGALASFVGVVRADSDGVSEMTLEHYPGMTEKALAAMVGEAGRRWKLIDAIVIHRVGRLLPGDQIVLVAVAGAHRGEAFAACEFLIDYLKTRAPFWKREVTPQGARWVAARASDDQAAERW.... 148
171 2.000e-76gi|496340546|ref|WP_009049724.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas chlororaphis]  clstr ali  43  1MTVHVQAEVLDLDRLHREVHGGDPSIGAVVTFVGYVRDLNDQVGSLFLEHYPGMTERALQRIVDEANQRWPLQRVRVVHRVGLLQVAEPIVFVGVASAHRQAAFAACAFLMDYLKTRAPFWKREQTLSGERWVEGRESDQLAASRW.... 148
172 2.000e-76gi|647532546|ref|WP_025822678.1| molybdopterin synthase catalytic subunit [Shewanella marina]  clstr ali  39  7.MIRVQTQDFDVPTEYAAIAADNSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLEQIEAQARERWPLTHVTIIHRVGTMGLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLEAGQQGQAWVEAKDSDDQAAAMWQQK. 155
173 3.000e-76gi|640282888|ref|WP_024850144.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira kuenenii]  clstr ali  41  7..IKIQQEDFDLSTEIKALREGHKDIGAVVSFIGTVRDEGDDISVLELEHYPGMTEKALEAIRLQAHERWPLQSSLIIHRIGEMMPCDQIVLVAVSSRHREAAFEAAHFIMDYLKTNAPFWKKETFPDGERWVDARVSDKEAEARWHQ.. 155
174 3.000e-76gi|500089284|ref|WP_011765297.1| molybdenum cofactor biosynthesis protein MoaE [Azoarcus sp. BH72]  clstr ali  44  1MSISVQEEDFDVGAEIDALTAGRVDVGAVASFVGLVRDANEGVSAMTLEHYPGMTEQALADIVAEAEARWRLNAVRVIHRYGRLVPGNRIVFVAVAGAHRGEAFAACEFIMDYLKTRAPFWKREETPQGARWVDAREGDAAAAARWGTGG 152
175 3.000e-76gi|653000583|ref|WP_027252786.1| molybdopterin synthase catalytic subunit [Photobacterium halotolerans]  clstr ali  36  5..ICVQAEDFSLALEYQALAEGN-QAGAVVTFVGKVRDMNESVSTLTLEHYPGMTEKSLLFIVEQAKSRWPVLAATVIHRVGQLTAGDQIVFVGVSSAHRGAAFQACEFIMDYLKTEAPFWKKEVREGETSWVDARETDQQARQRWHK.. 151
176 3.000e-76gi|495124258|ref|WP_007849071.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. CF316]  clstr ali  42  8.SVSIQTEDFDLSAEVAALRHGDRRVGAVCAFVGTVRDRNDGVASLELEHYPGMTEKSIAAMVDAAFGRFELFGVRVIHRVGLLQPLDQIVLVAVTSAHRGQSFEACEFLMDYLKTQAPFWKKEVTPAGARWVDARVSDDAALARW.... 154
177 4.000e-76gi|597958564|gb|EYC51752.1| molybdenum cofactor biosynthesis protein MoaE [Hylemonella gracilis str. Niagara R]  clstr ali  40  5.RVSIQTCDFNVATEIAALRARDARVGAVCSFIGTVRDRNGGVSAMELEHYPGMTEQAIEGMIDEAQRRFDIYAARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPQGARWVDARVSDDEALARWGISA 160
178 5.000e-76gi|503874917|ref|WP_014108911.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Glaciecola nitratireducens]  clstr ali  35  8..ISVQEQDFDLALEYTQIRKHSDSDGAIVTFTGLVRELTGNLKYMTLEHYPGMTEKSLMNICEQARERWPIGSIRIIHRIGKLPPDEQIVFVGVSSKHRKAAFAATEFMMDFLKTQAPFWKKELTTEGEFWVDAKSSDKHKANDW.... 153
179 5.000e-76gi|527114691|ref|WP_020914948.1| Molybdenum cofactor biosynthesis protein E [Shewanella piezotolerans]  clstr ali  37  1.MIRVQTTDFSVPDEYQLISQDNGD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLNQIEAQARERWPLNHVTIIHRVGKMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGEEGASWVEARDSDEQAADVWNKK. 149
180 6.000e-76gi|40063018|gb|AAR37874.1| molybdopterin converting factor, subunit 2 [uncultured marine bacterium 560]  clstr ali  34  4..IVVQTEDFDLTTEVAHTRSNNPQIGAIVSFIGTVRDHPGSISSMTLEHYPEMTEKSLKSIVTEARERWDLQNITIIHRIGKLKVNDQIVLVVTTSKHRQAAFESCHFIMDYLKTDAPFWKKESTEQKEEWVESRESDDEQKKRWQS.. 150
181 6.000e-76gi|492601959|ref|WP_005900411.1| molybdopterin converting factor subunit 2 [Aeromonas molluscorum]  clstr ali  39  11.RILIQREDFCLADEYARL-ATRPDSGAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALADIVAQARGRWPLQECTLIHRIGELRLGDQIVLVGVSSAHRDAAFDACHFIMDFLKTRAPFWKKELIAEGQRWVEAKESDNDAASRW.... 157
182 6.000e-76JCVI_PEP_1096684895653 /source_dna_id=JCVI_ORF_1096684895652 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  41  9.RILVQRDDFSLADEYARL-AARQDTGAVVSFVGKVRDFNQGVKGLALEHYPGMTEKALTDIVAEARSRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMDFLKTRAPFWKKELTAEGQRWVEAKESDNTAAARWQ... 156
183 6.000e-76gi|653020989|ref|WP_027272890.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Leminorella grimontii]  clstr ali  42  7.RIVVGAAPFSVGEEYQWLSQCDDD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKSLAEIVVAARERWPLQRVSVNHRVGELFPGDEIVFVGVTSAHRGSAFDAAEFIMDYLKTKAPFWKREATQEGDRWVESRDSDREAAERW.... 152
184 6.000e-76gi|500153143|ref|WP_011829146.1| molybdenum cofactor biosynthesis protein MoaE [Methylibium petroleiphilum]  clstr ali  41  11.RVTIQTEDFDLSSEVAALRAHQRGVGAVASFVGTVRDRNDGVSRMELEHYPGMTERAIEAMIDAAFARFDLLGARVIHRIGPLEVGEQIVLVVVSSAHRGQAFQACEFLMDYLKTQAPFWKKEQTPQGARWVDARVADDDALRRWGIAA 161
185 7.000e-76gi|506315285|ref|WP_015835060.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photorhabdus asymbiotica]  clstr ali  40  5.RIFVGLENFNVGDEYEWLSQCDED-GAIVTFTGKVRNHNDRVSGLRLEHYPGMTEKVLRNIVVEARSRWPLQRISIIHRVGALYPGDEIVFVGVTSAHRSMAFDAAEFIMDYLKTKAPFWKKEFLPDGERWVESRESDQEAARRW.... 150
186 9.000e-76gi|488369995|ref|WP_002439380.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shimwellia blattae]  clstr ali  42  5.RIRVGHDGFSVGDEYQWLAQCDAD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKALAEIVASARERWPLQRVSVIHRTGELWPGDEIVFVGVTGAHRGSAFEAAEYIMDYLKTRAPFWKREKTADGDRWVDARESDQQAASRW.... 150
187 1.000e-75METAHIT MH0025 GL0044206 [Complete] locus=scaffold96448_1:2494:2946:+  ali  46  6..IVVGPQPFSVGEEYPWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW.... 150
188 1.000e-75 GBSZFW302I7MDG|2|ZP_05435010.1  ali  46  6..IVVGPQPFSVGEEYPWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW.... 150
189 1.000e-75JGI.Meta 7045185570 C3786207__gene_311667 moaE protein [Human Stool microbiome from visit number 1 of subject 158337416]  ali  46  6..IVVGPQPFSVGEEYPWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW.... 150
190 1.000e-75gi|652656762|ref|WP_027016863.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas composti]  clstr ali  44  5.RVFIQTQDFDVSAELAALRAGDAGVGAACCFVGLVRDRNEGVASMELEHYPGMTEKSIEAIIDQAQARFGIHGARVIHRVGLLAPMEQIVLVAVTAAHRGKAFEACEYIMDYLKSLAPFWKKEQTPAGARWVDARVSDEQALERWS... 152
191 1.000e-75gi|260219647|emb|CBA26492.1| Molybdopterin-converting factor subunit 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  40  10.RVRIQTEAFDLGLEISQLQAADPRVGAVCSFVGTVRDRNGSVQTLELEHYPGMTEKSIEAMVDAAFARFDIYGARVVHRVGVLQPTEGVVLVAVTSAHRGQSFQACEFIMDYLKTQAPFWKKETTPEGAHWVDARVSDDEALARWGITA 163
192 1.000e-75gi|496205718|ref|WP_008925054.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. aB]  clstr ali  43  5..IRVGPAPFDMAEAYRWLAACDED-GAVVTFTGKVRNHNDNVAALMLEHYPGMTEKALQEIVDAARERWPLQRVTVIHRVGELFPGDEIVLVGVTSAHRSSAFSAAEFIMDYLKTRAPFWKREATEQGDRWVDARDSDHQAAQRWD... 150
193 1.000e-75gi|500118386|ref|WP_011794391.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax citrulli]  clstr ali  40  18.RVSIQPQDFDVSAELAALRARDGRVGAVCCFVGTVRDRSDGVAAMELEHYPGMTEKSIEAMVDEALGRFDIFGARVVHRVGLLAPQDQIVMVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPLGARWVDARVSDDAALARWGIVS 168
194 1.000e-75  ali  46  8..IVVGPQPFSVGEEYPWL-AERDEDGAVVTFTGKVRNHNDSVNALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW.... 152
195 1.000e-75gi|491575876|ref|WP_005433453.1| molybdenum cofactor biosynthesis protein MoaE [Sutterella wadsworthensis]  clstr ali  40  5.TIRVSEADFNPGEEIERLIESSPEAGGVASFVGVVRNRNDGVTHLTLEHYPAMTERALAGIVERARARWDVCGVTVIHRVGEMAVGEHIVLVVVTSAHRREAFEACEFIMDWLKTEAPFWKKERTPEGERWVDARESDEEARRRWGEAA 155
196 1.000e-75METAHIT MH0084 GL0041886 [Complete] locus=scaffold14080_2:18:488:-  ali  40  5.TIRVSEADFNPGEEIERLIESSPEAGGVASFVGVVRNRNDGVTHLTLEHYPAMTERALAGIVERARARWDVCGVTVIHRVGEMAVGEHIVLVVVTSAHRREAFEACEFIMDWLKTEAPFWKKERTPEGERWVDARESDEEARRRWGEAA 155
197 1.000e-75  ali  40  5.TIRVSEADFNPGEEIERLIESSPEAGGVASFVGVVRNRNDGVTHLTLEHYPAMTERALAGIVERARARWDVCGVTVIHRVGEMAVGEHIVLVVVTSAHRREAFEACEFIMDWLKTEAPFWKKERTPEGERWVDARESDEEARRRWGEAA 155
198 1.000e-75JGI.Meta 7068111014 SRS015782_WUGC_scaffold_20874__gene_46484 moaE protein [Human Stool microbiome from visit number 1 of subject 764224817]  ali  40  5.TIRVSEADFNPGEEIERLIESSPEAGGVASFVGVVRNRNDGVTHLTLEHYPAMTERALAGIVERARARWDVCGVTVIHRVGEMAVGEHIVLVVVTSAHRREAFEACEFIMDWLKTEAPFWKKERTPEGERWVDARESDEEARRRWGEAA 155
199 1.000e-75gi|497236200|ref|WP_009550462.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderiales bacterium JOSHI_001]  clstr ali  42  4.RVRIQTEDFDLGTEVAAVRAGNPAVGAVAAFVGTVRDRNAGISAMELEHYPGMTEKAIEAMIDDAMRRFRVLGARVIHRVGPLKPLDQIVLVVVTSTHRGDAFQACEFLMDYLKTQAPFWKKETTPEGARWVDARVADDAALARWGITA 156
200 1.000e-75gi|490355923|ref|WP_004235696.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Morganella morganii]  clstr ali  45  5.RIAVQTDNFSVGEEYQWL-AGCADDGAVVTFTGKVRNHNDNVAALSLEHYPGMTEKALADIVTQARERWELQRVTLIHRVGSLYPNDEIVFVGVSAAHRGMAFEAAEFLMDYLKTRAPFWKKETLPEGTRWVDARESDQKAADRW.... 151
201 1.000e-75gi|497224573|ref|WP_009538835.1| Molybdenum cofactor biosynthesis protein MoaE [Caenispirillum salinarum]  clstr ali  46  1MAVRVQREDFDVGAEMAAFCAGDTSVGAVASFVGLVREGSGAVSAMTLEHYPGMTERQLEAIEADARERWPLHDVLVVHRYGRMEPGERIVLVLTASSHRQAAFDACAFLMDWLKTKAPFWKLEETPNGGRWVDARESDDAAAARWGGD. 154
202 2.000e-75gi|500085621|ref|WP_011761634.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella amazonensis]  clstr ali  37  5.RILVQTADFSVPEEYQRIAADNQD-GAVVTFVGKVRDFNEGVSDLTLEHYPGMTEKVLDQIADQARERWPLNHLTIIHRVGTMHLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLETSDKGQGWVEARDADDQAAKAWEQ.. 152
203 2.000e-75METAHIT V1 GL0028585 [Complete] locus=scaffold64266_1:3615:4124:-  ali  38  1MKIAVQTEDFDVQAEVAALH-GSPKVGAVVMFLGTVRDLNEGVASMTLEHYPGMTEKALTAIVKEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSKWSKEA 151
204 2.000e-75  ali  38  1MKIAVQTEDFDVQAEVAALH-GSPKVGAVVMFLGTVRDLNEGVASMTLEHYPGMTEKALTAIVKEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSKWSKEA 151
205 2.000e-75gi|497966771|ref|WP_010280927.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pectobacterium carotovorum]  clstr ali  44  5.RIRVGEENFNVGDEYQWLAQCDED-GAVVTFTGKVRNHNKDVSALTLEHYPGMTEKALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDKQAAQRW.... 150
206 2.000e-75METAHIT MH0083 GL0075865 [Complete] locus=scaffold78862_2:131:589:+  ali  38  5.TIRVSPEDFSVDAEVARVREASPSAGAVVSFVGVVRNRNDGVSKMTLEHYPGMTEKALGKIVEKARERFHLEDVVVIHRVGDLSVGDQIVLCLVSASHRGEAFEGCEYIMDWLKTEAPFWKRETTPEGERWVDARESDDRAKARWG... 152
207 2.000e-75gi|594557279|gb|EXU81300.1| molybdenum cofactor biosynthesis protein MoaE [Comamonas aquatica DA1877]  clstr ali  42  5.RVLIQHQDFDVSAELAALRAGDARVGAVCSFVGTVRDRNEGVSAMELEHYPGMTEKCIEAIIDRAVARFGIFGARVIHRIGPLQPLDQIVLVAVTSAHRGMSFQACEFIMDYLKSEAPFWKKEQIPEGARWVDARVSDEQALARWAQ.. 153
208 2.000e-75gi|497445209|ref|WP_009759407.1| molybdenum cofactor biosynthesis protein MoaE [Roseibium sp. TrichSKD4]  clstr ali  44  6.SVRVQAENFDLTEETAKLTAGRFDIGAVVTFTGLCRDEGGQLSALELEHYPGMAEAEISRIAERAAERWPITGLTVIHRFGKIAPGENIVLVIAASPHRQAAFDAANFLMDFLKTRAPFWKKEHLKSGQDWVDAKDLDEQALTRWEQ.. 154
209 2.000e-75  ali  38  5.TIRVSPEDFSVDAEVARVREASPSAGAVVSFVGVVRNRNDGVSKMTLEHYPGMTEKALGKIVEKARERFHLEDVVVIHRVGDLSVGDQIVLCLVSASHRGEAFEGCEYIMDWLKTEAPFWKRETTPEGERWVDARESDDRAKARWG... 152
210 3.000e-75gi|340385693|ref|XP_003391343.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Amphimedon queenslandica]  clstr ali  40  4.SIRIQQEPFDAGSIIEDTGRNTPKTGAVAAFVGRMRDINAGIAQMTLEHYPGMTERAIENICQEASKRWELLDIRVVHRIGPLKPLDTIVLVAVASPHRQNAFLACEFIMDFLKTRAPFWKKETTEDGAEWVESRTSDELAAERWHEKS 155
211 3.000e-75gi|572101856|dbj|BAO30267.1| molybdenum cofactor biosynthesis protein E [Sulfuritalea hydrogenivorans sk43H]  clstr ali  47  1MSVSVQEADFDAGAEIAALSAGRDDVGAVASFVGLVRGETAAVQAMTLEHYSGMTEKALDAIVTEARGRWNIYGVRVIHRVGRLLPGDRIVFVAVASAHRGEAFAACEFIMDYLKTRAPFWKKEETPEGGHWVDARESDDHAAGRWNR.. 170
212 3.000e-75gi|495279071|ref|WP_008003825.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. GM49]  clstr ali  39  1MTVRVQREVFDISQLIDSLQANDPGVGAVVNFVGYVRDINQGVAGLFLEHYPGMTERSLQTIIDNARARWPLRAVEIVHRIGPLSISEPIVFVGVSSQHRQAAFEACAFITDYLKTDAPFWKREDVASGARWVDARDSDRSAVERW.... 148
213 3.000e-75gi|491640764|ref|WP_005498293.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella benthica]  clstr ali  40  8..VRVQTEDFSVSDEYA-LIAGDNSDGAVVTFVGKVRDFNDGVSDLTLEHYPGMTEAVLNQIALEARERWPLNNVTIIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDKGANWVEAKDADDQAANMWEKQ. 155
214 3.000e-75JGI.Meta 7008186891 SRS065099_LANL_scaffold_75854__gene_134260 moaE protein [Human Supragingival plaque microbiome from visit number 2 of su  ali  42  5..IHVQTQDFDVGAELKRXXXXXREVGAVASFVGYVRDSNDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRPRAAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQ... 161
215 3.000e-75gi|495816664|ref|WP_008541243.1| molybdenum cofactor biosynthesis protein MoaE [Sutterella parvirubra]  clstr ali  41  6.TIRVGEAPFDAGAETAALYAGDPSVGGVATFVGVVRNRNDGVAKLTLEHYPAMTEKALAGIVKRARARWTLGAVTVIHRVGPLDVSDPIVFVGVAAEHRGEAFAACEFIMDWLKTEAPFWKKEATPEGERWVDARESDDKAKARWGE.. 154
