current user: public

Query: ACL93483.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
31 3.000e-81gi|515528283|ref|WP_016961500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio norvegicus]  clstr ali  40  1.MISVQHEDFSLAEEYQRLNDSDSD-GAIVTFIGKVRDMNDNVTGLTLEHYPGMTEKSLNEIVLQAKQRWPLTHIRVIHRVGALNIGDQIVFVGVTSAHRNAAFEACEFIMDYLKTRAPFWKKERLNDDERWVEARESDDTAANRW.... 146
41 1.000e-80gi|491624876|ref|WP_005482416.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio parahaemolyticus]  clstr ali  40  4.RVSVQVEDFSVDQEYQRLSEG-TASGAVVTFIGKVRDMNDNVIGLHLEHYPGMTEKSLSDICDEAEARWPLLGVRVIHRVGDMDSGDQIVFVGVSSAHRGAAFDACEFIMDYLKTKAPFWKKERTTNEDRWIESRDTDHQAARRWEN.. 151
47 1.000e-80JGI.Meta JGI_HUM.0277509 7062523745 SRS017227_Baylor_scaffold_27253__gene_31941 moaE protein [Human Supragingival plaque microbiome from visit number 1 of s  ali  42  53.HVCVQTGDFDVGAELRRLQRLTLETGGVASFVGYVRDTNQGIGGLTLEHYPGMTERSLERICAQAEARWPLLGVTVIHRVGPLAPGDQIVLVATASRHRDAAFESCRFIMDYLKTEAPFWKKESTPDGERWVDARDSDEAARRRWEQ.. 201
48 2.000e-80gi|515577318|ref|WP_017010076.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio calviensis]  clstr ali  40  1.MISVQRDDFSVAEEYQWLN-DNASDGAVVTFVGKVRDMNDNVTGLTLEHYPGMTEKSLEEICNDAKTRWPLGKVRVIHRVGALNLGDQIVFVGVSSAHRKAAFDACEFIMDFLKTRAPFWKKEKLVDDERWIEARDSDDEAANRW.... 146
50 2.000e-80gi|494074662|ref|WP_007016718.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bermanella marisrubri]  clstr ali  34  4..IAVQEADFDIAQEYQAMRQDNPNDGAIVFFTGLVRDFNQGVTGLFLEHYPGMTEKSLENIVEQAKQRWPINRVSLIHRIGQLHISDQIVFVSASSPHREAAFDACRFIMDYLKHEAPFWKKETTQEGDRWVKANQKDKDALKKW.... 149
53 2.000e-80gi|493273383|ref|WP_006231194.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium profundum]  clstr ali  38  1.MISVQFDDFSVAEEYALLSEG-TDAGAVVTFIGKVRDFNDDVTGLSLEHYPGMTEKSLEEIVVQARERWPLLKTRVIHRVGDLGLGDQIVFVGVTSAHRGAAFEACEFIMDFLKTRAPFWKKEQTSNETRWVDARDTDTSAADRWQNK. 149
99 3.000e-78gi|500842046|ref|WP_012005758.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia proteamaculans]  clstr ali  42  6.RIRVGEAPFNVGEEYQWLAQCDDD-GAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALAEIVDEARSRWPLQRATVIHRVGELFPGDEIVFVGVTSAHRSMAFEASEFIMDYLKTRAPFWKREAVGQGDRWVDARDSDRQAAERWHK.. 153
126 2.000e-77gi|498913082|ref|WP_010848258.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus nematophila]  clstr ali  40  5.RIRVQRERFHVGDEYQWLSQCDED-GAVVTFTGKVRNHNDNVNALTLEHYPGMTEKMLQKIADEARQRWPVQRITIIHRIGELYPGDEIVFVGVTSSHRNMAFTAAEFMMDYLKTKAPFWKKESLAEGERWVEIKQHDQEAANRWQS.. 152
137 3.000e-77gi|495318206|ref|WP_008042953.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Reinekea blandensis]  clstr ali  38  4..IRVQQDDFSVQREYDGLCRENTDDGAVVFFVGRVRDLNEGVTGMFLEHYPGMTEKTLQSIADEARHRWPLNRIRIVHRVGALNPSDQIVFVGVSSPHRGAAFDGAQYIMDFLKTRAPFWKKESTPEGDRWVDARSSDTEQENRW.... 149
143 5.000e-77gi|490543038|ref|WP_004408162.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio nigripulchritudo]  clstr ali  36  4..VSVQKEDFSLADEYD-VLAQGTSSGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLESLCEQAKQRWSIENIRVIHRVGDLDIGDQIVFVGVSSAHRGDAFNACEFVMDYLKTQAPFWKKERTTDSVRWVESRESDAAAASRWAEQG 152
157 9.000e-77gi|498123029|ref|WP_010437185.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio cyclitrophicus]  clstr ali  38  10.RVVVTAEDFSVGDEYDYLAQG-TAAGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLSEICDQAEARWPIEKMRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFVMDFLKTKAPFWKKERTTETTRWVDSRDSDAKAAERWEK.. 157