216 3.000e-75gi|652911636|ref|WP_027165586.1| molybdopterin synthase catalytic subunit [Mesorhizobium sp. WSM3224]  clstr ali  49  9..IRIQREDFDVAAEIAGLTRGRADIGAVVTFSGLCRDEQGALSALELEHYPGMAEAEIGRIAAEAVERWPLQGLTVIHRHGKIAPGENIVLVVAASSHRQAAFEAANFLMDYLKSRAPFWKKEHLADGSQWVEAKEADDHAADRWTKP. 157
217 3.000e-75gi|651235346|ref|WP_026375424.1| molybdopterin synthase catalytic subunit [Aestuariibacter salexigens]  clstr ali  37  1.MISIQREDFNVGDEYELLRKTSRSEGAVVTFVGLVRDVNDSVTALELEHYPGMTEKVLNELCDEARQRWVLGAIRIIHRVGKLQANDQIVFVGVSSRHRQDAFDAAQFVMDVLKTQAPFWKKEHGVNSAKWVEVRETDMLALQRWQNP. 150
218 4.000e-75gi|653009923|ref|WP_027262083.1| molybdenum cofactor biosynthesis protein MoaE [Leisingera nanhaiensis]  clstr ali  46  1MRVKVQEAPFDVADEMRGF--GAPGTGAIVTFTGVVRNDSGNLTAMEIEHYPGMTEAALAQIATRAQERWQLGDVLVIHRHGRLIPGEQIMMVATASRHRKAAFEAADFLMDYLKSRAPFWKKEITADGAEWVAARDEDEAALDRWSPE. 148
219 4.000e-75gi|639052987|ref|WP_024459735.1| hypothetical protein [Marinimicrobium sp. LS-A18]  clstr ali  36  1.MISVQTAPFDVAHEYAQLTADDVDAGAAVFFVGRVRSHNDGVTGMTLEHYPGMTEKALEQILADARQRWSLGRVRVIHRVGSLVLGEAIVFVGVTSAHRDASFEAAEFIMDYLKNRAPFWKREDTEDGSVWVDARDKDLRALARWS... 148
220 5.000e-75gi|492544729|ref|WP_005880959.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacter formigenes]  clstr ali  39  1MSIRIQTEDFDLSAELDRLRSDHRDIGAVVSFVGTVRDVNDGILSMELEHYPGMTEAALEEIESRARQRWDILDSIIIHRVGVLKPADQIVLVAVASRHRGEAFRACEYMIDALKTQAPFWKKEQTAKGGRWVKAKDSDESALKKW.... 149
221 5.000e-75gi|501284337|ref|WP_012327355.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella woodyi]  clstr ali  40  8..VRVQTQDFSVPEEYA-LIADDNSDGAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLNQIATEARERWPLNKVTIIHRVGTMSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGETGKSWVEAKDADEQAAKMWDRS. 155
222 5.000e-75gi|653036070|ref|WP_027287758.1| molybdenum cofactor biosynthesis protein MoaE [Rhodovibrio salinarum]  clstr ali  37  1.MIRVQREDFDVGTELAALTQDNPGVGGMCSFVGLVRDGEGRVTAMTLEHYPGMTEKMLERIDAEAHRRWPIEASLVIHRFGRMEPGERIVLVATASAHRQAAFDSCQFLIDWLKTKAPFWKLEETPDGGRWVDARDSDDTAASRWGSD. 160
223 6.000e-75gi|496387197|ref|WP_009096187.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. GFAJ-1]  clstr ali  43  8IAVEVQAAPFSMDYGYESTLQQRTDIGAIVSFTGLVRDFNEDVTGLTLEHYPGMTERTLAEIGEQAWERWSLQAVRIIHRVGHLSPGDPIVRVLVASAHRRDAFNACDFIMDYLKTQAPFWKKEHSREGAYWVKERDSDQQDADRWSSS. 158
224 6.000e-75gi|499954843|ref|WP_011635577.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella frigidimarina]  clstr ali  37  8IVVRVHTEDFSVADEYA-LLACDKQDGAVVNFVGKVRDFNDGVTDLTLEHYPGMTESVLLQISQQACERWPLNKVTIIHRVGRLSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDTGAKWVEARDSDQQAAKMWQK.. 156
225 7.000e-75gi|640183665|ref|WP_024814445.1| molybdenum cofactor biosynthesis protein MoaE [Acidovorax sp. JHL-3]  clstr ali  38  5.RVSIQTEDFDVSTEIAALRHENKGVGAVCSFVGTVRDRTDAVASMELEHYPGMTEKSIEAMVDEAMRRFDIFGARIIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEETAQGARWVDARVSDDAALARWGIDA 182
226 7.000e-75gi|543167592|ref|WP_021019499.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio gazogenes]  clstr ali  37  4.SVAVQHDDFCVEDEYQALSQGD-DAGAVVTFVGKVRDMNLGVTGLHLEHYPGMTEKALNTICEQALQRWPLLAIRVIHRIGDLAIGAQIVFVGVSSHHRDAAFAASAFIMDTLKTQAPFWKKETTSRGERWLDSRDSDRLAAEKWQ... 150
227 7.000e-75gi|500094461|ref|WP_011770468.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ingrahamii]  clstr ali  36  1.MIRVQTEDFNQQREYDRLREQS-SVGAVVTFTGLVRDFNQGVASLTLEHYPLMTEKSLAQIVMQAKQRWNILACTLIHRVGELKISEQIVFVGIATAHRQDAFAACEYIMDYLKTEAPFWKKECNSQGSYWVDARESDRSALNKWS... 148
228 8.000e-75gi|551321236|ref|WP_022940996.1| molybdenum cofactor biosynthesis protein MoaE [Psychromonas hadalis]  clstr ali  36  1.MIKVQSENFNQQIEYDRLRQAS-HTGAVVTFTGLVRDINQGISALTLEHYPAMTEKALADIVKQAQSRWSLIDTTVIHRVGELQLLDQIVFVGVASLHRGDAFAACEFIMDYLKTQAPFWKKETNSQGESWVDARESDQSALNKWHK.. 149
229 8.000e-75gi|646636369|ref|WP_025567652.1| hypothetical protein [Gammaproteobacteria bacterium SCGC AAA003-E02]  clstr ali  43  1MNISVQLNDFEPTVEQQALEQF-PGAGAVVTFTGLVRNKNDGVSSLTLEHYPGMTEKSLEKIVLEAKQRWTLEAVRVIHRVGTLAVGERIVFVGVAATHRGEAFAACEFIMDYLKTKAPFWKKEQGELEGRWVDARETDDQAAHRWQK.. 149
230 8.000e-75gi|517238318|ref|WP_018427136.1| molybdenum cofactor biosynthesis protein MoaE [Hoeflea sp. 108]  clstr ali  45  8.MVRIQAADFDVAQEIGRLTAGRADVGAVVTFTGLCRDEAGTLSALELEHYPGMAEAEISRIAAEALERWPLSGMTAIHRFGRVRPGENIVLVVAASKHRQAAFEAASFLMDYLKSRAPFWKKEHRADGSDWVDAKESDEAAAARWARP. 157
231 8.000e-75  ali  33  1MKISVQTEDFDVQKEYGELKA-NPHAGAVVMFVGNVRDINEGIEKMSLEHYPGMTEKSLTKIVKEAQERWHIQDATVIHRVGDLEINDQIVFVGVSGGHRGECFDACEFIIDYLKTEAPFWKKETIDGKGKWVDARESDDEAMSKWN... 148
232 9.000e-75gi|648488645|ref|WP_026180396.1| molybdenum cofactor biosynthesis protein MoaE [Hahella ganghwensis]  clstr ali  37  1MHIEISQRDFDLGTEVKRLVGDDNGIGASCSFVGYVRDFSEEVVGLELEHYPGMTEKSLQKIAEEACDRWEIEGITVIHRIGRMMLGEQIVLVVTTSAHRAEAFAACEFVMDYLKVDAPFWKKELTNDGDHWVEARDKDSERAEKWQID. 151
233 1.000e-74JGI.Meta 7049005675 C5074502__gene_241672 moaE protein [Human Stool microbiome from visit number 1 of subject 158499257]  ali  37  1MKIAVQTEDFDVQAEVAALH-GSPKVGAVVMFLGTVRDLNEGVASMTLEHYPGMTEKALTAIVKEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSKWSK.. 149
234 1.000e-74gi|518446484|ref|WP_019616691.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ossibalaenae]  clstr ali  35  1.MIKVQSEDFNQQVEYDRLRK-DPSVGAVVTFSGLVRDINQGVSSLTLEHYPGMTESSLAEIVKQAESRWNIIDCTVIHRIGELQLLDQIVFVGIASLHRQDAFAACEFIMDYLKTQAPFWKKETNAQQESWVDARESDQEALNKW.... 147
235 1.000e-74JCVI_PEP_1096665653177 /source_dna_id=JCVI_ORF_1096665653176 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  37  5MSVRITEDDFDIALEHEKLK--SRDAGAIVTFTGTVRDNGGGLNAMTLEHYPGMTESEIEMIIDQAKARWPLVNVTVIHRVGRMLPTENIVFVGCSSAHRGAAFDGANFIMDFLKTKAPFWKLEDGPNGAKWVDARDSDSKALDRWNLP. 153
236 1.000e-74gi|556302003|ref|WP_023292960.1| molybdopterin synthase catalytic subunit [Enterobacter cloacae]  clstr ali  44  18.RILVGPERFNVGTEYSWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAEIVDEARGRWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTKAPFWKREATPEGDRWVESRDSDKQAASRW.... 163
237 1.000e-74JCVI_PEP_1096695085025 /source_dna_id=JCVI_ORF_1096695085024 /offset=0 /translation_table=11 /length=206 /full_length=206  ali  41  47.RVLIQTADFDVSAEIDALRAQDLRVGAVCSFVGTVRDTQDEVQAMELEHYPGMTEKSIEAMIDEAHTRFDFYGARVVHRVGRLLPADQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGAHWVDARVSDDAALARWGIQA 202
238 1.000e-74gi|503273696|ref|WP_013508357.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pantoea sp. At-9b]  clstr ali  43  5.RIRVGSAAFNVAEEYAWLSAHDSD-GAVVTFSGKVRNHNDSVAALTLEHYPGMTEKALTEIVEEARQRWALQQVSVIHRVGELFPGEEIVFVGVSSAHRSSAFAAAEFIMDYLKTRAPFWKREATAHGDRWVDARDSDHQAAERWK... 151
239 1.000e-74gi|500135329|ref|WP_011811334.1| molybdenum cofactor biosynthesis protein MoaE [Verminephrobacter eiseniae]  clstr ali  40  5.RVVIQTQDFDLSSEIAALRRDNRGVGAVCSFVGVVRDRNDAVLSIELEHYPGMTEKSIEAMVDEAVRRFDIVGARVIHRVGRLQPLEQIVLVAVASAHRGQGFQACEFLIDYLKTQAPFWKKEHTPQGVRWVDARVSDDAALARWGIMA 166
240 1.000e-74gi|495506997|ref|WP_008231644.1| molybdenum cofactor biosynthesis protein MoaE [Roseobacter sp. CCS2]  clstr ali  47  1MTVRVQSDPFDAGAELNSFAQDRTDIGAVVSFTGVVRDTKGDLQEMLIEHYPGMTQSAITKIADEAVQRWALADVLVIHRYGPLKPGEPIMMVATVSAHRAASFEAADFLMDYLKSRAPFWKKEVTAEGAAWVDAKDTDEDALKRW.... 146
241 1.000e-74gi|496087141|ref|WP_008811648.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Burkholderiales]  clstr ali  38  1MKIAVQTEDFDVQAEVAALHA-SPKVGAVVMFLGTVRDLNEGVASMTLEHYPGMTEKALTAIVEEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSRWTK.. 149
242 1.000e-74gi|559225838|ref|WP_023581223.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Proteus hauseri]  clstr ali  38  6.RIAVQTENFSVGDEYQWLSECDSD-GAVVTFTGKVRNHNDEVSTLTLEHYPGMTEKALNDIVSEARGRWPLQRVSVIHRVGTLHIGEEIVFVGVTSSHRNSAFESAEFIMDFLKTRAPFWKKELSENKDRWVDARQSDYDSAERWE... 153
243 1.000e-74gi|494357399|ref|WP_007193512.1| molybdenum cofactor biosynthesis protein MoaE [Thiocapsa marina]  clstr ali  40  3.RIRVQHDLFDSAEEQKILSRDKPRVGAVVTFVGLMRDFNEGVVAMTLEHYPGMTEKALGAIAEEAAQRWDLEDISILHRVGELRPQDPIVFVGVSSRHRGEAFRACEFLIDSLKTRAPFWKKEQTSEGERWVDARVTDDAAARRWAE.. 151
244 1.000e-74gi|587642112|gb|EWY41124.1| molybdenum cofactor biosynthesis protein MoaE [Skermanella stibiiresistens SB22]  clstr ali  40  1MAIRVQREDFDVGAELAALTENNHGIGGVTSFVGLVREMGGGPSAMTLEHYPGMTERQLAEIEAEASRRWKLDATLIIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTRAPFWKLEETAKGSHWVEAKEGDDIAASRWAE.. 148
245 1.000e-74gi|552167727|ref|WP_022987534.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter sp. ES-1]  clstr ali  40  1.MISVQTGDFDTGAEYAALRASGSGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEAVIQGLIDEASRRWDVRDARVIHRVGRLALSDQIVFVGVCSAHRGDAFAACSFIMDALKTSAPFWKKEMTSDGEHWVEQKASDRERTQAWSSD. 150
246 2.000e-74gi|518257559|ref|WP_019427767.1| molybdenum cofactor biosynthesis protein MoaE [Limnohabitans sp. Rim28]  clstr ali  39  5..VTIQTEDFNVSQEIEVLRAQDLRVGAVCSFVGTVRDTRDEVQAMELEHYPGMTEKSIEAMIEQAHQRFDFYAARVVHRVGRLLPSDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPQGAQWVDARISDDAALARWGIQS 159
247 2.000e-74gi|563834250|ref|WP_023800669.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium sp. L48C026A00]  clstr ali  48  8.TVRIQAEDFDVAAEIARMTQGRADIGAVVTFSGLCRDEAGRLAALELEHYPGMAEAEIGRIAAEAVQRWPLQGLTAIHRHGRIAPGENIVLVVAASAHRQAAFEAANFLMDYLKSRAPFWKKEHHTDGSEWVDAKEADDEAASRWKR.. 156
248 2.000e-74gi|499368109|ref|WP_011055687.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Yersinia pestis]  clstr ali  44  7.RIRVGAEAFSVGDEYTWLSQCDED-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALTEIIADARSRWSLQRVSVIHRVGPLFPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATVEGERWVESRDSDHIAAKRW.... 152
249 2.000e-74gi|589606701|gb|EXI78356.1| Molybdopterin synthase catalytic subunit [Candidatus Accumulibacter sp. BA-92]  clstr ali  44  1MRISVQEGDFDVGAELAALRQGNPQIGAVASFVGLVRDSNDGVAEMSLEHYPGMTEKALAEIVEEACRRWAIIDALVIHRVGRLLPSEQIVLVAVAGAHRGEAFAACEFIMDYLKTRAPFWKREVTPSGARWVDARAADDQAAERWQEPG 152
250 2.000e-74gi|496226493|ref|WP_008940528.1| molybdenum cofactor biosynthesis protein E [Marinobacter santoriniensis]  clstr ali  37  1.MISVQTDDFDPSAEYQSLRDSGSGTGAIVTFTGLVRDSGDDVQGLYLEHYPGMTEQVIQGLIDEASQRWDVRRARVIHRVGPLALRDQIVFVGVCSAHRGDAFKACEFIMDALKTSAPFWKKEITAEGEHWVEQKSGDRARSSRWE... 148
251 2.000e-74gi|557914694|ref|WP_023471537.1| Molybdopterin synthase catalytic subunit [Betaproteobacteria bacterium MOLA814]  clstr ali  39  1MTVRIQTQDFDVSTELAALHANNLQVGAVCSFVGTVRIWNKDIHGMTLEHYPGMTEKAIEAMVVQAKARFDMFDAVVIHRVGELLAGDQIVLVAVTSTHRHESFQACEFLMDYLKTQAPFWKKEHTAAGAQWVDAREADDAALARWGINA 156
252 2.000e-74gi|640278743|ref|WP_024848524.1| molybdopterin synthase catalytic subunit [Aminobacter sp. J41]  clstr ali  44  9..VRVQAEDFDAAQEIARLTAGRTDIGAVVTFSGLCRDENGALSALELEHYPGMAEAEISRIANEATERWPLTGLTVIHRYGMMRPGDNIVLVVAASSHRQAAFEAASFLMDFLKTRAPFWKREHRADGTEWVAAKEEDDAAQARW.... 154
253 2.000e-74gi|502752553|ref|WP_012987537.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus bovienii]  clstr ali  41  3....VQRERFNVGDEYQWLSQCDDD-GAVVTFTGKVRNYNDSVKALTLEHYPGMTEKMLQVIIDEARQRWPLQRISVIHRIGELYPGEEIVFVGVTSAHRSMAFTAAEFIMDYLKTRAPFWKKESLVEGERWVATRESDQEAAGRW.... 145
254 2.000e-74JCVI_PEP_1096685142461 /source_dna_id=JCVI_ORF_1096685142460 /offset=0 /translation_table=11 /length=156 /full_length=156  ali  38  7..VRVQTVDFNVTDEYHQLAQDNSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTERVLEQIVAEARERWPLNKVTVIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDKGKNWVEAKDADEQAAQLWQHK. 154
255 3.000e-74gi|496588321|ref|WP_009286926.1| Molybdopterin biosynthesis MoaE [Halomonas titanicae]  clstr ali  48  9IKVTIQAAPFPMDYGYDDALAGRSDIGAVVSFTGLVRDFNEDVTGLTLEHYPGMTERTLTEIGEQAWQRWSLQAVRIIHRVGYLGPGDPIVRVLVASAHRREAFEACDFIMDYLKTQAPFWKKEHSAQGEYWVKERHSDQQDAARWE... 157
256 3.000e-74gi|496229439|ref|WP_008943474.1| molybdenum cofactor biosynthesis protein MoaE [Oceanibaculum indicum]  clstr ali  40  1.MIRVQREDFDIGAEIAALTDGNHAIGGVASFTGLVRDMAGGIGAMTLEHYPGMTEKALARIEAEAQERWPLQASLIIHRYGRLEPGDRIVLVVTASAHRQAAFDSAMFLMDYLKTQAPFWKLEETGEGAQWVDARESDDHALARW.... 147
257 3.000e-74gi|504233240|ref|WP_014420342.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter hydrocarbonoclasticus]  clstr ali  37  1.MISIQTDDFDAGAEYEALRLTGPGTGAIVTFSGLVRDSGDGVTGLFLEHYPGMTEQVIQGLIDEAGRRWDVQRARVIHRVGRLALADQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITREGEHWVEQKESDVARSRNWE... 148
258 3.000e-74gi|495523072|ref|WP_008247717.1| molybdenum cofactor biosynthesis protein MoaE [gamma proteobacterium BDW918]  clstr ali  41  5..VRVGEADFDVGAECRALASHSRQSGAIVQFVGLMRDSNDDVLTMELEHYPGMTERCITEIVNRAQQRWPLFAVTVIHRVGVLQPQDQIVFVGVSAAHRLDAFQSCEFIMDYLKTEAPFWKKECTLNGERWVDARQTDQQARKRWQ... 152
259 3.000e-74gi|500950031|ref|WP_012029605.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium sp. ORS 278]  clstr ali  42  5VTVRVQHEDFDTAAEIAALSHGRTDIGAVVSFSGLCRDHATPISALTLEHYPGMAEAEIMRHAEQAMARWPLQGLTVIHRFGRITPGENIVLVVTASSHRQAAFEAAEFLMDYLKTNAPFWKREETNDGGSWVEAKSHDDAAAARWTK.. 154
260 4.000e-74gi|652803819|ref|WP_027099890.1| molybdenum cofactor biosynthesis protein MoaE [Comamonadaceae bacterium URHA0028]  clstr ali  40  5.RVAIQHEDFDVSAELAQLRAADHRVGAVCSFVGTVRAAAKTVLDMELEHYPGMTEKAIEAMVDEAQRRFDIFAARVVHRVGLLGPGEQIVFVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKERTPEGEHWVDARISDDAALARWGIQG 157
261 4.000e-74  ali  42  5.RIVVSPARFSVSEEYPWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAEIVELARERWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTRAPFWKREATPDGERWVDARDSDRQAAERW.... 150
262 4.000e-74gi|495335242|ref|WP_008059979.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas sp. GM78]  clstr ali  38  1MTVRVQYKTFDTGQLIDRLRANDPGVGAVVNFVGYVRDINQGVTSLFLEHYPGMTERSLQKIIDNAKTRWPLKAVEIVHRIGQLSVSDPIVFVGVSSQHRQAAFDACAFIMDYLKTDAAFWKREDVASRARWVDARDSDRSAAGRWETVS 152
263 5.000e-74gi|499513561|ref|WP_011200201.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Mannheimia succiniciproducens]  clstr ali  35  15IKIAVQEAEFDQNSEYRWLSQSD-SVGASVIFVGKVRDLNDEVSSLYLEHYPAMTEKALNEIVDEAKSRWDIQRVVVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTKAPFWKKEKTDKGERWIESRDSDQQAAEKW.... 161
264 5.000e-74gi|633287858|gb|KDB52762.1| molybdopterin biosynthesis MoaE protein [Sphaerotilus natans subsp. natans DSM 6575]  clstr ali  42  9.RVAIQTEDFDLSAEVAALRAGDGAVGAVTTFIGTVRDRHAGVSAMELEHYPGMTERAIEAMIDEALRRFDIRAARVVHRVGPLAIGDQIVLVAVSSMHRGESFQACEFLMDWLKSEAPFWKKETTAEGARWVDARVSDERALARWGIAS 165
265 5.000e-74gi|503132351|ref|WP_013367012.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacter lignolyticus]  clstr ali  45  5.RIIVDTAAFDVGAEYRWL-AGRDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVEEARSRWPLGRVTLIHRIGEMWPGEEIVFVGVTSAHRSSAFAAGEFVMDYLKTRAPFWKREATPEGERWVDARDSDREAAERWQ... 151
266 5.000e-74gi|530669879|dbj|BAN68295.1| molybdopterin synthase catalytic subunit [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  42  4.RIAVQTEPFDLAEETARLSAGDATIGAVASFVGLVRGHNRDITTLILEHYPGMTEKALSRIVDAAAERWPLQAVTVIHRVGELRLGEPIVLVLTASAHRQAAFESCQFIMDILKTEAPFWKKERLPDGERWVDARESDSEAAARWLRD. 158
267 6.000e-74gi|503341713|ref|WP_013576374.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rahnella sp. Y9602]  clstr ali  43  6..IVVDAAPFSVGDEYNWLAQSDAD-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALAEIVAKARTRWPLQRVSVYHRVGPMYPGDEIVFVGVTSAHRGMAFEANEFIMDHLKTRAPFWKREATEEGDRWVDARDSDKQAAARW.... 150
268 6.000e-74METAHIT V1 GL0114486 [Complete] locus=scaffold55408_6:969:1421:-  ali  43  5.RILVGHERFNVGTEYDWL-AGRDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAAIVEEARGRWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTKAPFWKREATPEGERWVESRDSDKHAASRW.... 150
269 6.000e-74gi|589830241|gb|EXJ12661.1| Molybdopterin synthase catalytic subunit [Nitrincola sp. AK23]  clstr ali  36  14ITSRIQTQCFDISYEIEALHQGRTDIGALVSFLGYVRDFNEDVIALTLEHYPEMTEQALDEIQLNATQRWPLLGTRVIHRVGRLEPTDPIVLVLAVSSHRQHAFDACSFIIDQLKTQAPFWKKEHTASGDYWVSARYSDEHAAKRWN... 162
270 6.000e-74gi|488369113|ref|WP_002438498.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Escherichia hermannii]  clstr ali  44  5.RIRVGHEGFSVGDEYQWLASCDED-GAVVTFTGKVRNHNESVSAMTLEHYPGMTEKALAEIVAEARQRWALQRVSVIHRIGELWPGDEIVFVGVTGAHRSQAFEAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDHQAAERW.... 150
271 6.000e-74gi|635596009|dbj|BAO81166.1| molybdopterin converting factor, large subunit [Comamonadaceae bacterium A1]  clstr ali  44  11..VRIQTEDFDLSAEVAALHAADARVGAVAVFVGTVRDEGQALDCLELEHYPGMTERAIEDMVEQARQRFEIFGARVLHRVGRLGLGEQIVLVAVTAAHRGQAFQACEFLMDYLKTQAPFWKKEHGATGSRWVDARTSDDAALAKWGIAA 160
272 6.000e-74gi|497815607|ref|WP_010129763.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus sputorum]  clstr ali  37  6..IQVQEDNFDQNAIYQWLSAEH-SVGATTLFVGKVREMNDNVSGLYLEHYPAMTEKALQEIVAQARQRWDLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKRETTQEGERWIEGRESDQQAADKWE... 151
273 7.000e-74JGI.Meta 7002975176 C2680359__gene_119763 moaE protein [Human Tongue dorsum microbiome from visit number 2 of subject 159207311]  ali  36  6..IQVQEDNFDQNAIYQWLSAEH-SVGATTLFVGKVREMNDNVSGLYLEHYPAMTEKALQEIVAQARQRWDLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKRETTQEGERWIEGRESDQQAADKWELD. 153
274 8.000e-74gi|497409224|ref|WP_009723422.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas sp. TD01]  clstr ali  43  11IAVRVQEEPFKMDDGYESLLRKRTDIGAIVTFTGLVRDFNEDVIGLTLEHYPGMTERTLTQIGEQAYQRWALQAVQIIHRIGDLTPGDPIVRVLVASAHRRDAFQACDFIMDFLKTQAPFWKKEHSRQGAYWVKERHTDQQAAERW.... 158
275 8.000e-74gi|493221343|ref|WP_006201583.1| molybdenum cofactor biosynthesis protein MoaE [Mesorhizobium amorphae]  clstr ali  46  9..VRIQREDFDVAAEIARLSEGRADIGAVVTFSGLCRDEQGRLSALELEHYPGMAEAEIARIASEAIERWPLHGLTVIHRHGKVRPGGNIVLVVTASAHRQAAFEAANFLMDYLKSRAPFWKKEHHADGSAWVDAKEIDDKAAGRWKAPS 158
276 9.000e-74gi|517747006|ref|WP_018917214.1| molybdenum cofactor biosynthesis protein MoaE [Halomonas zhanjiangensis]  clstr ali  45  3IRVYVQATPFALADGYEQVLAQRTDIGAVVSFTGLVRDFNEDVTGLTLEHYPGMTERTLESIGEQAWQRWSLQAVYIVHRVGYLTPGDPIVRVLVASAHRREAFEACDFIMDFLKTQAPFWKKEHSGQGEYWVKERTTDTQDAARW.... 150
277 1.000e-73gi|492534362|ref|WP_005876201.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacter formigenes]  clstr ali  39  2ISIHVQTGDFDLTEEVNRLRSDRRDIGAVVSFLGTVRDGDETVLSMELEHYPGMTEQVLQEIAEEACRRWDVMDLAVIHRVGKLEPSDQIVLVAAGSRHRGEAFRACEYVIDQLKTRAPFWKKEETPEGSRWVAAKPDDETASRKW.... 149
278 1.000e-73gi|640486253|ref|WP_024926198.1| MULTISPECIES: molybdopterin synthase catalytic subunit [Mesorhizobium]  clstr ali  51  9..IKIQAQDFDIAAEIGELTAGRADIGAVVTFSGLCRDEAGALVALELEHYPGMAEAEIGRIAVEAIGRWPLQGLTVIHRHGRIRPGENIVLVVTASAHRLAAFEAANFLMDYLKSRAPFWKKEHRADGSDWVEAKDSDEAAAARW.... 154
279 1.000e-73gi|502478495|ref|WP_012801260.1| molybdenum cofactor biosynthesis protein MoaE [Kangiella koreensis]  clstr ali  44  1MLVKVQHEDFDLALVRDYFKQYGAEVGAVVTFTGLVRDFQERVEALTLEHYPGMTESVLTQLAEDAKSRWNLTGVVIIHRVGTLHPGDNIVLVATASAHRQDAFNSCQYIMDTLKTTAPFWKKEETDHGARWVEAKQSDHGEMDKWQASA 156
280 1.000e-73gi|640622574|ref|WP_025050600.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter sp. NB-68]  clstr ali  47  1MRISVQESPFDLGKETAGFSAGRKDMGALVTFTGVVRDLGDPLQALEIEHYPGMTEAALTEIAEQAMARFSLGDALVIHRYGRLVPGEMIMMVATAAPHRNDAFDGAEFLMDYLKSRAPFWKREITATGADWVASKAEDEAALDRW.... 147
281 1.000e-73METAHIT V1 GL0111328 [Complete] locus=scaffold55032_4:6961:7416:+  ali  32  1VKISVQTEDFDVQKEYGELKA-NPHAGAVVMFVGNVRDINEGIEKMSLEHYPGMTEKSLTKIVKEAQERWHIQDATVIHRVGDLEINDQIVFVGVSGGHRGECFDACEFIIDYLKTEAPFWKKETIDGKGKWVDARESDDEAMSKWN... 148
282 1.000e-73gi|518735245|ref|WP_019894958.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira halophila]  clstr ali  39  8..IRVQTDDFDLSHEVKALREGHKDIGAVVSFVGTVRDVNDDVAVLELEHYPGMTEKALENIRQKAHQRWPLQNSLIIHRVGEMRPCDQIVLVAVASRHREAAFEGAHFIMDFLKTHAPFWKKETLPDGTRWVDARLSDDEAKKKWLKAS 158
283 1.000e-73gi|495606615|ref|WP_008331194.1| molybdenum cofactor biosynthesis protein MoaE [Maritimibacter alkaliphilus]  clstr ali  47  3.MIRVQSEPFSLGDEAEAFAKGRTDTGAVVTFTGIVRD-TGGMARMEIEHYPGMTEKAISGIVDQAMDRWSLDDALVIHRYGSLAPGERIMMVATASRHRVAAFEAAEFLMDYLKSRAPFWKKEFGPDGAEWVAAKDEDEDALSRW.... 146
284 1.000e-73gi|515521923|ref|WP_016955177.1| hypothetical protein [Catenovulum agarivorans]  clstr ali  36  5..IKVQNNDFSVAEQYQQLIENNQQDGAVVFFVGLVRDFNQSIKSLTLEHYPAMTEKVLKQIVAQAREKWSLGRVAVVHRVGTMQLGEQIVFVGVTSQHRQAAFEAGQFIMDILKTQAPFWKKEQTEQGSHWVDAKESDQAQAQNW.... 150
285 1.000e-73gi|640440327|ref|WP_024901232.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia andropogonis]  clstr ali  39  1MRIVVQEADFDTGQELTALRVAHPGAGAVVAFVGAVRDISGGVDMLELEHYPGMTERALADIVAQAARRWPFQGVTVIHRYGPLRPTDQIVLVAVASAHRGEAFSACEFIMDYLKTEAPFWKKEGTGGARRWVDARETDDHARSRWGGGG 153
286 1.000e-73gi|495406572|ref|WP_008131271.1| molybdenum cofactor biosynthesis protein MoaE [Pseudoalteromonas sp. BSi20480]  clstr ali  41  3ISINVQTQDFSVGKQHDALCSNNKSDGAVVTFTGLVREFGDNVIALELEHYPGMTEQLLQSIAEQAQTRWQLARISIIHRVGYLALGEQIVFVGVTSRHRQAAFEGAQFIMDYLKNHATFWKKEHFKDSSNWVEFKQSDKQALNKWQS.. 152
287 2.000e-73JCVI_PEP_1096669731989 /source_dna_id=JCVI_ORF_1096669731988 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  40  1.MISVQTEDFNVAAEYTALRHQAGDAGAIVLFTGLVRDGSDRTQRLFLEHYPGMTEKQLEAISQQASKRWPLLGVRILHRVGELYPGDQIVLVATASRHRQAAFESADFIMDFLKSRAPFWKKQTSQSESRWIESRESDIDALKRWQE.. 157
288 2.000e-73JCVI_PEP_1096671195973 /source_dna_id=JCVI_ORF_1096671195972 /offset=0 /translation_table=11 /length=172 /full_length=172  ali  44  26.RIIVSHDRFKVGDEYPWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAEIVEQARERWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTRAPFWKREATPEGERWVDARDSDREAAERW.... 171
289 2.000e-73gi|499813836|ref|WP_011494570.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella denitrificans]  clstr ali  35  5VKIAVQEADFDHAQEYARIAQDNND-GAVVTFCGKVRDFNEGITRLTLEHYPGMTESVLAQICQQALQRWSINHLTVIHRVGSLDLGEQIVFIGVSSAHRGDAFAACEYLIDFLKTKAPFWKLEATHQGERWLDARDTDEVAANTWQQ.. 153
290 2.000e-73gi|495494509|ref|WP_008219168.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera nanhaiensis]  clstr ali  41  3IFVAVQSDDFCVASEYNELRRQS-GCGAIVTFSGLVRELSDNLHSMTLEHYPGMTEQALTAIAEQAQQRWQLGAVHLIHRVGTLKPHEQIVFVGIASPHRAAAFAACEFIMDYLKNRAPLWKKEHTSNGDYWVEAKTSDQHALTRWD... 149
291 2.000e-73gi|518485731|ref|WP_019655938.1| molybdenum cofactor biosynthesis protein MoaE [Variovorax paradoxus]  clstr ali  40  5.RVSIQTNDFDLSREVAALRAGDKRVGAVCSFIGTVRDRNNTITSMELEHYPGMTEKAIEAMIDEAHRRFDILGARVIHRVGLLQPEDQIMMVAVVSAHRGQSFQACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGISA 183
292 3.000e-73gi|499148425|ref|WP_010861753.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Plesiomonas shigelloides]  clstr ali  39  7.RIRVSEDDFDIAAEYTWLNQDD-SCGAVVTFTGKVRNHSGSVNGLHLEHYPAMTDKALNDIISEARARWPLGRVSLIHRVGELGSGEQIVYVGVSSGHRLAAFAAAEFIMDYLKVRAPFWKKEQMPDGARWVEAKTSDQEAARRWQSE. 155
293 3.000e-73gi|493339868|ref|WP_006296783.1| molybdenum cofactor biosynthesis protein MoaE [Hylemonella gracilis]  clstr ali  40  5.RVSIQTNDFNVAAEIAALRARDARVGAVCSFIGTVRDRNEGVSAMELEHYPGMTEQAIEGMIDEALQRFDIYAARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPQGARWVDARVSDDEALARWGISA 184
294 3.000e-73gi|494467368|ref|WP_007256868.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola granulosus]  clstr ali  46  1MSVRVQPEPFDAGAELNAFAARASGAGAVVTFTGLVRDISGGLAHMEIEHYPGMTERAISSIVAEATERFGLDAALVIHRHGRLAPAEPIMMVATAARHRGSAFEAAVFLMDYLKSRAPFWKKEVTADGAEWVAARDEDEAALSRW.... 146
295 3.000e-73gi|516541971|ref|WP_017929596.1| hypothetical protein [Loktanella hongkongensis]  clstr ali  47  1MKIRVQEAPFDAGAELDAFAHGRHEVGAVVSFTGIVRDRDGGLVHMQIEHYPGMTEKAITAIAETAKARWDLADLVVIHRFGTLPVGQPIMMVATAAPHRRAAFEAAEYLMDYLKSRAPFWKKEVTQAGEHWVEATPEDEDALSRW.... 146
296 3.000e-73gi|495460069|ref|WP_008184761.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae bacterium HTCC2150]  clstr ali  42  1MGVRVQTDPFNAGAELKTFSSVQTNAGAVVTFTGIVRDLPDNLAFMEIEHYPGMTEKALEKICDTAIERWKLADALVIHRYGKLTAGEDIMMVATASKHRKDAFEAAEFLMDYLKSRAPFWKKEHAKDGADWVAQRSEDEDALNRW.... 147
297 3.000e-73gi|518000315|ref|WP_019170523.1| molybdenum cofactor biosynthesis protein MoaE [Pseudaminobacter salicylatoxidans]  clstr ali  49  8..VRIQREDFDIQSEVARISDGRADIGAVVTFTGLCRDEAGRLSALELEHYPGMAEAEISRIAAEAVARWPLQGLTVIHRYGRIVPGENIVLVVAASAHRQAAFEAANFLMDYLKSRAPFWKKEHHADGTEWVEAREADDEALTRWRR.. 155
298 4.000e-73gi|517138569|ref|WP_018327387.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobium giardinii]  clstr ali  43  6VTVRVQRDDFDLAAEVRALSASRHDIGAVVTFSGLCRDEAGTLSALELEHYPGMAEAEIARICRQAIDRFGLQAATAIHRYGKILPGENIVLVVTASPHRQAAFDGANFIMDFLKTSAPFWKKEHATDGSAWVSAKDADDGARDRWSKS. 156
299 4.000e-73gi|495525255|ref|WP_008249900.1| molybdenum cofactor biosynthesis protein MoaE [Limnobacter sp. MED105]  clstr ali  43  6..VLVQEADFDVTEEIRWLRQGLPEIGAVATFIGTVRDINENVSAMTLEHYPGMTEKALENILQVADARFDITSAMIIHRVGPLYPEDQIVFAAATSEHRQQAFLACEFMMDYLKTEAPFWKKEDTPEGSRWVSARDSDDSAKERWEQ.. 153
300 4.000e-73gi|589087158|gb|AHK43914.1| putative molybdopterin converting factor subunit [Ensifer adhaerens OV14]  clstr ali  45  9VTVRVQREDFDLSAEVSKLSSGRPDIGAVVTFSGLCRDEAGTLTALELEHYPGMAEAEIERICRLAVERFGLQAATAIHRYGKINPGENIVLVITASPHRQAAFDGANFIMDFLKTSAPFWKKEHSSDGTAWVSAKDADDTARDRWKR.. 158
301 4.000e-73gi|501410404|ref|WP_012441970.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia tasmaniensis]  clstr ali  41  4.RIRVGDAPFSMGDEHRWLSASDLD-GAVVTFTGKVRNHNDDVNALTLEHYPGMTEKALAAIVAEARQRWAMQRVTIIHRIGELFPGDDIVLVGVSAVHRGAAFDAAEFIMDQLKTRAPFWKREATADGQRWVAARESDRHAAARWK... 150
302 4.000e-73gi|508729531|emb|CCK75016.1| Molybdenum cofactor biosynthesis protein E [Oleispira antarctica RB-8]  clstr ali  34  1.MISVQNEDFDFANEYQQLRKRSLQSGAIVMFVGLVRDFSDNVSSMTLEHYPGMTENVLNGIAQQAEQRWPLDGVRIIHRVGELHAADQIVLVGVSSAHRIAAYEASQFIMDILKTEAPFWKKESTQDGERWVDAKNSDSQQAADWHTP. 155
303 4.000e-73gi|653031915|ref|WP_027283677.1| molybdenum cofactor biosynthesis protein MoaE [Rubritepida flocculans]  clstr ali  43  3.SIRVQEAPFDVAAEMAALTAGRTDIGALASFTGICR-VDDGLAAMVLEHYPAMTERALARIAEQAMARWPLTGCTVIHRVGRLTPGEPIVLVLTASAHRQAALEACAFLMDWLKTKAPFWKREEPREGPRWVEARESDEDAAARWTRTA 151
304 5.000e-73JGI.Meta 7055301230 SRS054590_LANL_scaffold_12536__gene_37184 moaE protein [Human Stool microbiome from visit number 1 of subject 338793263]  ali  38  5.TIRVGEADFSVSDELAKLN-DQADCGAVVSFLGVVRRANEGVYAMTLEHYPAMTEKALAGIVERARARWQLGDITVIHRVGRLLPGDQIVLVAVAASHRGEAFQACEFIMDWLKTEAPFWKKEETPDGARWVDARVSDDEAKRRWE... 151
305 6.000e-73gi|628968315|gb|KCV80823.1| molybdopterin synthase subunit MoaE [Actibacterium sp. 22II-S11-z10]  clstr ali  44  1MAVQVQKEAFDVGAEVNCFTAGCKDAGAVVSFTGIVRNNADGLQRMQIEHYPGMTEKALAGIEAQARDRWPLQDVLIIHRHGDLAPGEVIMMVATASKHRMAAFEAAEFLMDYLKSRAPFWKQEFTAQGSDWVAAKDVDEDALKRW.... 147
306 6.000e-73gi|522079907|ref|WP_020591116.1| hypothetical protein [Kiloniella laminariae]  clstr ali  39  1.MIRVQSEDFDLALEVRKLTEGNPAIGAVTAFIGLVRDIAGDISSMTLEHYPGMTEKMLREIETEAHQRWELDASLIIHRYGQLAPGDQIVLVVTCSKHRQAAFESCEFLMDFLKTKAPFWKLEQTPEGGKWVDARDGDTEATERWLKS. 150
307 7.000e-73gi|494185546|ref|WP_007118937.1| molybdenum cofactor biosynthesis protein MoaE [Oceanibulbus indolifex]  clstr ali  45  1MRVLVQEAPFDLAEETARFAKGEGGSGAIVTFTGVVRDNGAGLSAMEIEHYPGMTEKALCEIAEQAMARFELQDALVIHRYGRLVPGEQIMMVASAARHRRSAFEAAEFLMDYLKSRAPFWKREITAEGEAWVAAKDEDEAALERW.... 147
308 7.000e-73  ali  36  4IQISVQEQPFDQNAVYQWLSEQH-SVGATVIFVGKVRDLNDEVSSLYLEHYPAMTEKALREIVEQAKARWDIQRVSVIHRVGLLHTGDEIVLVGISSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALNKW.... 150
309 8.000e-73JCVI_PEP_1096678544949 /source_dna_id=JCVI_ORF_1096678544948 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  36  5..VLIQNADFDFAYEYQSLLDNNNKDGAVVCFVGLVRDYNQGVSGLTLEHYPGMTEKALRDIVIKAKKRWPVGQVRVIHRIGELKLSEQIVFVGVTSKHREAAFAANQFIMDYLKNDAPFWKKEQTNKGDRWVEAEKKDLDAKNRWDHTS 154
310 8.000e-73gi|505310883|ref|WP_015497985.1| molybdopterin-converting factor subunit MoaE [Octadecabacter antarcticus]  clstr ali  41  1.MIRVQAMPFDPGGELNVFSASVAGAGAIVSFTGVVRDVAGGLSGMEIEHYPGMTEKALSAIRGEAMQRWDLADALVIHRIGQLEAHESIMMVATASQHRKSAFEAAEFLMDYLKSRAPFWKKEITLDGSDWVDSKAEDEDALSRW.... 145
311 8.000e-73gi|497590891|ref|WP_009905075.1| molybdenum cofactor biosynthesis protein MoaE [Burkholderia thailandensis]  clstr ali  44  3.TVRVQTDDFDVSAEIAALRARNPKVGAVACFVGTVRDLNEGVDALELEHYPGMTEKALAAIADDAIARWPGIDVAIVHRVGKLRPLDQIVFVATVSAHRGDAFQSCEFVMDYLKTQAPFWKKENTPAGERWVDARSADDAALARWGVES 153
312 9.000e-73gi|499900579|ref|WP_011581313.1| molybdenum cofactor biosynthesis protein MoaE [Chelativorans sp. BNC1]  clstr ali  46  6.HIRVQAEDFDLAVEIDRLTDGRRDVGAVVTFTGKCRDEGGRLAALELEHYPGMAEAEMTRIARQAAERWQLSGLTVVHRYGKIRPGENIVLVVTASSHRKAALEAADFLMDYLKSRAPFWKKEHLTDAGQWVEAKAEDENALERWKK.. 154
313 1.000e-72gi|497824569|ref|WP_010138725.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola sp. S124]  clstr ali  47  7..IRVQSAPFDPGAELSAFTAARAGCGAVVSFTGLVRDLSGGLSAMEIEHYPGMTEKALAGIAADASGRWDLGPVLILHRYGRLGAEEPIMMVATASRHRRAAFEAADFLMDYLKSRAPFWKKESTDAGASWVAAKDEDEDALSRW.... 152
314 1.000e-72gi|542099246|ref|WP_021015415.1| molybdopterin biosynthesis MoaE protein [Serratia sp. ATCC 39006]  clstr ali  43  5.RIHVGEAGFNVGEEYNWLAQCDED-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALADIVAEARSRWPLQRVSVIHRIGAFYPGDEIVFVGVTGAHRSTAFDAAQFIMDYLKTRAPFWKREATPEGDRWIESHDSDKQAAERW.... 150
315 1.000e-72gi|647626210|ref|WP_025899732.1| molybdenum cofactor biosynthesis protein MoaE [Sneathiella glossodoripedis]  clstr ali  39  1.MVIVQQEIFDSGAVIADVAGQSTDIGAVVSFTGYVRDFNDGVKSLTLEHYPGMTEKQLEKIEQEARSRWKLTDCRIIHRFGTMELGEPIVLVVTASAHRQDAFEAAAFLMDWLKTKAPFWKLEETAQGERWVKERQSDLDAANKWK... 149
316 1.000e-72gi|497287652|ref|WP_009601869.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio caribbenthicus]  clstr ali  40  3IKVSVQVEDFSVSYEHQCLSEGS-HSGAVVTFCGNVRDMNLGIKGLTLEHYPGMTEKIINHICSEAISRWSIEKIRVVHRVGELNVGEQIVFVGVASGHRREAFSACEFIMDNLKTRAPFWKKERTTDSTRWIDARSSDSDAVLRWDK.. 151
317 1.000e-72gi|497056661|ref|WP_009450230.1| molybdenum cofactor biosynthesis protein MoaE [Nitratireductor indicus]  clstr ali  46  2...RVQQEDFDLSEEVAALTAGRRDVGAVVSFAGLCRDENGRLTALELEHYPGMAEAEISRIAAEALGRWPLTGLTVIHRFGKILPGGNIVLVVASSEHRRAAFEAADFLMDFLKSKAPFWKKEHTVDGTQWVTAKDSDEEDIKRWK... 147
318 2.000e-72gi|550980096|ref|WP_022728204.1| molybdenum cofactor biosynthesis protein MoaE [Fodinicurvata sediminis]  clstr ali  39  1MTVRIQEEDFDPGSELEKLTGGQTAIGGVTSFIGLVRDMAGDVTGMTLEHYPGMTEKMLERIEAEAHERWPLNASLIIHRVGPLEAGDRIVMVATASAHRQATFDSCHFLIDWLKTKAPFWKAERTREGQEWVEARESDDEASERWNR.. 151
319 2.000e-72gi|653402919|gb|KEA51831.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Mangrovibacter sp. MFB070]  clstr ali  42  6.RIGVGHGNIDVGAEYQWLAACDDD-GAVVTFTGKVRNHNDNVSALCLEHYPGMTEKALEEIVATARERWPLQRVTVLHRIGEMYPGEEIVFVGVTGAHRSSAFAAAEFIMDYLKTRAPFWKRESTEQGARWVEARESDKVAAERW.... 151
320 2.000e-72gi|490716439|ref|WP_004579004.1| molybdenum cofactor biosynthesis protein E [Marinobacter nanhaiticus]  clstr ali  38  1.MIRIQTEDFDVGTEIAAL-ENNGRSGAIATFTGLVRNRGDDVAALFLEHYPGMTENVIADLIDQARGRWTIDDARVIHRVGHLPLGDRIVFVGVSSAHRQDAFAACEFIMDALKTSAPFWKKEITADGEHWVEQKDSDREKAKGWGN.. 149
321 2.000e-72gi|652362093|ref|WP_026758213.1| molybdenum cofactor biosynthesis protein MoaE [Sediminimonas qiaohouensis]  clstr ali  44  1MTIRVQEQPFDLGEEANAFADAQDDAGAVVTFTGIVRDGGAGLDRMVIEHYPGMTEKALGQIAADARTRWELADVLIIHRYGEMRAGERIMMVAAAARHRKNAFDAAEFLMDYLKSRAPFWKKEHTTDGGDWVAARDEDEDALKRW.... 148
322 2.000e-72gi|574575103|gb|ETW12178.1| molybdopterin converting factor subunit 2 [Roseivivax sp. 22II-s10s]  clstr ali  53  1MRIVVQEAPFDYGAECDGFATGRTDVGAVVTFAGLVRSDAD-LDRMEIEHYPGMTESALTAIAEEAARRWSLQDVLVIHRVGPMRPGERIMMVATAAPHRRDAFEAADYLMDYLKSRAPFWKKEHGPQGESWVEAKATDEDALSRW.... 145
323 2.000e-72gi|548225197|ref|WP_022444148.1| molybdopterin biosynthesis MoaE protein [Sutterella sp. CAG:351]  clstr ali  41  6..VIVRHEDFDVSREMEELRKGSGSAGAMVAFTGVVRNRNDDIFALTLEHYPGMTESAITAIADKARARWELDDIVVIHRVGRLEVGDQIVLCLVTSAHRGEAFEACEYIMDWLKTEAPFWKKEETPSGSRWVDARESDEKAKARWQ... 152
324 2.000e-72gi|652343366|ref|WP_026740563.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Lonsdalea quercina]  clstr ali  42  5.RIRVGEAAFSVGDEYAWLAACDED-GAVVTFTGKVRNHNENVSALTLEHYPGMTEKALAEIVEEARERWPLQRISVVHRIGALYPGDEIVFVGVTGAHRGAAFDAAEFIMDQLKTRAPFWKRESTDEGERWXASRDSDRLAAKRWTR.. 152
325 2.000e-72gi|501020732|ref|WP_012073403.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Actinobacillus succinogenes]  clstr ali  34  4IRIAVQEAEFDQNAEYRWLSENH-SIGATTIFVGKVREMNDEVASLYLEHYPAMTEKALREIVEEAKQRWDIQRISVIHRVGLLQTGDPIVLVGVSSAHRGDAYAANEFIMDYLKTRAPFWKKEQTAQGERWLESRDSDHQAVGKWSRE. 153
326 2.000e-72METAHIT MH0016 GL0013392 [Complete] locus=scaffold79696_1:5117:5572:-  ali  37  7..IRVSHDDFDVSEEIAALEREGRNAGAVVTFTGVVRS-DDGVTAMHLEHYPEMTEKSLAQIVEKARARWNIEDVVIIHRVGELKAGDRIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKEVTAQGGRWVDARESDEIAKNRWGK.. 151
327 2.000e-72  ali  37  7..IRVSHDDFDVSEEIAALEREGRNAGAVVTFTGVVRS-DDGVTAMHLEHYPEMTEKSLAQIVEKARARWNIEDVVIIHRVGELKAGDRIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKEVTAQGGRWVDARESDEIAKNRWGK.. 151
328 2.000e-72gi|495445205|ref|WP_008169899.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter manganoxydans]  clstr ali  36  1.MISVQSEDFDVAEEYAALRDSGAGTGAIATFTGLVRDSGDGVTGLYLEHYPGMTEQVIQGLIDDASKRWDVREARVIHRVGRLALCDQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEIASDGEHWVEQKESDLARSEGWE... 148
329 2.000e-72gi|653085499|ref|WP_027335875.1| molybdenum cofactor biosynthesis protein E [Halomonas sp. HL-48]  clstr ali  45  3ITIRVQAAPFDMAFGYEDSIAGRTDIGGIVSFTGLVRDFNEDVTGLTLEHYPGMTEATLQQIAEQAGERWSLNAVTIIHRVGYMRPGDAIVRVLVASAHRREAFEACDFIMDWLKTQAPFWKKEHGRQGDYWVKERRSDIDDAARW.... 150
330 2.000e-72gi|490450177|ref|WP_004321067.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Thauera]  clstr ali  44  12..VSVQHEDFDVGGEIARLGEGRRDVGAVASFVGLVRDANDGVRAMTLEHYPGMTERALEEIVEQAKARWSLLSVRVIHRYGRLEPADRIVFVGVTSAHRGEAFAACEFIMDYLKTRAPFWKCEETPQGARWVDARESDD.......... 151
331 3.000e-72JGI.Meta 7070023873 SRS047634_LANL_scaffold_56701__gene_65197 moaE protein [Human Supragingival plaque microbiome from visit number 2 of sub  ali  36  10..IAVQEQPFDQNAVYLWLSESH-SVGASVIFVGKVRDLNDGVSSLYLEHYPAMTAKALRDIVTEAKSRWDIQRVAVIHRIGLLHTGDEIVLVGVSSAHRGDAYSANEFIMDYLKTKAPFWKKEQTDKGERWIESRDSDKQAADKW.... 154
332 3.000e-72gi|517166714|ref|WP_018355532.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pasteurella pneumotropica]  clstr ali  36  4INISVQEAEFDQNEVYQWLSAQH-SVGAVVIFVGKVRDLNDDVSSLYLEHYPAMTEKALREIVFEAKQRWDIQRVAVIHRVGLLHTGDEIVLVGVSSAHRGNAYQANEFIMDYLKSKAPFWKKEQTKKGERWIESQDSDKKALEKW.... 150
333 3.000e-72gi|495149543|ref|WP_007874350.1| molybdopterin (MPT) converting factor, subunit 2 [Ochrobactrum sp. CDB2]  clstr ali  43  11..VSVRSEDFDVAEEIHKLGEGRKDIGAIVTFTGLCRDEGGKLSALELEHYPGMAEAEIRRIVDEAISRWPLSGISIIHRYGLVKPGENIVLVVTASAHRQAAFEAASFLMDFMKTGAPFWKREHLIDGGSWVESKAEDDQSRERWQK.. 158
334 3.000e-72gi|517744099|ref|WP_018914307.1| hypothetical protein [Thiomonas sp. FB-6]  clstr ali  41  4..VRIQTEAFDAGAESRRLRAGRIDIGALVVFEGICRDHAEGVQSLELEHYPEMTRASIERMVGQARVRWPLQGAVVVHRVGLLHPGDPIVLVVVASSHRHDAFEACAFLMDYLKTQAPLWKKEATPQGAQWVDAREADDEALARWGIES 154
335 4.000e-72JGI.Meta 7071923912 C5470264__gene_149455 moaE protein [Human Stool microbiome from visit number 2 of subject 764002286]  ali  39  10..IRVGEADFSLDEELSRIMRESPSAGGVASFVGLVRNKNDGVSRMTLEHYPGMTEKSLAKIAAAARERFHLVDVIVVHRVGELKVGDRIVLCLTSAEHRGDAFAGCEYIMDWLKTEAPFWKKEQTPDGERWVDARESDDKARERW.... 155
336 4.000e-72JGI.Meta 7067540983 SRS024435_LANL_scaffold_33659__gene_89960 moaE protein [Human Stool microbiome from visit number 2 of subject 159571453]  ali  37  7..IRVSHDDFDVSEEIAALEREGRNAGAVVTFTGVVRS-DDGVTAMHLEHYPEMTEKSLAQIVEKARARWNIEDVVIIHRVGGLKAGDRIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKEVTAQGGRWVDARESDEIAKNRWGK.. 151
337 4.000e-72gi|491572899|ref|WP_005430480.1| molybdenum cofactor biosynthesis protein MoaE [Sutterella wadsworthensis]  clstr ali  39  6..IRVGEADFSLDEELSRIMRESPSAGGVASFVGLVRNKNDGVSRMTLEHYPGMTEKSLAKIAAAARERFHLVDVIVVHRVGELKVGDRIVLCLTSAEHRGDAFAGCEYIMDWLKTEAPFWKKEQTPDGERWVDARESDDKARERW.... 151
338 4.000e-72gi|491889064|ref|WP_005654170.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus influenzae]  clstr ali  36  4IQIAVQEQSFDQNAVYQWLSELH-SVGATVIFVGKVRDLNDAVSSLYLEHYPAMTEKALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALEKW.... 150
339 4.000e-72  ali  41  6..VIVRHEDFDVSREMEELPKGSGSAGAMVAFTGVVRNRNDDIFALTLEHYPGMTESAITAIADKARARWELDDIVVIHRVGRLEVGDQIVLCLVTSAHRGEAFEACEYIMDWLKTEAPFWKKEETPSGSRWVDARESDEKAKARWQ... 152
340 4.000e-72gi|646612159|ref|WP_025563127.1| molybdenum cofactor biosynthesis protein MoaE [Psychromonas sp. SP041]  clstr ali  35  1.MISVQEQDFNQQEEYDRL-KCKTSVGAIVTFTGLVRDINNGVSDLSLEHYPGMTEKCLIDIVEQAKQRWNIIESTVIHRVGHLAISDQIVFVGIASQHRGDAFAACEFIMDYLKTQAPFWKKETMSNGEQWVDAREVDQDALSKW.... 147
341 5.000e-72gi|491992601|ref|WP_005709952.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus paraphrohaemolyticus]  clstr ali  35  6..VKVQTEPFDQNEVYHWLSEHH-SVGATTIFVGKVREMNDDVSGLYLEHYPAMTEKSLHEIVEEARSRWELQRIAVIHRIGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTNHGERWIEGRDSDQQAAVKW.... 150
342 5.000e-72gi|652426791|ref|WP_026822146.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Arsenophonus nasoniae]  clstr ali  39  5.RLVIQQANFNVAEQYEWL-AQCQDDGAVVTFTGKVRNHNDNIKTLTLEHYPVMTEKALQNIANEARCRWQLQRICIIHRIGTLQPGEEIVFVGVTSEHRSSAFSAAEFIMDYMKTKAPFWKKEHFTQGQRWVEARLSDQAAFERW.... 150
343 5.000e-72gi|518721409|ref|WP_019881911.1| MULTISPECIES: hypothetical protein [Methylophilus]  clstr ali  38  5..VSVQPGDFDVGAELQQLRAATPQAGALVNFVGLVRDSTDGVSEMVIEHYPGMTEKALQQIAQQAMQRWPLLGIRLIHRVGSLTAQAQIVLVAATSLHRQAAFEACAFMMDYLKTEAPFWKKEVGDFGQHWVEARASDEQAKQQWKLP. 153
344 5.000e-72JCVI_PEP_1096681330255 /source_dna_id=JCVI_ORF_1096681330254 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  36  1.MISVQRDDFDHCEQYQALKEEADGDGAVVTFTGLVRDFNGAVSGIHIEHYPGMTEKSLMHICSEARKRWQLGQIRVIHRVGTIGPQEQIVFVGVTSKHRKNAFEACEFIIDYLKTSAPLWKQEGTSEGMKWVTSRSSDQEAMDRWANTA 151
345 5.000e-72gi|647629902|ref|WP_025902916.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Tatumella sp. UCD-D_suzukii]  clstr ali  39  6.MIRVGEAPFSLADVYQWLSASDED-GAIVTFTGKVRNHNDSIATLTLEHYPAMTDKVLHDIATRARERWPLQQVAIIHRVGCLAPGDEIVLVGVSSAHRSSAFAAASYIMDILKTQAPFWKREATAQGDRWVSSRESDEQAAKRWEDP. 154
346 6.000e-72JGI.Meta 7012385415 SRS024289_LANL_scaffold_19784__gene_24256 moaE protein [Human Supragingival plaque microbiome from visit number 2 of sub  ali  35  4VHISVQEAEFDQNAVYHWLSESH-SVGATVIFVGKVRDLNDDVSSLYLEHYPAMTEKALQEIISEAQSRWNIQRVSVIHRVGLLHTGDEIVLVGISSAHRGDAYHANEFIMDYLKSKAPFWKKEQTNKGERWIEARDSDKEALKKW.... 150
347 6.000e-72gi|544803740|ref|WP_021220895.1| molybdenum cofactor biosynthesis protein MoaE [Pseudomonas alcaligenes]  clstr ali  46  1MGIRVQATAFDPGTELNALHAANVGVGAVVGFVGYVRDFNEGVSGMFLEHYPGMTEKALEKIAEEARQRWPLLKVDILHRIGRLEPGEPIVFVGTASAHRQAAFDACNFIMDYLKTRAPFWKKEDTAEGPRWVEGRCSDQAAAQRWEGD. 151
348 6.000e-72gi|518796256|ref|WP_019952210.1| hypothetical protein [Kushneria aurantia]  clstr ali  41  1.MIIIQQQPFDIGELHERVAGESTSLGAVVSFIGRVRDFNEDVQALTLEHYPGMTEKALGSIVEQAQSRWRIERALVVHRIGYMVPGDNIVAVLTASSHRQDAFDACAFIMDYLKIRAPFWKKEHTASGAYWVRERGSDLASLSRWEQ.. 149
349 6.000e-72gi|491430314|ref|WP_005288109.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Edwardsiella tarda]  clstr ali  40  5.RIVVNTAHFAVADEYSWLAQCDED-GAVVTFTGKVRNHNDDVSALTLEHYPGMTEKALAQIVEQARARWPLGRVSVYHRIGPMQPGEEIVFVGVTSAHRGMAFQAAEFIMDYLKTRAPFWKREASNGHERWVDARDSDRQAAERW.... 150
350 6.000e-72gi|653000343|ref|WP_027252547.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium halotolerans]  clstr ali  39  4.RIVVGPKPFDTQAEYNWL-AGDDQDGAVVTFHGKVRNLGDDVSKLALEHYPGMTEKALRDIIEQARQRWTLNRVTIIHRVGELGAGEDIVMVGVSSAHRNNAFAAAEFMMDILKTQAPFWKRESTPDGERWLDARDSDHQAVKRW.... 149
351 7.000e-72gi|522834206|ref|WP_020746788.1| molybdenum cofactor biosynthesis protein E [Alteromonas macleodii]  clstr ali  36  1.MISVQRGDFDHCEQYQALKEEADGDGAVVTFTGLVRDFNGAVSGIHIEHYPGMTEKSLMHICSEARKRWQLGQIRVIHRVGTIGPQEQIVFVGVTSKHRKNAFEACEFIIDYLKTSAPLWKQEGTSEGMKWVTSRSSDQEAMDRWANTA 151
352 7.000e-72gi|653079650|ref|WP_027330233.1| hypothetical protein [Marinimicrobium agarilyticum]  clstr ali  40  1.MISVQREPFDVAHEYKQLTGGDVESGAAVFFVGRVRARNDGVSGLSLEHYPGMTEKALEAIVSDARERWPLERVRVIHRVGPMALGEEIVFVGVTSSHRDASFQAAEFIMDYLKNRAPFWKQEQTEEGPTWVEAKAKDHEALGRWQ... 148
353 7.000e-72METAHIT unmapped GL0599198 unmapped_[Complete]_[mRNA]_locus=scaffold133726_1:189:650:-  ali  39  6..IRVGEADFSLDEELSRIMRESPSAGGVASFVGLVRNKNDGVSRMTLEHYPGMTEKSLAKIAAAARERFHLVDVIVVHRVGELKVGDRIVLCLTSAEHRSDAFAGCEYIMDWLKTEAPFWKKEQTPDGERWVDARESDDKARERW.... 151
354 7.000e-72  ali  39  6..IRVGEADFSLDEELSRIMRESPSAGGVASFVGLVRNKNDGVSRMTLEHYPGMTEKSLAKIAAAARERFHLVDVIVVHRVGELKVGDRIVLCLTSAEHRSDAFAGCEYIMDWLKTEAPFWKKEQTPDGERWVDARESDDKARERW.... 151
355 7.000e-72gi|494263908|ref|WP_007153551.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter algicola]  clstr ali  40  1.MIRVQQQDFDPAEEYRALRNSGSGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEQVIEGLVLEASRRWDVRDARIIHRVGSLALADQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITGDTEHWVEQKAADLDRTQSWD... 148
356 8.000e-72JCVI_PEP_1096666532085 /source_dna_id=JCVI_ORF_1096666532084 /offset=0 /translation_table=11 /length=179 /full_length=179  ali  35  28.RLRIQTEDFDLATEYQFLRQPSSSVGAVVTFTGLVRDFEGSIDSLSLQHYPGMTEKLLQEIVDQANSRWNLIGTTVIHRVGKLLPCDQIVFVGVASQHRADAFEAAQFIMDYLKTKATFWKKVDQDGQQHWVESKDSDQAASQRWTTD. 177
357 8.000e-72JCVI_PEP_1096684705035 /source_dna_id=JCVI_ORF_1096684705034 /offset=0 /translation_table=11 /length=161 /full_length=161  ali  38  1MSVRVQTEDFDVGVESRALQADS--VGGIALFVGTVRGLSNGVTAMTLEHYPGMTEGELERIEADAMDRWPLERVTIIHRVGRLLAGEQIVLVATASAHRQAAFDAAQFIMDFLKTDAPFWKAEERDGKTSWVEARDSDTAARDKWHDDS 150
358 8.000e-72gi|506352194|ref|WP_015871913.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Edwardsiella ictaluri]  clstr ali  43  6..IVVSAAPFSVAEQYQWL-AQRDEDGAVVTFSGKVRNHNDDVSALTLEHYPGMTEKALAEIVALARRRWPLGRIAVYHRVGPMFPGEEIVFVGVTSAHRGMAFEAAEFIMDYLKTRAPFWKRETSEGADRWVDARDSDRQAAERW.... 150
359 9.000e-72gi|499889404|ref|WP_011570138.1| molybdenum cofactor biosynthesis protein MoaE [Roseobacter denitrificans]  clstr ali  46  1MRVVVQDAPFDFGHEAQAFARGHTSMGAIVTFTGVVRDTNEALEAMEIEHYPGMTEAALTDIAEQAISRWSLGNALVIHRHGRLVPGEMIMMVATAARHRKDAFEAAEFLMDYLKSRAPFWKREITSQGASWVAARDEDEAALERW.... 147
360 9.000e-72gi|518928701|ref|WP_020084576.1| hypothetical protein [Hyphomicrobium zavarzinii]  clstr ali  42  1MAVRVQREAFDVAEEIRLLTDRRTDVGGIVTFTGLVRGEAGGLQTLTLEHYPGMTELELGRIDDEARERFGLTGSLVVHRFGELKPGDPIVLVITLSAHRRAAFEAAEFLMDYLKSRAPFWKKESFADGTEWVDERASDGAALARWTGAS 153
361 1.000e-71gi|518126945|ref|WP_019297153.1| molybdenum cofactor biosynthesis protein MoaE [Phaeobacter gallaeciensis]  clstr ali  48  1MRISVQEAPFELGAESDAFAAGVNNAGALVTFTGVVRDADGGLQAMEIEHYPGMTEKALTAIAEEAMSRWSLADALVIHRHGRLAPGERIMMVATAARHRKDAFEAAEYLMDYLKSRAPFWKKEILSGGSDWVAAKDTDEDALKRW.... 148
362 1.000e-71gi|506247936|ref|WP_015767711.1| molybdenum cofactor biosynthesis protein MoaE [Candidatus Accumulibacter phosphatis]  clstr ali  43  1MVVRVQEADFDVGAELAALRGKDPQIGALASFVGLVRELNDGVSELTLEHYPGMTERALQAIVSEACRRWAIIDALVIHRVGRLLPTDQIVLVAVAGAHRGDAFAACQFIMDYLKTRAPFWKRELTPEGARWVAAHAADDEAAERWQ... 149
363 1.000e-71METAHIT MH0068 GL0004978 [Complete] locus=scaffold10735_12:6632:7087:+  ali  37  5.TIRVGEADFSVSDELAKLN-DQADCGAVVSFLGVVRRANEGVYAMTLEHYSAMTEKALAGIVERARARWQLGDITVIHRVGRLLPGDQIVLVAVAASHRGEAFQACEFIMDWLKTEAPFWKKEETPDGARWVDARVSDDEAKRRWE... 151
364 1.000e-71  ali  37  5.TIRVGEADFSVSDELAKLN-DQADCGAVVSFLGVVRRANEGVYAMTLEHYSAMTEKALAGIVERARARWQLGDITVIHRVGRLLPGDQIVLVAVAASHRGEAFQACEFIMDWLKTEAPFWKKEETPDGARWVDARVSDDEAKRRWE... 151
365 1.000e-71gi|501088948|ref|WP_012139194.1| molybdenum cofactor biosynthesis protein E [Marinobacter lipolyticus]  clstr ali  37  4.SVSVQQEDFDVATEYRALRGSDAGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTERVIEDLIEQAAERWDVRKARVLHRVGELALCDQIVFVGVCSAHRGDAFAACAFIMDALKTSAPFWKKEITESGEHWVEQKDADLARSQGWE... 151
366 1.000e-71gi|519018444|ref|WP_020174319.1| hypothetical protein [Methyloferula stellata]  clstr ali  43  10VSVRVQAETFDAAAEAQRLTEGRTDLGAIVTFTGLCRDESGTLAALEIEHYPGMAEAEILRVVEEARSRWPLQGALVIHRFGKIKPGEPIVLVVTTSTHRTEAFEAAAFLMDYLKTRAPFWKKEHLADQSSWVAAKDQDEAAAGRWK... 158
367 1.000e-71gi|502737286|ref|WP_012972270.1| molybdenum cofactor biosynthesis protein MoaE [Allochromatium vinosum]  clstr ali  38  4..IRIQTEPFDIRAEQEALFQDNPRVGALVTFVGLMRDLNEGVARMMLEHYPGMTEKALSALVAEAGERWDLEGIRLVHRVGTLEPLDPIVFVGVVSQHRGDSFRACEFLIDALKTRAPFWKKELTETGERWVEERATDLEAARRW.... 149
368 1.000e-71gi|503148712|ref|WP_013383373.1| molybdenum cofactor biosynthesis protein MoaE [Ketogulonicigenium vulgare]  clstr ali  48  1MDIRVTEQPFDGGAELNAFSARVAGAGAVVTFNGVVRDVPGSLQMLEVEHYPGMTELALREAAAQAITRWSLVDVLIIHRYGRLSAGEQIMMVATAAPHRLGAFEAAEFLMDYLKSRAPFWKKEVTADGEAWVEARCSDEEALKRWS... 147
369 1.000e-71gi|518504281|ref|WP_019674488.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera perlucida]  clstr ali  43  3IFVAVQSDDFCLASEYSELRR-NAACGAIVTFSGLVRELHDTVLGMTLEHYPGMTEQALTQIATDALNHWQLAAVHVIHRVGRLKPNEQIVFVGVASAHRPAAFAACEFIMDYLKNRAPFWKKEHTAEGDYWVEAKASDQHALARWE... 149
370 2.000e-71gi|504013640|ref|WP_014247634.1| molybdenum cofactor biosynthesis protein MoaE [Azospirillum lipoferum]  clstr ali  45  1MAIRVQAEDFDVGAEYAAFTAGRTSVGGVAMFVGLVRDIAGGVSAMTLEHYPGMTEKQLEAIEEEARRRWPLDDVLVIHRHGRLEPGDRIVMVATASAHRDAAFESCRFLMDWLKTKAPFWKLEATPEGERWVEAKDSDDAAAARWSE.. 150
371 2.000e-71gi|643887588|ref|WP_025267097.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bibersteinia trehalosi]  clstr ali  35  5..IKVQTENFDQNAVYRWL-AENHRVGATTVFVGKVREMNDSVSGLYLEHYPAMTEKALNEIVAEARQRWELERVAVIHRVGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTAQGDRWVEERESDLQAAEKWQ... 150
372 2.000e-71gi|499634993|ref|WP_011315727.1| molybdenum cofactor biosynthesis protein MoaE [Nitrobacter winogradskyi]  clstr ali  42  5ITIRLQEADFDLAHEVAALSRGRTDIGAVVTFSGICRGDEDGIAALTLEHYPGMAEAEIARHAEEAVSRWPLTGITVIHRYGRIVPGENIVLVVTASSHREAAFQGAEFLMDYLKTKAPFWKREEGASGSGWVDAHDRDDTAAARWAKP. 155
373 2.000e-71gi|498009035|ref|WP_010323191.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacterium stanieri]  clstr ali  42  3.RIEISTKDYDLTEVQNWLKQGDTPCGATVTFTGLVRDEEGGLDGLYLEHYPGMTQNALDNIIQQARQRWSLGPVCIHHRIGWLTPGDNIVLVALASPHRAEAFEAAEFLMDYLKRDAPFWKKERINGEEHWVEQKESDRQAAKRWQTE. 151
374 2.000e-71gi|499802387|ref|WP_011483121.1| molybdenum cofactor biosynthesis protein MoaE [Polaromonas sp. JS666]  clstr ali  41  5.RVLITTEDFNLADEVAVLRANDSRVGAVCTFTGTVRDRNGEVLSMELEHYPGMTEKAIEAMIDEAMVRFDIFGVRVIHRVGLLQPLDQVVMVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALAKWGIQA 185
375 2.000e-71gi|653063604|ref|WP_027314919.1| molybdopterin synthase catalytic subunit [Microvirga flocculans]  clstr ali  45  4.TIRIQAEPFDTAAETASLTGGRADIGAVVAFTGLCRDEGGRLAALELEHYPGMAEAEIGRIAAQAETRWPLLGLTIVHRFGRILPGDEIVLVLAASAHRQAAFEAAAFLMDYLKTHAPFWKREHLKDGTVWVEAKEADDRATERWGH.. 152
376 3.000e-71gi|494452462|ref|WP_007243365.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus pittmaniae]  clstr ali  36  4IQIAVQSQTFDQNAVYQWLSESH-SIGASVIFVGKVRDLNDNVSSLFLEHYPAMTEKALREIVEEACSRWQLERVSVIHRVGLLHTGDEIVLVGTASAHRGDAYAANEFIMDFLKSKAPFWKKEQTDQGERWIEARDSDKQALTKW.... 150
377 3.000e-71gi|494680767|ref|WP_007438102.1| molybdenum cofactor biosynthesis protein MoaE [Acetobacteraceae bacterium AT-5844]  clstr ali  41  3.TIRVQEAPFDQAAETAALTAGRVDVGGVASFLGLCRA-DDGLAALVLEHYPGMTEKALGDIAAEAESRWPLTGCTVIHRYGRILPSEPIVLVLAASRHRTAALEACAFLIDWLKTGAPFWKREEFADGSRWVEARESDDAAAAKWG... 148
378 3.000e-71gi|493005383|ref|WP_006086549.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella baltica]  clstr ali  38  7..VRVQEVDFSVADEYRQLAQDDSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTEAVLEQIVVEARSRWPLNKVTVIHRVGTMALGEQIVFIGVTSAHRKGAFAACEFLIDFLKTKAPFWKLEAGEQGKSWVEAKDADEQAAELWQH.. 153
379 3.000e-71gi|648625375|ref|WP_026317126.1| molybdopterin synthase catalytic subunit [Ahrensia kielensis]  clstr ali  47  6.HISVQASDFDLQSEVDKLTQGRKDIGAVVTFTGLCRDEGGKLKALELEHYPAMAEAQLNQIAQKAAKRWPLTGLTIIHRFGKIEPGANIVLVVTASSHRRAAFEAADYLMDYLKSEAPFWKKEHLADAEDWVQSKQADIDDLKRW.... 152
380 3.000e-71gi|497491553|ref|WP_009805751.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola batsensis]  clstr ali  53  1MKVAVQEAAFDLGAEANAFAAGHREMGAVVTFSGLVRA-DGGLAALEIEHYPGMTEKAIRTIAEEARDRWSLGDVLVIHRHGRLEPGEAIMMVATAAPHRRDAFEAAEFLMDYLKSRAPFWKKEIGAEGTAWVAAKDEDEAALGRW.... 145
381 3.000e-71gi|563755296|ref|WP_023786748.1| molybdenum cofactor biosynthesis protein MoaE [Hyphomicrobium nitrativorans]  clstr ali  43  1MAVRVQHEPFDAVAEVEALTRGRIDVGGIVTFTGLVRGDVDGLISLTLEHYPGMTEAELGRIEVEARKRFDLVDCVVVHRVGELTPGEGIVLVVALSRHRQAAFEAAEFLMDYLKTRAPFWKKETFADGANWVDARDSDSRAEARWGGES 153
382 3.000e-71gi|494065601|ref|WP_007007671.1| molybdenum cofactor biosynthesis protein MoaE [Nitratireductor aquibiodomus]  clstr ali  49  9..VRVQAGDFDLATEARRLTDGRRDVGAVVSFTGLCRDEDGRLEALELEHYPGMAEAEIGRIADEAAQRWPLSGLTVIHRFGRIAPGENIVLVVAASAHRRAAFEAADFLMDYLKSRAPFWKKEHAAGETEWVEAKDRDQEDMKRWER.. 156
383 4.000e-71gi|516416876|ref|WP_017806274.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Avibacterium paragallinarum]  clstr ali  34  4IQIAVQSEPFDQNAVYRWVAEPH-SVGAAVIFVGKVREMNDNVSSLFLEHYPAMTEKALREIVEEACQRWQLLRIAVIHRVGLLYTGDEIVLVAVSSPHRGEAYQANEFIMDFLKSKAPFWKKEQTENGERWVEHRESDSAALRKW.... 150
384 4.000e-71gi|493994900|ref|WP_006937573.1| molybdenum cofactor biosynthesis protein MoaE [Labrenzia aggregata]  clstr ali  50  7..VRVQAEDFDLQAESLRLTEGRKDVGALVTFTGLCRDEAGTLAALELEHYPGMAEAELTRIAGEAAARWPLTGLTVIHRFGKIAPGHNIVLVIAASSHRRAAFEAADFLMDYLKTRAPFWKKEHPAEGGSWVEAKTEDDTDAARW.... 152
385 4.000e-71gi|446467347|ref|WP_000545201.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Salmonella enterica]  clstr ali  45  5.RIVVGPAPFSVGEEYSWLAARDED-GAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGARWVEARDSDQQSAKRW.... 164
386 5.000e-71gi|503512715|ref|WP_013747234.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Gallibacterium anatis]  clstr ali  38  4IEISVQTEPFDQNAIYQW-SSASAESGATVIFVGKVRDMNDNVSGLYLEHYPAMTEKALREIAEQAAQRWQLQRIYIVHRVGQLYTGDEIVAVAVSSAHRGSAYQANEFIMDFLKTKAPFWKKETTKSGDRWLDSRESDQQAAHRWE... 151
387 5.000e-71gi|496119860|ref|WP_008844367.1| molybdopterin synthase catalytic subunit [Glaciecola lipolytica]  clstr ali  34  8ISINIQKNDFDHGLEYTQLKEHSDQHGAIVTFTGLVRDMNEQVTGLFLEHYPGMTEKVLQKLAAEAAQKWSLGAITIIHRIGQLDVNQQIVFVGVTATHRGEAFDACQFLMDFLKTQAPFWKKEQRGSSAHWLDKRLSDEFAAKKWKE.. 157
388 5.000e-71gi|516742628|ref|WP_018077462.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  47  1MKIVIQCEAFDLGAEVDAMRRGRTGIGAIASFIGLARDCNEGVHAMTLEHYPGMTEKALAALVDEANSRWTLLDVTVIHRIGRLLPGDPIVLVAVASQHRGEAFAACEFIMDYLKTQAPFWKKEATPEGERWV................. 135
389 5.000e-71gi|653445069|ref|WP_027536993.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium sp. URHA0002]  clstr ali  41  5VTIRIQQADFDIGHEIAALTRSRTDVGAVVTFSGICRENGEPIAALTLEHYPGMAEAEIQRHADEAMARWPLTGLTVIHRVGRITPGENIVVVLAASQHRQAAFQAAEFLMDYLKANAPFWKREESQNGTNWIEARGHDETAAKRWTKS. 155
390 5.000e-71gi|643486994|ref|WP_025217316.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Mannheimia varigena]  clstr ali  37  6..IEVQEAEFDQNQIYRWLSEYH-SVGATTLFIGKVREINDNVSGLFLEHYPAMTKKALQAIVDEARQRWDLQRVAVVHRIGQLNTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKREQTQEGERWIEGRDSDQQAAEKWK... 151
391 6.000e-71gi|502358598|ref|WP_012771500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Aggregatibacter aphrophilus]  clstr ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGASVIFVGKVRDLNDKVSSLYLEHYPAMTHKALLDIAQQAKVRWDLQKISIIHRVGQLNTGDEIVLVGTSSAHRGDAYHANEFIMDYLKTQAPFWKKEQTTKGERWIEGRDSDYVAAEKWK... 151
392 6.000e-71gi|494591715|ref|WP_007350308.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacter sp. ELB17]  clstr ali  36  14.SVSIQNADFDAAQEYAQLRDSGAGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEQVISDLIAQAGQRWDVRKARVIHRIGRLPLQSQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKELTDAGEHWVEQKASDVARAEGW.... 160
393 7.000e-71JCVI_PEP_1096676808227 /source_dna_id=JCVI_ORF_1096676808226 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  45  7..ISIQAEPFSLADESAALARSTGDVGAVATFTGYCRSEGGRLSALELEHYPGMAEEEIQRVVDEAVTRWPLMAVRVIHRFGRMTPGDEIVFVGTVSTHRREAFAACEFLMDYLKTRAPFWKKEYLADGGEWVEAKAADDVATLRWAKP. 155
394 7.000e-71JCVI_PEP_1096666341427 /source_dna_id=JCVI_ORF_1096666341426 /offset=0 /translation_table=11 /length=153 /full_length=153  ali  33  4..IIVQSEDFDITTEVALAKASNSNIGAIVSFVGTVRDESKNLNTMTLEHYPGMTEKSLKSIVDKAKDKWELQSVTIIHRIGKLDVNDQIVLVISASRHRQEAFDSCNFIMDFLKTDAPFWKKESTTKSENWVKSRSQDEEKKKHWKNE. 151
395 8.000e-71gi|497290896|ref|WP_009605113.1| molybdenum cofactor biosynthesis protein MoaE [SAR116 cluster alpha proteobacterium HIMB100]  clstr ali  41  4..ITITTDNFNAGDEIEALRLA--GVGAIVTFTGIVRDKAEDLTAMTLEHFPGMTEQEIQAIIDEARTRWPLQGVRVIHRVGRLLPQENIVFVGTASAHRQAAFDSASFIMDYLKTKAPFWKKEETPAGASWVEARDCDDKALEKWQ... 148
396 8.000e-71gi|517815409|ref|WP_018985617.1| hypothetical protein [Methylophilus methylotrophus]  clstr ali  40  9..VSVQPEDFDTGHELKQLKAATPQAGALVNFVGLVREASGHLSEMVIEHYPGMTEKALQKIALQATERWPLLGVRMIHRVGTLTAQSQIVLVATTSLHRQAAFEACAFMMDYLKTEAPFWKKEIGDFGEHWVEARASDEQAKQQWKQP. 157
397 8.000e-71gi|518868988|ref|WP_020024878.1| hypothetical protein [gamma proteobacterium SCGC AAA076-D02]  clstr ali  32  4..IIVQSEDFDLTTEVALAKVSNSNIGAIVSFVGTVRDESKNLNTMTLEHYPGMTEKSLKLIVDKAKNKWELQSVTIIHRIGKLDVNDQIVLVITTSRHRQEAFDSCNFIMDFLKTDAPFWKKESTTKSENWVKSRSQDEEKKKHWKNE. 151
398 8.000e-71JGI.Meta 7030754592 C3544874__gene_274945 moaE protein [Human Supragingival plaque microbiome from visit number 2 of subject 159510762]  ali  34  4IRIAVQEAEFDQNAVYHWLSEQN-SVGAAVIFVGKVRELNDDVSSLYLEHYPAMTEKALKEIVAEAKQRWEIQRVAVIHRVGLLQTGDEIVLVGVSSSHRGEAYRANEFIMDFLKSKAPFWKKEQTDKGERWIDARTSDKQALEKW.... 150
399 9.000e-71gi|494051213|ref|WP_006993323.1| molybdopterin synthase catalytic subunit [Glaciecola mesophila]  clstr ali  36  5..IAVQTEDFDHSALYNALRQDSLSNGAIVTFSGLVRDFNQGVGDLFLEHYPAMTQISLQQIVAQARARWGLGKIILIHRVGHLAQGDQIVFVGVTSMHRKAAFEGAQFIMDYLKTEAPFWKKESTELGDKWVQANVSDTTARQRWTGD. 153
400 9.000e-71gi|499247710|ref|WP_010945250.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus ducreyi]  clstr ali  35  6..IEVQQAPFDQHAIYQWLSEPH-SVGATTIFVGKVREMNDNVSGLYLEHYPAMTKKALQEIVNQARQRWELQRIAVIHRIGQLHTGDEIVLVGVSSAHRGDAYLANEFIMDYLKTKAPFWKRETTAEGERWIESRESDEQQLEKW.... 150
401 9.000e-71gi|653100679|ref|WP_027350770.1| hypothetical protein [Halotalea alkalilenta]  clstr ali  43  3.TIAIQTEGFDLGAVESSLIQGRSDLGAMVSFVGRVRDFSDGVRALTLEHYPGMTEAVLDALADEAVARWRLGGVAIIHRVGRLSPGDEIVLVAVACAHRKAAFEACEFIIDRLKTQAPFWKKEHSDEGDRWVGERMSDRWASERWEES. 152
402 1.000e-70JGI.Meta 7021232954 C3121381__gene_190630 moaE protein [Human Tongue dorsum microbiome from visit number 2 of subject 159571453]  ali  36  4IQIAVQSQTFDQNAVYHWLSESH-SIGASVIFVGKVRDLNDNVSSLFLEHYPAMTEKALREIVEEACSRWQLERVSVIHRVGLLHTGDEIVLVGTASAHRGDAYAANEFIMDFLKSKAPFWKKEQTDQGERWIEARDSDKQALTKW.... 150
403 1.000e-70gi|516409682|ref|WP_017799080.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia toletana]  clstr ali  42  4.RIRVGHQPFSMAEEYQWLAACDED-GAVVTFTGKVRNHNDDVSALTLEHYPGMTEKALEEIVAEARQRWPLQRVTLIHRIGELFPGDEIVMVGVTGAHRSAAFAAAEFMMDYLKTRAPFWKREATPQGDRWVDARDSDKQAARRWE... 150
404 1.000e-70gi|640617774|ref|WP_025045836.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter sp. MM-124]  clstr ali  48  1MRISVQEQPFDLGAESAAFASGRKDMGAIVTFTGVVRDLDDPLEAMEIEHYPGMTEAALSEIATQAVTRFELGDALVIHRYGRLLPGEMIMMVATAARHRKSAFEGAEFLMDYLKSRAPFWKREITAAGADWVASKAVDEDALKRW.... 147
405 1.000e-70gi|619155009|gb|KAJ54057.1| molybdenum cofactor biosynthesis protein MoaE [Actibacterium mucosum KCTC 23349]  clstr ali  45  1MTVRVQENPFDFGAEAQAFATGRTDAGAVVTFTGIVRDLVQSLHEMMIEHYPGMTERALSGIEADARTRWDLRDVLIIHRHGILRPGDMIMMVATASPHRKDAFEAAEFLMDFLKSRAPFWKKERTGEGEEWVASKSEDEYALSRW.... 147
406 1.000e-70gi|515999887|ref|WP_017430470.1| hypothetical protein [Halomonas jeotgali]  clstr ali  44  23IRVSVQREPFAGEDDSRELSRGRHDIGAVVCFTGLVRDFNEDVTGLTLEHYPGMTEKTLEDIAGQAWQRWSLNAVRVVHRVGYMTPGDGIVRVSVASAHRRDAFEACDFIMDFLKTRAPFWKKEHARHGDYWVSERGTDHADADRWDDS. 173
407 1.000e-70gi|494164133|ref|WP_007103867.1| molybdopterin synthase catalytic subunit [Glaciecola polaris]  clstr ali  36  5..IDVQTDDFDQNALYNALRQDSASQGAIVTFSGLVRDFNQGIGGLFLEHYPAMTMHSLTNIVGQARQRWTLGKIIVIHRVGHLAQGDQIVFVGVTSAHRKDAFDGAQFIMDHLKTEAPFWKKETTECGPRWVEANPNDEKARAKWGND. 153
408 1.000e-70JCVI_PEP_1096679717643 /source_dna_id=JCVI_ORF_1096679717642 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  41  2.SVKVQSEDFDIGGELAALTDGNMDIGGMVSFVGLVRDGDDALKAMTLEHYPGMTEKMLREIEAEANERWDLEASLIVHRYGRLEPGDRIVLVATASAHRQEAFDACAFLIDWLKTKAPFWKLEESDQGAQWVESKETDDRAAERWERD. 152
409 1.000e-70gi|594395232|gb|EXU73485.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia mallotivora]  clstr ali  41  4.RIVVDAAPFSVDEAYRWLSASDED-GAVVTFTGKVRNHNDKVAALTLEHYPGMTEKALAAIVAEARQRWTVQRVMVIHRTGELFPGEEIVLVGVSAAHRSGAFAAAEFIMDQLKTRAPFWKREATTEGERWVAARDSDQQAAARWK... 150
410 1.000e-70gi|550953922|ref|WP_022702312.1| molybdenum cofactor biosynthesis protein MoaE [Pseudorhodobacter ferrugineus]  clstr ali  42  1MQIRVQSEPFDMGAESNAFAQSATGAGAIVTFTGITRDSAGDLAVMEIEHYPGMTERALTSIAEQAMQRWHLTDCLVIHRYGALAPTDPIMMVATASRHRANAFAAAEFLMDYLKSRAPFWKKEITASKTDWVAARAEDEAALKRW.... 147
411 1.000e-70gi|494914105|ref|WP_007640143.1| molybdopterin synthase catalytic subunit [Glaciecola psychrophila]  clstr ali  33  7..ISVQTQDFDFAYQYQKLRDSNNSDGALVTFVGLVRDMNQSVSGLFLEHYPAMTEKVLNDIVETARVKWHLGSVSVIHRVGQLKVSDQIVFVGVTSQHRQSAYHANEFIMDYLKTQAPFWKKETTTQGDKWIEAKISDIQKSKDWS... 153
412 2.000e-70gi|489900301|ref|WP_003803739.1| molybdenum cofactor biosynthesis protein MoaE [Alcaligenes faecalis]  clstr ali  35  1.MVRIQTEDFDVAALNAELRATAGGAGAMVTFTGYVRDQADGTTTLFLEHYPGMCEREIETVCEQARQRWPILDTLVVHRVGELHLTEQIVYVGVTSAHRGDAFRACEFIMDVLKTRAPFWKRETLADGKRWVQQRDSDAQKTDSWNNSA 153
413 2.000e-70gi|648490559|ref|WP_026182310.1| molybdenum cofactor biosynthesis protein MoaE [Leeia oryzae]  clstr ali  39  1MRIRVSEADFDLQEEQQALLELTAEAGAVVSFTGYVREFSSGLETMLLEHYPGMTESALEMIAQEASQRWSLKAVNIIHRIGRLGPKARIVLVQVVSRHRGDAFSACEFVMDYLKTRAPFWKKEFPLEGQYWVEAKETDEAALARW.... 149
414 2.000e-70gi|550963850|ref|WP_022712161.1| molybdenum cofactor biosynthesis protein MoaE [Pseudochrobactrum sp. AO18b]  clstr ali  47  4.TILVSQDDFDAAALTARMTEGRTDIGAVVSFTGFCRDENKTLQALELEHYPGMAEAQLARIAAEAMQRWPLQGITIVHRSGLIKAGEQIVFVATASKHRRAAFEAAEFLMDYLKSDAPFWKKEHLENGSGWVKAKASDEDMKKRWQ... 157
415 2.000e-70gi|549964994|ref|WP_022571211.1| molybdopterin converting factor, large subunit [Rhodobacteraceae bacterium HIMB11]  clstr ali  45  1MKISVQAEPFDYGALSNAFAQGHTHVGAVVTFCGIVRDDDGGLSTMEIEHYPGMTEKAIRAHAKTAKDRFSLAEVLVIHRYGSLKPGEMIMMVATAAPHRNDAFKGAEFLMDYLKSRAPFWKKEIVNGEPRWVDAKPEDEDALSRW.... 147
416 2.000e-70gi|518387099|ref|WP_019557306.1| molybdenum cofactor biosynthesis protein MoaE [Thiomicrospira arctica]  clstr ali  38  11..IKIQQADFDLTVENAKLRTGHKDIGAVVSFVGTVRDINEGVAILELEHYPGMTEKALEKIRLEAHDRWSLEASLIIHRIGKMYPADQIVLVAVASRHRENAFHAAHFIMDYLKTNAPFWKKETLPDGDRWVDSRVSDKEAEARW.... 157
417 2.000e-70gi|640415632|ref|WP_024897366.1| molybdopterin synthase catalytic subunit [Ochrobactrum rhizosphaerae]  clstr ali  45  11..ISIRDTDFDIAEEIRQLSEGRKDIGAIVSFTGLCRDEGGKLSALELEHYPGMAEAEIRRIAHDAIERWPLSGVSIIHRFGLIKPGENIVLVVTASAHRQAAFEAASFLMDFMKTGAPFWKREHLIEGGDWVESKAEDEQSRGRWQR.. 158
418 2.000e-70gi|640631623|ref|WP_025059623.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter donghicola]  clstr ali  45  1MRVSVQSEPFDLGQESTTFASGHRNMGAIVTFTGIVRDLDDPMDAMEIEHYPGMTEKAIATITKEAIERFSLGDALVIHRHGRLHPGEMIMMVATAARHRKDAFEAATYLMDYLKSRAPFWKRELSASGAAWVAAKDEDEAALERW.... 147
419 2.000e-70gi|501463678|ref|WP_012487123.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Cellvibrio japonicus]  clstr ali  40  4.SIAVQEADFDVGTEYQALIVGDTRAGAHVLFVGRVRDMNMEVQGLFLEHYPGMTEQVLQSLVDDARKRWELLGVRLIHRVGYLRPGDQIVLVATSSAHRAHAFEAAEFLMDLLKTKAPFWKKEHSSGGAVWLESRAQDNEAGKRW.... 150
420 2.000e-70gi|518808009|ref|WP_019963963.1| hypothetical protein [Pannonibacter phragmitetus]  clstr ali  45  6.RVIVQPGPFDAEAESRQLSAGRADVGAIVSFTGLCRDEDGRLEALVLEHFPGMAEKELERIAREALTRWPLTGLTVIHRHGRILPGEQIVLVTAASRHRRAAFEAADFLMDFLKSRAPFWKKEILREGGGWVAAKAEDETALDRWN... 153
421 2.000e-70gi|564608520|ref|WP_023849777.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae bacterium PD-2]  clstr ali  50  1MRVVVQEAPFDFGAEAAGFAAGRTDMGAVVTFTGVVRDTGGDLDRMEIEHYPGMTEKALETIAAEAVARWSLGDALVIHRFGRMAPGEQIMMVATAAPHRKDAFEAAEYLMDYLKSRAPFWKKEHGRDGTSWVAAKDEDEEALTRW.... 147
422 3.000e-70gi|497484578|ref|WP_009798776.1| molybdenum cofactor biosynthesis protein MoaE [Nitrobacter sp. Nb-311A]  clstr ali  44  5VTIRLQKEDFDVAREVAALSRGRTDIGAVVSFSGICRGEGDAIAALVLEHYPGMAEEEIARHAEEAVSRWPITGLTVIHRFGRIAPGDNIVLVVTASAHREAAFHAAEFLMDYLKTRAPFWKREEGSSGSSWVDAHDRDDTAAARWAKS. 158
423 3.000e-70gi|495069796|ref|WP_007794621.1| molybdenum cofactor biosynthesis protein MoaE [Pelagibaca bermudensis]  clstr ali  47  8.RVVVQEAPFDFGVEAERFAAGRTDLGAVVTFTGVVRDVAGGLEGMEIEHYPGMTEKALTKIASEAQARWSLGEVLVIHRYGKMAAGERIMMVATASAHRQHAFEAAEYLMDYLKSRAPFWKKESAGGDQSWVAAKDEDEAALDRW.... 152
424 3.000e-70gi|502871381|ref|WP_013106357.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Thiomonas]  clstr ali  44  4ITIRIQTEPFDLGAELQALRAGRLDVGAIASFVGLCRDHHPGVQAMELEHYPGMTERAIADMVHEAQARWPLLGVTVIHRVGRLLPGDDIVLVLVASAHRAAAFAACEFLMDYLKTQAPFWKKETTPEGGQWVDARESDDAALRRWGVES 159
425 3.000e-70gi|506298013|ref|WP_015817788.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Teredinibacter turnerae]  clstr ali  36  1.MIRVQQADFDVAGEYRNLQQ-HGLAGAIVTFSGLVRDFAGDTSRFFLQHYPGMTESVLNKIVSQAQSRWPLLAVTVIHRVGHLQAGDQIVFVGVSSAHRKSAFAACEYIIDLLKTEAPFWKKE----GRQWVDAKQSDQAAADRW.... 141
426 3.000e-70JCVI_PEP_1096669575741 /source_dna_id=JCVI_ORF_1096669575740 /offset=0 /translation_table=11 /length=151 /full_length=151  ali  35  1MKIYIQKEDFDISFLIQELKKKSNSVGAIASFIGLMRDINDGIQSMTLEHYPEMTKKTLEDICIKAKDKWKIIDLVVAHRYGVININDNIVFVGVASQHRKDAFEACEFIMDFLKTNATFWKKELHLDGSSWVESRKSDDDALNRWQ... 150
427 3.000e-70gi|511822593|ref|WP_016401808.1| molybdenum cofactor biosynthesis protein MoaE [Agarivorans albus]  clstr ali  37  1.MIKVQLEDFDVGEEYQRLRE-RASAGAIVFFVGLVRDMNQQVKGLQLEHYPGMTELQLEKIVAEAKTRWPIQDASIVHRVGDLDVSDQIVFVGVNSAHREASFEACHFIMDYLKTKATFWKKERTLGGDVWLDARESDLKAKDKW.... 146
428 4.000e-70gi|492859005|ref|WP_006012055.1| molybdenum cofactor biosynthesis protein MoaE [Brucella ovis]  clstr ali  41  10.SISVRSEDFDIAAEIDRIGKNRREIGAIVTFTGLCRDEDGQLAALELEHYPGMAQAEISRMAKQALERWPLNDLTIIHRYGLIKPGENIVLVVAASRHRHAAFEAASFLMDYMKTNAPFWKREHLADGTAWVSSKEEDEESRKRWEEP. 159
429 4.000e-70gi|501130914|ref|WP_012179764.1| molybdenum cofactor biosynthesis protein MoaE [Dinoroseobacter shibae]  clstr ali  44  1MTVRVQQAPFALGAELDSFAAGRTDMGAIVSFTGVVRDATGDLDVMEIEHYPGMTERAIGKIVDEAKARWSLGDALVIHRYGRMGPGDRIMMVATAAPHRVDAFAAAEFLMDYLKSRAPFWKKEISGAGASWVAATDEDEAALTRW.... 147
430 4.000e-70gi|640083504|ref|WP_024792154.1| molybdopterin synthase catalytic subunit [Candidatus Ruthia magnifica]  clstr ali  31  4..IIIQQQDFDLSTEIVLIKNNHSDIGAVVSFVGFVRDLDDSIQKMTLEHYPEMTEKALKSIIDEAKKRWSIGNITLIHRVGDLNINDQIVLVITSSKHRQSAFASCEFIMDYLKTQAPFWKKEYAQNKSKWVKAKSSDKNQKNRWE... 149
431 4.000e-70JGI.Meta 7062616834 SRS017227_Baylor_scaffold_97884__gene_125030 moaE protein [Human Supragingival plaque microbiome from visit number 1 of  ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGATVMFVGKVRDMNDEVSSLYLEHYPAMTHKALMDIAQQAKVRWDLQKISIIHRVGELNTGDEIVLVGTASAHRGDAYHANEFIMDYLKNQAPFWKKEQTEKGERWIEGRDSDYAAADKWK... 151
432 4.000e-70gi|502585698|ref|WP_012823477.1| molybdenum cofactor biosynthesis protein MoaE [Halothiobacillus neapolitanus]  clstr ali  37  1MKISVQTEDFDVNSVLAELRGRCAHVGAVACFLGTVRDMNDDVAVLTLEHYPGMTERALERVATEAKSRWPVAGVTIVHRYGALFPSDQIVLVAVASAHRHDALDACAFMMDYLKTHAPFWKKETDSSGATWVDARESDAVARARW.... 149
433 5.000e-70gi|492856084|ref|WP_006010038.1| molybdopterin synthase catalytic subunit [Glaciecola pallidula]  clstr ali  35  8..ISIQAHDFDHACVYAKIQKNADSDGAIVTFTGLVRELTGNLHYMTLEHYPEMTQKSLMNICEQARQRWPLGAINIIHRIGKLTPDEQIVFVGVSSKHRKAAFAATEYIMDFLKTKAPFWKKEVSSEGEFWVQAKLSDKQKADDW.... 153
434 5.000e-70gi|517728518|ref|WP_018898726.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobium sp. 2MFCol3.1]  clstr ali  42  6.TIRVQREDFDLQAEVELLSKGKPGIGAVVTFSGLCRDEGGTLDALELEHYPGMAEAEMMRIAEMAIERFKLNGLTAIHRYGKIAAGENIVLVIAAAPHRQAAFDGANFVMDFLKTSAPFWKKEHGKDGREWVEAKGHDDAARDKWK... 153
435 5.000e-70gi|497258115|ref|WP_009572332.1| molybdenum cofactor biosynthesis protein MoaE [Celeribacter baekdonensis]  clstr ali  45  5VRISVQAEDFDLATELSGF-GHAANTGATVTFTGLVRDDTGALQHMEIEHYPGMCEDAIRKIADEAANRWALTDCLVIHRFGRLVPGEQIMMVATAARHRSEAFAAAEFLMDYLKSRAPFWKKEVTREGAEWVAAKDSDEDALSRW.... 149
436 5.000e-70gi|495095233|ref|WP_007820056.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobium sp. CF142]  clstr ali  43  6.TIRVQREDFDLQTEVDRLSKGKPGIGAIVTFSGLCRDEGGTLSALELEHYPGMAEAEMTRIGELAIERFGLSGLTAIHRFGKIAAGENIVLVVAAAPHRQAAFDGASFVMDFLKTSAPFWKKEHGKDGGDWIAAKDADDTARDRWK... 153
437 6.000e-70gi|504304870|ref|WP_014491972.1| molybdenum cofactor biosynthesis protein MoaE [Bradyrhizobium japonicum]  clstr ali  39  10VTIRIQQDDFDIAREIAILTGSRTDIGAVVSFSGICRGDEDSIAALTLEHYPGMAEEEIKRHADEATSRWPLNGVTIIHRVGRFMPGQNIVLVLAASQHRQAAFQAAEFLMDYLKTSAPFWKKEESATGTGWVEAHARDDEAAARWTRS. 160
438 7.000e-70gi|652863920|ref|WP_027133819.1| molybdenum cofactor biosynthesis protein MoaE [Geminicoccus roseus]  clstr ali  42  1MAVRVQAEPFDLGAEIAELTRGRTEIGGVATFTGLVREFAGGLTSMTLEHYPGMTERELERVEAEALDRWPLDASLIVHRYGKMLPGEPIVLVATASAHRQAALESCAFLIDWLKTRATFWKFEEGEDGGLWVEAKEADDEAARKWH... 149
439 7.000e-70gi|640175574|ref|WP_024811443.1| molybdenum cofactor biosynthesis protein MoaE [Oceanicola sp. HL-35]  clstr ali  44  1MVVRVQSDPFDLGGEANAFAAQSGGMGAIVTFTGVVRDVAGGLQAMEIEHYPGMTERALAKIEDQARARWELGGVLILHRYGPLHPDDRIMMVATAARHRKDAFEAAEFLMDYLKSRAPFWKKEHTGTRADWVAARDADEDALRRW.... 147
440 7.000e-70gi|652476222|ref|WP_026870909.1| molybdenum cofactor biosynthesis protein MoaE [Inquilinus limosus]  clstr ali  48  1MTVRVQEADFDPGAEIAALSDGRTDVGGVACFVGLVRDIASGVRAMTLEHYPGMTERQLAEIEAEARDRWPLLEVRIVHRIGRLEPGDRIMFCGVASAHRGAAFEACAFLMDWLKTQAPFWKKEETPEGERWV................. 135
441 8.000e-70gi|497515811|ref|WP_009830009.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae bacterium HTCC2083]  clstr ali  39  1MKILVQDAAFDAGAELNDFTKAQSNMGAVVSFTGIVRDLDAGLKQMDIEHYPGMTERALEKIASDAMGRWNLGDVLVIHRFGALKPEDVIMMVATASKHRKDAFEAADFLMDFLKSRAPFWKKEQTGAAQDWVNSKQEDEDALTRWE... 147
442 9.000e-70gi|494366553|ref|WP_007196846.1| molybdenum cofactor biosynthesis protein MoaE [Hoeflea phototrophica]  clstr ali  45  20VTVRIQAEDFDIASEIAALAEGRADIGAVATFTGLCRDEGGRLSSLELEHYPGMAERAIRTIANEAAKRFALTGITAIHRYGKIAPGCNIVLVVATAPHRQAAFDGASFLMDYLKTEAPFWKKEHRKGGGEWVSAKDSDDRAKARWDK.. 169
443 9.000e-70gi|515597139|ref|WP_017029746.1| hypothetical protein [Vibrio breoganii]  clstr ali  36  4..VLVQEQDFDLGE-EYSLLSESSSIGAVVTFVGKVRDFNDDVIGLNLQHYPVMTEKALHEICSEARSRWPLDRVTIIHRVGDLDIADQIVLVGVSSAHRDAAFAGCEFIMDFLKTKAPFWKKERLKDSSRWLDSRESDQISMKRWS... 149
444 9.000e-70gi|503714533|ref|WP_013948609.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Hyphomicrobium]  clstr ali  39  1MTVRVSTDDFDISEEMAKLSDGDTAIGGVALFVGKVRGDVKGLVSMTLEHYPGMTEAELARIETEACARFKLSASLIIHRVGELKPGDNIVLVIACAPHRQDAFAGAEYLMDYLKTRAPFWKKETLGDGSQWVDARESDEDAAAAW.... 149
445 9.000e-70gi|517115239|ref|WP_018304057.1| hypothetical protein [Wenxinia marina]  clstr ali  43  1MSVLVTEAAFDAGAELKDFTAGAEGAGGVVSFTGVVRDVAGGLSHMEIEHYPGMTERAIAAMRDDAMARFSLTAARVIHRHGRLAPGETIMMVLTAAPHRGDAFAAAEFLMDWLKSRAPFWKKEVTADGAEWVAAKDADEDALTRW.... 146
446 1.000e-69gi|497502415|ref|WP_009816613.1| molybdenum cofactor biosynthesis protein MoaE [Roseovarius sp. 217]  clstr ali  43  1MDVRVQEAAFDLGSEANAFVAKQSGMGAVVTFTGIVRDLDGALSTMEIEHYPGMTQKALDTIANEAASRWNLGDILIIHRYGMLHPDDLIMMVATAARHRADAFQAAEFLMDFLKSRAPFWKKEVTEAGTDWVAARDEDEDALSRW.... 147
447 1.000e-69gi|494077435|ref|WP_007019487.1| molybdenum cofactor biosynthesis protein MoaE [Neptuniibacter caesariensis]  clstr ali  41  6..VLVQTEDFNIGELSERVRAEDATSGAIVTFTGIVRNTDASLDALYLEHYPGMTEKALEKIADQARQRWELGNIVIAHRVGTLPLNENIVFVGVGSAHRVNAFEAAQFVMDYLKRDAPFWKKEISSQGESWVEQKQSDLDAAEDW.... 152
448 1.000e-69gi|590082462|gb|EXL08765.1| molybdopterin synthase catalytic subunit [Aquamicrobium defluvii]  clstr ali  40  7.HIRIQTADFDVAAEIARLTSGRSDIGAVVTFTGLCRDEAGRLSGLELEHYPGMAEAEVLRIAGDVCGRWPLQGITVIHRYGKLEPGDNIVLVATASTHRQAAFDAACFMMDFLKSRAPFWKREHVAGGAEWVAAREADEAAIANWRK.. 155
449 1.000e-69gi|492137317|ref|WP_005759086.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pasteurella bettyae]  clstr ali  36  4VKIAVHEAEFDQNAEYRWLSEPN-SVGAAVVFVGKVRDLNDEVSSLYLEHYPVMTEKALREIVDEAIQRWQLQRVSVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKSKAPFWKKEQTDKGERWIEARHSDKEALEKW.... 150
450 1.000e-69gi|575470098|gb|ETX15750.1| molybdenum cofactor biosynthesis protein MoaE [Roseivivax halodurans JCM 10272]  clstr ali  49  1MPVSVQDAPFDYGAECERFASGRADMGAVVTFAGIVRGDGD-LARMEIEHYPGMTEKALGEIAEKARRRWSLGDVLVIHRYGMLTPGERIMMVATAAPHRRNAFEAADFLMDYLKSRAPFWKKEHMADGEAWVAAKDEDEDALSRW.... 146
451 1.000e-69gi|652977178|ref|WP_027229783.1| molybdopterin synthase catalytic subunit [Phyllobacterium sp. UNC302MFCol5.2]  clstr ali  44  8..VRIQGEDFDTASEIARLTENRRGIGAIVTFSGLCRDEAGTLAALEIEHYPGMAEAEITRIADEALARWSLDGLTVIHRYGFIKPGENIVLVVAASAHRQAAFEAASFLMDYLKNAAPFWKKQHLRDGESWVEAKATDKEALRRWQKK. 157
452 2.000e-69gi|494946969|ref|WP_007672997.1| molybdenum cofactor biosynthesis protein MoaE [alpha proteobacterium BAL199]  clstr ali  37  1MSVRVQEEDIDIGAELAEMTVGNHAIGGLGVFVGLVRDIAGEVAGMTLEHYPGMTERQLEAIEAEACARWPLQASRIVHRVGRLEPGDNIVLVACASAHRQAALDATAFLIDWLKTKAPFWKLEETRAGAHWVDARESDDAAAARWSR.. 150
453 2.000e-69gi|495835627|ref|WP_008560206.1| molybdenum cofactor biosynthesis protein MoaE [Ruegeria sp. R11]  clstr ali  46  1MRIAVQDGLFDIGEESNRFAAGGANAGAIVTFTGVVRGDNGDMVAMEIEHYPGMTERAIRKIADEAMARWSLADVLVIHRHGRLVPGEQIMMVATASRHRLHAFEAAEFLMDYLKSRAPFWKKELLQDGANWVEAKDSDEEALDRW.... 152
454 2.000e-69JCVI_PEP_1096676121441 /source_dna_id=JCVI_ORF_1096676121440 /offset=0 /translation_table=11 /length=153 /full_length=153  ali  35  2..IRVQAEDFDIGNEISIITNQNQNIGGICSFTGLVREFNPNIQAMTLEHYPGMTEKQLSKIENEAHERWDLSDSLIIHRFGCLKPKDRIVLVITASAHRKAAFESCQFLMDWLKTQAPFWKMEETATGSHWVVAKSSDNLEVEKWSAK. 150
455 2.000e-69gi|492454289|ref|WP_005849690.1| molybdenum cofactor biosynthesis protein MoaE [Sulfitobacter sp. EE-36]  clstr ali  45  1MKISVQEAGFDLGQESQDFAAGHRDMGAIVTFTGIVRDLDDPLQAMEIEHYPGMTESALTEMAETAIVRFSLGDALVIHRFGRLLPGEMIMMVATAARHRKDAFEAAEFLMDYLKSRAPFWKREITAKGADWVASKAEDEDALARW.... 147
456 3.000e-69gi|551337695|ref|WP_022957115.1| molybdenum cofactor biosynthesis protein MoaE [Spongiibacter tropicus]  clstr ali  40  3IRVSVQEADFDAGDACRALT--SSDCGAIVQFVGVMRNEGDEVVSMRLEHYPGMTERSITDIAEQAARRWSLGEVLVIHRIGELLPGQQIVLVAVSAAHRQAAFSGCEFIMDYLKTQAPFWKKEQLLDGSRWVDARSSDASAALRWD... 150
457 3.000e-69gi|515480733|ref|WP_016914001.1| hypothetical protein [Halomonas stevensii]  clstr ali  45  13..VEVTEDSFSMAHGYEQALRGRTDIGAVVSFTGLVRDFNEDVLGLTLEHYPGMTERSLMEIAEQAWQRWSLQAVRIIHRVGDLALGDPIVRVLVASAHRRDAFLACDFIMDYLKTQAPFWKKERARQGTYWVKERKTDHQDAERWS... 159
458 3.000e-69JGI.Meta 7023387514 SRS022602_Baylor_scaffold_82489__gene_100742 hypothetical protein [Human Supragingival plaque microbiome from visit numb  ali  37  4IQISVQEQPFDQNAVYQWLSEQH-SVGATVIFVGKVRDLNDEVSSLYLEHYPAMTEKALREIVEQAKARWDIQRVSVIHRVGLLHTGDEIVLVGISSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESD........... 143
459 3.000e-69gi|653271847|ref|WP_027469786.1| hypothetical protein [Deefgea rivuli]  clstr ali  40  4..IQVQTDDFDVALEYARLV-GNPAIGAVVMFVGRVRDLNPELIALELEHYPKMTERALLQIVQDARTRWPLDAVTLIHRVGPLHPAEQIVLVLTASAHRHAAYAANAYIMDYLKTEAPFWKKERTSSQSVWLDARESDQAARQRWE... 149
460 3.000e-69JGI.Meta 7066427186 C2680535__gene_97936 hypothetical protein [Human Buccal mucosa microbiome from visit number 2 of subject 159814214]  ali  35  6..VKVQTESFDQNEVYHWLSEHH-SVGATTIFVGKVREMNDDVSGLYLEHYPAMTEKALHEIVEEARSRWELQRIAVIHRIGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTNHGERWIEGRDSDQIKAEKW.... 150
461 3.000e-69gi|492469417|ref|WP_005855422.1| molybdenum cofactor biosynthesis protein MoaE [Sagittula stellata]  clstr ali  45  1MRIVVQDAPFDFGAEAAGFAAGRHDMGAIVTFTGVVRDVDGGLNAMEIEHYPGMTEKALEKIAAEAMDRWSLGDALVIHRYGRMEAGEQIMMVATAARHRKDAFEAAEYLMDYLKSRAPFWKKEFVGDETGWVAARDEDEAALDRW.... 146
462 4.000e-69gi|491996433|ref|WP_005712884.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus parasuis]  clstr ali  34  6..IQVQQDPFDQNAIYKWLSEQH-SVGATTLFVGKVREMNDSVSGLYLEHYPAMTEKALRAIVDEAKSRWELQRVAVIHRIGQLYTGDEIVLVGVSSAHRGNAYHANEFIMDYLKTKAPFWKRETTDHCDRWIEGRESDQEAADKW.... 150
463 4.000e-69gi|496031842|ref|WP_008756349.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacteraceae bacterium KLH11]  clstr ali  46  5MRIAVQEEEFDLGAEANAFAAGDAANGAIVTFTGVVRDLTGDLDVMEIEHYPGMTERALTKIAQDAKERWSLGDVLVIHRHGRLAPGDRIMMVATASPHRKDAFEAAEYLMDYLKSRAPFWKKEITTSGADWVAAKDEDEDALTRW.... 151
464 6.000e-69gi|499928449|ref|WP_011609183.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Histophilus somni]  clstr ali  37  4IKISVQEQNFDQNAIYQWLTEPH-SVGAAVIFIGKVREMNDSVSGLYLEHYPAMTGKALQEIVVEAKKRWQLYRVAVVHRVGLLNTGDEIVLVGVSTAHRGDAYQANEFIMDYLKSKAPFWKKEQTCQGTRWIEHRESDQQALEKW.... 150
465 6.000e-69gi|652396238|ref|WP_026792073.1| molybdopterin synthase catalytic subunit [Pleomorphomonas oryzae]  clstr ali  46  9IIVRVGPDDFDVGAEIDALQAGDPAVGAVTSFVGYCRDEGGRLAALELEYYPGMAEAEIGRVVNEAVARWPLYAITVVHRGGRIKPGERIVLVAVSSSHRDAAFAACDYVMDFLKTRAPFWKKEHPADRSEWVEAKAHDDARAERWKGE. 159
466 6.000e-69gi|503579986|ref|WP_013814062.1| MULTISPECIES: molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia]  clstr ali  36  5..IIVDTESFDIAREHQWLSASETE-GAVVTFVGKVRNNNLGVNSLTLEHYPGMTEKLLAQIVDEARRRWPLGRVVVFHRIGELRAGDGIVLVGVSSTHRADAFLAAEFIMDYLKTKAPFWKKESTPQGELWVAARDKDCAAVERW.... 149
467 6.000e-69JCVI_PEP_1096665705785 /source_dna_id=JCVI_ORF_1096665705784 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  45  11MDVKIQEAAFDVGAEINAFSQRHTKMGAITTFTGIVRDNDDELQAMEIEHYPGMAEKAISEIMQTAVKRWSLGDALVIHRYGTLAPGEIIMMVATAAIHRTDAFQAAEFLMDYLKSRAPFWKKEITKEAVTWVPSRQNDEDALDRW.... 157
468 6.000e-69JCVI_PEP_1096683196451 /source_dna_id=JCVI_ORF_1096683196450 /offset=0 /translation_table=11 /length=153 /full_length=153  ali  38  1.MIKLQVEDFDVSRELSVMLSGHKQVGGVCTFVGLVRDSSEPLNSLTLEHYPEMTKKELIKIEKQAKEKWTLKDSLIIHRYGRLVPSDQIVFVATASAHRRDAFNSCEYIVDYLKTRAPFWKKEEYKSRVKWVEARSSDEDAVNKWEEVA 151
469 7.000e-69gi|504686294|ref|WP_014873396.1| molybdenum cofactor biosynthesis protein MoaE [Phaeobacter gallaeciensis]  clstr ali  44  1MRIAVQKDAFDLGEESQRFASDVANAGALVTFTGVVRGSEKGMVAMEIEHYPGMTERAIKTITQEAQQRWSLADALVIHRHGRLVPGEQIMMVATAARHRSDAFEAAEYLMDYLKSRAPFWKKEMTQDGTNWVEAKDSDEEALTRWD... 153
470 7.000e-69METAHIT unmapped GL0392955 unmapped_[Lack_5`-end]_[mRNA]_locus=scaffold689919_2:2:430:+  ali  40  1........DFDLSEELKRLRDGRQDIGAVVSFLGTVRDIHDDILSMELEHYPGMTELVLGEIVDEARRRWDIVDLTVIHRVGKLKLSDQIVLVAVASRHRRDAFMACEYLIDMLKARAPFWKKEETASGMRWVKAKSSDQDVLDRWKK.. 142
471 7.000e-69  ali  40  1........DFDLSEELKRLRDGRQDIGAVVSFLGTVRDIHDDILSMELEHYPGMTELVLGEIVDEARRRWDIVDLTVIHRVGKLKLSDQIVLVAVASRHRRDAFMACEYLIDMLKARAPFWKKEETASGMRWVKAKSSDQDVLDRWKK.. 142
472 7.000e-69gi|575466021|gb|ETX11741.1| molybdenum cofactor biosynthesis protein MoaE [Marinomonas ushuaiensis DSM 15871]  clstr ali  41  1.MIQVQENDFDVDALYKGLLKSNK-TGAVAMFVGLVRDLSKEACSFELEHYPGMTERNLKKIVDEANDRWPLLDVCVVHRVGRLTIDDQIVFVGVSASHRAEAFQACDFIMDYLKSRAAFWKKETQGSKSQWVEANTKDEASLERWSKE. 150
473 8.000e-69gi|516721232|ref|WP_018064257.1| hypothetical protein [Martelella mediterranea]  clstr ali  39  7..IRIQAETFDIAAEIEDIIGGRPDIGATVSFTGHCRDEGGRLEALELEHYPGMAEEEIARIGQQAIDRFGLLGLTVIHRFGRMLPGDPIVVVIAAASHRHAAFEGASFVMDFLKTDAPFWKKEHLKDGGEWVSAREQDDHARDRWQ... 153
474 8.000e-69gi|495026086|ref|WP_007751725.1| molybdenum cofactor biosynthesis protein MoaE [Rhizobium sp. CF080]  clstr ali  44  7.SIRVQATDFDLQAEITALTAGRKNIGAVVTFTGLCRDEQGALSALELEHYPGMAEAEMLRIGELAIERFSLLGLTAIHRYGKILPGGNIVLVIAAAPHRQAAFDGANFVMDFLKTSAPFWKKEHAADGRQWIAAKDTDDTARDKW.... 153
475 9.000e-69JGI.Meta 7058187163 SRS049959_WUGC_scaffold_20054__gene_38114 moaE protein [Human Stool microbiome from visit number 1 of subject 765701615]  ali  36  7..IRVSHEDFDVSAELKALGRAGRRAGAAVTFTGIVR-TDDGVTSMTLEHYPEMTERSLAKIVEKARARWDIEDVVVIHRVGELTAGEQIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKETTAEGGRWVDARESDDLAKSRWGEAS 153
476 1.000e-68gi|568206608|ref|WP_024080972.1| Molybdenum cofactor biosynthesis protein E [Magnetospirillum gryphiswaldense]  clstr ali  40  1.MIRVQAEDFDPGAELAAFSAGNGKVGGICMFLGLVRDQGAGVSAMTLEHYPGMTERQLAAIEAEARDRWPLHEVLIIHRHGRLEPGERIVLVATASSHREAAFQSCHFLMDWLKTKAPFWKIEHTDQGDQWVAAKDEDDDAARRWTR.. 154
477 1.000e-68gi|493779028|ref|WP_006727463.1| molybdenum cofactor biosynthesis protein MoaE [Agrobacterium albertimagni]  clstr ali  40  7.TIRVQRDDFDAAAESRGLTADRKDIGAIVSFVGLCRDEAGTLSALELEHYPGMAETEMTRIAELAIDRFSLLGLTAIHRFGRIEAGEQIVLVIAAAPHRQAAFDGANFVMDFLKTSAPFWKKEHSQDGSSWVAAKDADDTARDRWSR.. 155
478 1.000e-68JCVI_PEP_1096673101969 /source_dna_id=JCVI_ORF_1096673101968 /offset=0 /translation_table=11 /length=198 /full_length=198  ali  45  53..VRVQEAAFDPGQELNAFSATVQGAGAVVSFSGITRDLAEGLDVMEIEHYPGMTEKALQSIREEALTRFSLAGAMILHRYGRLAAGDPIMMVATAARHRADAFAGAEFLMDYLKSRAPFWKKEVTPEGARWVAARAEDEEALTRW.... 197
479 1.000e-68gi|501512903|ref|WP_012520840.1| molybdopterin synthase [Phenylobacterium zucineum]  clstr ali  68  1.MIRLTDQPFDPGALLGEFSRARTETGAVATFTGIARAEQGSTAVLELEAYPGFTEAHIGKIAEEAKRRFGLHDLAILHRVGRIAPGEPIVFVATAAGHRRAAFEACDFLMDYLKSKAPFWKKEHGPGGARWIEPTAQDHADRARWEKE. 148
480 1.000e-68METAHIT unmapped GL0076672 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold25635_1:3:440:-  ali  41  6..VIVRHEDFDVSREMEELPKGSGSAGAMVAFTGVVRNQGDDIFALTLEHYPGMTESAITAIADKARARWELDDIVVIHRVGRLEVGDQIVLCLVTSAHRGEAFEACEYIMDWLKTEAPFWKKEETPSGSRWVDARESDEK......... 146
481 2.000e-68gi|490529690|ref|WP_004394880.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio metschnikovii]  clstr ali  42  2............ADEYA-VLAQDSAAGAVVTFVGKVRDLNDDVIGLRLEHYPGMTEKALSHLCDQAQQRWPLQQVRIIHRVGDLDVGAQIVFVGVASAHRGASFAACEFIMDSLKTQAPFWKKERTTHSERWIESRESDHQAAKRW.... 136
482 2.000e-68gi|653046932|ref|WP_027298531.1| molybdenum cofactor biosynthesis protein MoaE [Rhodospirillales bacterium URHD0088]  clstr ali  39  1.MIRVQREDFDIGGEIARLTAANRRIGGVASFVGLVREMAGGIGAMTLEHYPGMTEKKLAEIESEACRRWPLDASLIIHRYGRLEPGDRIVLVVTASAHREAALASCAFLIDWLKTEAPFWKLEETDSGGKWVEAREGDATAARRW.... 147
483 2.000e-68gi|430003095|emb|CCF18878.1| Molybdenum cofactor biosynthesis protein E [Rhizobium sp.]  clstr ali  46  7..IRVQMQDFDLQSEIDALTRGRTGIGAVVTFTGLCRDEQGALSALELEHYPGMAEAEMQRIADLAIERFSLQGLTAIHRYGKIAPGENIVLVIAAAPHRQAAFDGASLMMDYLKTSAPFWKKEHKADGTDWVSAKDADDRAREKW.... 152
484 2.000e-68gi|502980999|ref|WP_013215975.1| molybdenum cofactor biosynthesis protein MoaE [Hyphomicrobium denitrificans]  clstr ali  39  1MAVRVSTSDFDISAEMARLTNGDTGVGGVALFVGKVRDHKDGLTELVLEHYPGMTEAELERIEAEAQRRFDLSASLVVHRVGSLKPGDNIVLVIACASHRQNAFAAAEFLMDYLKTRAPFWKKEVLASGEHWVDARESDDEAAAAWQ... 150
485 2.000e-68gi|516957991|ref|WP_018184261.1| hypothetical protein [Kaistia granuli]  clstr ali  42  4VRVAIVSEPLDITAEIERVTTGRGDIGAVVTFTGLCRDEDGRLEALELEHYPGMAETEVTRIAEQAAKRWEISDVTVLHRHGKVKPGETIVLVVTASKHRHAAFESAEFIMDFLKTHAPFWKKEHTAAGAVWVSAKSSDDDAEERWN... 151
486 2.000e-68gi|503519331|ref|WP_013753747.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Glaciecola sp. 4H-3-7+YE-5]  clstr ali  38  5..IEVQTEDFNQGALYDALRQDSLANGAIVTFSGLVRDFNQGVGDLFLEHYPAMTKASLLNIVTAARARWHFGKIIIIHRVGRLAQGEQIVFVGLTSAHRKDAFDGVQFIMDYLKTEAPFWKKESTSEGDKWVAANVSDTEARLRWDKQ. 153
487 2.000e-68gi|505278008|ref|WP_015465110.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas sp. CNPT3]  clstr ali  36  1.MIKVQTQDFNQQVEYEHLRAAS-QTGAIVTFTGLVRDVNQGISLLTLEHYPLMTEKVLNEIVAQASLRWSILNVRVIHRVGELQLLDQIVFVGIASLHRGDAFAACEYIMDHLKAAVPFWKKERNNAGSYWVDARESDQNALKKWQ... 148
488 2.000e-68gi|639255618|ref|WP_024577720.1| MULTISPECIES: molybdenum cofactor biosynthesis protein MoaE [Afipia]  clstr ali  37  5VTIRIQSADFDIAAEIAALTKGNTDIGAVVSFSGICRGGEGDIAAMTLEHYPGMAEAEIGRHVSEAIARWPLTGVTVIHRFGRVVPGDNIVLVLTASVHREAAFQAAEFLMDYLKTNAPFWKSEQTDDNTVWVDAQAHDDNAAARWKK.. 155
489 2.000e-68gi|565829811|ref|WP_023913598.1| molybdenum cofactor biosynthesis protein MoaE [Rhodobacter capsulatus]  clstr ali  46  1MQVRVQDAGFDFGSELSAFSENRENVGAVVGFLGLVRDDTGTLEALEIEHYPGMCESAIAAMVEEARRRWDLADALVIHRHGRLAVGAQIMMVATAARHRVAAFEAAEFLMDYLKSRAPFWKKEVSRDGTAWVAAKDIDEDALSRWQ... 147
490 3.000e-68gi|504052739|ref|WP_014286733.1| molybdenum cofactor biosynthesis protein MoaE [Pseudovibrio sp. FO-BEG1]  clstr ali  46  9.TVRVQAADFDVLAETEILTKGRKDVGAIVTFTGLCRDEGGTLEALELEHYPGMAEAQISKFAQQAVDRWPITGLTIIHRFGKIPPGENIVLVIATSPHRRAAFEAADFLMDFLKTQAPFWKKEHLKDASEWVEAKAADDADAARWNEE. 158
491 3.000e-68gi|492851666|ref|WP_006005620.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Glaciecola punicea]  clstr ali  34  1.MITVQQEDFDHGREYEALRELANRDGAIVTFTGLVRDFNSSVSNVVIEHYSGMTEKYLMQICSDAKKRWNLGQVRIIHRIGTLEAFEQIVFVGVSSKHRQNAFEAAQFIMDILKTTAPFWKQETTAKGTQWVKRKDSDEAAAAKWS... 148
492 4.000e-68gi|491810937|ref|WP_005612966.1| molybdopterin synthase subunit MoaE [Ruegeria mobilis]  clstr ali  45  1MRVLVQQEPFDFGSEAEAFARDAGGAGAVVTFTGVVREADSGAMAMEIEHYPGMTEKALEKIASEAIARWDLTDALVIHRHGRLVPGDQIMMVATAARHRVAAFEAAEYLMDYLKSRAPFWKKEILQNGAEWVAAKSADEDALTRW.... 148
493 4.000e-68gi|520762301|ref|WP_020284359.1| molybdopterin converting factor, subunit 2 [Osedax symbiont Rs2]  clstr ali  36  6..IKIQTEDFDLTQLNTWLQQSDSSYGALVTFTGVVRDSGADLEQLFLEHYPGMTQKCLLNIVERARARWSLGRIAVVHRVGELTINENIVFVGVISAHRVEAFQATQFIMDYLKKEAPFWKKELTAKSKAWVEQKQSDLEAAGQWGS.. 152
494 4.000e-68gi|636824427|ref|WP_024350516.1| molybdopterin synthase catalytic subunit [Aurantimonas coralicida]  clstr ali  42  5..VRIQAENIDIAAEIAAMTGG-GAVGGLVTFSGYCRDEGGRLAALELEHYPGMAEREIARIARETLARWPLFGCRAIHRYGRVAPGEEIVFVACSSAHRQAAFEAASYLMDFLKTQAPFWKREHLVDGSTWIEAKDTDDAATDRWHR.. 151
495 4.000e-68gi|516013947|ref|WP_017444530.1| hypothetical protein [Gayadomonas joobiniege]  clstr ali  40  1.MIKVQTEPFNVGEIYQNLANNNAAAGAVVFFVGQVRDYNQNIRALTLEHYPAMTEKVLSEIVNEAERRWPLQAVSLVHRVGRMLIGDEIVFVGVASAHRQAAFAASQFIMDKLKTQAPFWKKEETETGNHWVEARESDIKAADNW.... 147
496 5.000e-68gi|495869739|ref|WP_008594318.1| molybdenum cofactor biosynthesis protein MoaE [Nitratireductor pacificus]  clstr ali  51  7..VHVQAGDFSLAEEVRRLTGGRRDVGAVVTFTGLCRDEGGRLDALELEHYPGMAEAEIGRIAAEAAGRWPLTGLTVIHRFGRIAPGENIVLVVAAASHRRAAFEAADFLMDFLKSRAPFWKKEHAAEAGVWVEATEKDRDDMKRWQR.. 153
497 6.000e-68JCVI_PEP_1096693949963 /source_dna_id=JCVI_ORF_1096693949962 /offset=0 /translation_table=11 /length=163 /full_length=163  ali  37  1...KVQEEDFDVGEEFSRMTTGKTAIGGLASFVGLVRDYDGDITSMTLEHYPGMTEKELKRLEADARRRWELEDVLIIHRYGKLSPGDRIVLVVTASPHRGAALESCQFLIDWLKTKAPFWKLEDRTSGKKWVAARDEDSVTANRW.... 145
498 6.000e-68JCVI_PEP_1096682844481 /source_dna_id=JCVI_ORF_1096682844480 /offset=0 /translation_table=11 /length=180 /full_length=180  ali  39  31.SILIQADDFSLDRALTELKAQSGLAGGLCFFTGAVRNSNDAVGGLYLEHYPGMTERQLDQIVDEAARRWQLHGAIVVHRIGHLKPGDNIVLVAVSASHRGEAFEACEMIMDYLKTNATFWKKESIPDGHRWVEARSSDQAKATAWD... 178
499 6.000e-68JCVI_PEP_1096669525925 /source_dna_id=JCVI_ORF_1096669525924 /offset=0 /translation_table=11 /length=161 /full_length=161  ali  42  13..VRIRTADFDAGVEIDKLR--RAGVGAIATFSGIVRHETPGLIAMTLEHFPGMTEQEIQNIIDQARRRWPLTAVKVIHRVGRLLPQENIVFVGTASAHRQAAFDSASFIMDYLKTRAPFWKKEETSSGAQWVEARETDDIALQKW.... 156
500 6.000e-68gi|497191453|ref|WP_009505715.1| molybdenum cofactor biosynthesis protein MoaE [Citreicella sp. 357]  clstr ali  42  3IRILVQEAPFDFAAEADGFAAGRTDLGAVVTFSGVVRDLSGSLDGMAIEHYPGMTEKALDAIAREAEARWSLGEVLVIHRYGEMAAGERIMMVATASAHRKDAFESAQFLMDYLKSRAPFWKKETAAGARSWVAARDEDEAALKRW.... 148
501 6.000e-68gi|494919525|ref|WP_007645562.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Cellvibrio sp. BR]  clstr ali  36  4.TIRVQTEDFDLKTEYDSLRAISAPCGAVVLFTGLVRDFPQQLVDLTLEHYPVMTEHALHKLVEQARRRWLLLGVTIIHRTGRLMPGDQIVMIGVSSAHRASAFDAVQFLMDKLKTIAPFWKKETYPNESYWVSAKDSDEQLAQRW.... 156
502 7.000e-68gi|497495512|ref|WP_009809710.1| molybdenum cofactor biosynthesis protein MoaE [Roseobacter sp. MED193]  clstr ali  46  1MQVRVQEEGFDLGAESDGFAAGVSGAGAIVTFTGVVRDDGGGLEAMEIEHYPAMTQTALEAIATEAKTRWELADALVIHRYGRLLPGERIMMVATAARHRKHAFEAAEYLMDYLKSRAPFWKKEILCDGSDWVSAKADDEAALERW.... 148
503 7.000e-68gi|567647390|gb|ETK22657.1| molybdopterin biosynthesis MoaE [Pseudomonas sp. FH1]  clstr ali  44  1MAIRVQAQAFDPGFEVNAMHAANVGVGAVVSFVGYVRDFNDGVAGMFLEHYPGMTEKALAKIAVEAEQRWPLLKLEVLHRIGALEPGAPIVFVAAASAHRQAAFDACAFVMDYLKTRAPFWKKENTSAGPRWVEGRDSDQAAEKRWNLEG 152
504 7.000e-68gi|648507521|ref|WP_026199272.1| molybdenum cofactor biosynthesis protein MoaE [Lamprocystis purpurea]  clstr ali  46  2ISIQVQQQPFQIAAEQEALWRGKPQVGALVTFVGLMRDINREVSAMTLEHYPGMTXXXXXXXXXXXXXRWDLLGLRIVHRVGLLTPQEPIVFVGVVSRHRTEAFRACEFLIDYLKTRAPFWKKETTPDGERWVEARATDEAAAGRWS... 150
505 8.000e-68gi|501276210|ref|WP_012319228.1| molybdenum cofactor biosynthesis protein MoaE [Methylobacterium radiotolerans]  clstr ali  47  11.SVGIQAEPFDTAAEIAGLSAALGGAGAVVTFTGLCRDEGGRLTALELEHYPGMAEAEIRRVADEAMARWPLQALRVIHRHGLVRPGDGIVLVVTAASHRVAAFEAADFLMDYLKTRAPFWKREHLADGTTWVDATAQDEVAAGRWG... 159
506 8.000e-68gi|506359117|ref|WP_015878836.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Tolumonas auensis]  clstr ali  34  5..ILVQQEDFDVAAEYARLS-DNPETGAIVSFIGKVRNFNQDVTGLHLEHYPAMTQLSLEKLVAEAHARWPIQSCTLIHRVGDLTINDQIVLILVASVHRKAAFAACEFLIDELKTSAPFWKKERLTDGSRWVSP............... 139
507 9.000e-68JCVI_PEP_1096672812411 /source_dna_id=JCVI_ORF_1096672812410 /offset=0 /translation_table=11 /length=152 /full_length=152  ali  32  6.MIKVQKDDFDINKEIKKITSVNKNIGGTGLFIGNVREGNSELKSMTLEHYPIMTERQLEKINNEAKARWNLIDSLIIHRYGKLYPGDQIVLVATFSRHRTDALNACEFLIDWLKTKAPFWKLEESNQGSTWVKERHSDLDAANKW.... 151
508 9.000e-68gi|557399379|ref|WP_023410104.1| hypothetical protein [uncultured Thiohalocapsa sp. PB-PSB1]  clstr ali  39  6IEIRIQDSSLDPAIEQDQLRLGCPSAGALVAFVGLMRDISDDVTAMTLEHYPGMTERALTGIADEAMARWHIDGIRIVHRVGRVFPQDPIVLVAVLSKHRMEAFRACEFLIDFLKTHAPFWKKEQTAQGDRWVQARNPDLHAAIRWG... 154
509 9.000e-68gi|297183999|gb|ADI20119.1| molybdopterin converting factor, large subunit [uncultured alpha proteobacterium EB080_L06A09]  clstr ali  45  1MAVLIQEEDFNLSDELKLLKAGKGDAGAIISFIGSVR-GDKSLRALELEHYPNMTLSSLEEIQDKAISRWKLIDVRIIHRFGYLSLGEQIMMVAVASQHRREAFEAADYIMDFLKSRAPFWKKEHSDTGSTWVDANPEDEKSLARW.... 145
510 1.000e-67gi|494915980|ref|WP_007642018.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Cellvibrio sp. BR]  clstr ali  35  4.SIAVQTNDFNVGDEYAQLVENDKDAGAVVFFVGRVREMNQSVSGLSLEYYPSMTERVLDQIMDVARQRWDLISVRIVHRVGQLYLSDQIVFVGVTSQHREHAFQAAEFLMDFLKTQAPFWKKEITAHGEMWVEAKESDQQRAIMWE... 151
511 1.000e-67gi|578037864|emb|CCQ74865.1| Molybdopterin-converting factor subunit 2 [Magnetospira sp. QH-2]  clstr ali  41  1MVVRVQREDFDVGAELATFTDGNKAIGGVCLFVGLVRDLTGGEGAMTLEHYPGMTEKQLEKIEAEARKRWPLENSLIIHRFGRLEAGEQIVLVAAASAHRDAAFQAARFLMDWLKTQAPFWKQEHGGDGDQWVEAKDSDDFAAQQWNRE. 149
512 1.000e-67gi|550982848|ref|WP_022730947.1| molybdenum cofactor biosynthesis protein MoaE [Thalassospira lucentensis]  clstr ali  44  3.RVSVQQDDFDPGAELAALTDGRTDIGAAVSFVGLVRDGGDTVSALTLDHYPGMTERELEKIADEAGHRWKLDGIRIVHRFGRMEPGERIVLVIALSAHRRDAFEACDFVMDFLKTRAPFWKREETQNGEKWVSAKASDDADADRWK... 150
513 1.000e-67gi|119094151|gb|ABL60981.1| molybdopterin converting factor large subunit [uncultured marine bacterium HF10_19P19]  clstr ali  40  12..VSIRTADFDAGVEIDKLR--RAGVGAIATFSGIVRNETPGLIAMTLEHFPGMTEQEIQNIIDQARRRWPLTAVKVIHRVGRLLPQQNIVFVGTASAHRQAAFDSASFIMDYLKTRAPFWKKEETSSGVQWVEARETDDIALQKWVKP. 158
514 2.000e-67gi|501562602|ref|WP_012567070.1| molybdenum cofactor biosynthesis protein MoaE [Rhodospirillum centenum]  clstr ali  45  1MTVRVQAEDFDVGAELAALTRGNPRIGGLACFVGLVRDLHPGAADLTLEHYPGMTERQIGAIAAEAKARWPLESVLVIHRHGRLEPGDRIVLVACASAHRDAAFAACQFLMDWLKTRAPFWKREETVEGGRWV................. 139
515 2.000e-67gi|495382412|ref|WP_008107122.1| molybdenum cofactor biosynthesis protein MoaE [Methylophilales bacterium HTCC2181]  clstr ali  35  1.MVKIQKEDFSIEKMTTEIKALGSHIGAIVSFIGYVRDFNKILLDMHLEHYPGMTEKVLNDIEKKAFSRWDLSAVTIVHRVGVLKSNDPIVAVIVASPHRNNAFDACRFIIDFLKTEAPFWKKESTDSGDYWVDDKKSDLKQKQSWDNQS 153
516 2.000e-67gi|567422784|ref|WP_024022742.1| molybdenum cofactor biosynthesis protein MoaE [Marinomonas sp. D104]  clstr ali  41  1.MIRVQHEDFSVDDLYKGLLKAN-QTGAVAMFVGLVRQFSDESCSFELEHYPGMTERNLQAIVDEANTRWPLLDVCVVHRVGRLSVDDQIVFVGVSASHRAEAFQACDFIMDYLKSRAAFWKKESQGSESHWVEAKDDDEESLVRWSK.. 149
517 2.000e-67gi|500421753|ref|WP_011930022.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Calyptogena okutanii thioautotrophic gill symbiont] :_  clstr ali  33  4..IIIQQQDFDLSTEVALIKNTRSDIGAIVSFVGFVRELKDNIQKMTLEYYPGMTEKTLKYIVNKANKLWHISNTTIIHRVGDLNIKDQIVLVITSSKHRQTAFESCEFIMDFLKTQAPFWKKEHTQNKSTWVEAKSSDKNQKKRWE... 149
518 2.000e-67gi|495086767