178 5.000e-76gi|503874917|ref|WP_014108911.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Glaciecola nitratireducens]  clstr ali  35  8..ISVQEQDFDLALEYTQIRKHSDSDGAIVTFTGLVRELTGNLKYMTLEHYPGMTEKSLMNICEQARERWPIGSIRIIHRIGKLPPDEQIVFVGVSSKHRKAAFAATEFMMDFLKTQAPFWKKELTTEGEFWVDAKSSDKHKANDW.... 153
183 6.000e-76gi|653020989|ref|WP_027272890.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Leminorella grimontii]  clstr ali  42  7.RIVVGAAPFSVGEEYQWLSQCDDD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKSLAEIVVAARERWPLQRVSVNHRVGELFPGDEIVFVGVTSAHRGSAFDAAEFIMDYLKTKAPFWKREATQEGDRWVESRDSDREAAERW.... 152
185 7.000e-76gi|506315285|ref|WP_015835060.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photorhabdus asymbiotica]  clstr ali  40  5.RIFVGLENFNVGDEYEWLSQCDED-GAIVTFTGKVRNHNDRVSGLRLEHYPGMTEKVLRNIVVEARSRWPLQRISIIHRVGALYPGDEIVFVGVTSAHRSMAFDAAEFIMDYLKTKAPFWKKEFLPDGERWVESRESDQEAARRW.... 150
186 9.000e-76gi|488369995|ref|WP_002439380.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shimwellia blattae]  clstr ali  42  5.RIRVGHDGFSVGDEYQWLAQCDAD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKALAEIVASARERWPLQRVSVIHRTGELWPGDEIVFVGVTGAHRGSAFEAAEYIMDYLKTRAPFWKREKTADGDRWVDARESDQQAASRW.... 150
189 1.000e-75JGI.Meta JGI_HUM.0744233 7045185570 C3786207__gene_311667 moaE protein [Human Stool microbiome from visit number 1 of subject 158337416]  ali  46  6..IVVGPQPFSVGEEYPWL-AERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRWVEARESDQQAAKRW.... 150
191 1.000e-75gi|260219647|emb|CBA26492.1| Molybdopterin-converting factor subunit 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  40  10.RVRIQTEAFDLGLEISQLQAADPRVGAVCSFVGTVRDRNGSVQTLELEHYPGMTEKSIEAMVDAAFARFDIYGARVVHRVGVLQPTEGVVLVAVTSAHRGQSFQACEFIMDYLKTQAPFWKKETTPEGAHWVDARVSDDEALARWGITA 163
200 1.000e-75gi|490355923|ref|WP_004235696.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Morganella morganii]  clstr ali  45  5.RIAVQTDNFSVGEEYQWL-AGCADDGAVVTFTGKVRNHNDNVAALSLEHYPGMTEKALADIVTQARERWELQRVTLIHRVGSLYPNDEIVFVGVSAAHRGMAFEAAEFLMDYLKTRAPFWKKETLPEGTRWVDARESDQKAADRW.... 151
202 2.000e-75gi|500085621|ref|WP_011761634.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella amazonensis]  clstr ali  37  5.RILVQTADFSVPEEYQRIAADNQD-GAVVTFVGKVRDFNEGVSDLTLEHYPGMTEKVLDQIADQARERWPLNHLTIIHRVGTMHLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLETSDKGQGWVEARDADDQAAKAWEQ.. 152
205 2.000e-75gi|497966771|ref|WP_010280927.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pectobacterium carotovorum]  clstr ali  44  5.RIRVGEENFNVGDEYQWLAQCDED-GAVVTFTGKVRNHNKDVSALTLEHYPGMTEKALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDKQAAQRW.... 150
214 3.000e-75JGI.Meta JGI_HUM.3397531 7008186891 SRS065099_LANL_scaffold_75854__gene_134260 moaE protein [Human Supragingival plaque microbiome from visit number 2 of su  ali  42  5..IHVQTQDFDVGAELKRXXXXXREVGAVASFVGYVRDSNDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRPRAAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQ... 161
224 6.000e-75gi|499954843|ref|WP_011635577.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella frigidimarina]  clstr ali  37  8IVVRVHTEDFSVADEYA-LLACDKQDGAVVNFVGKVRDFNDGVTDLTLEHYPGMTESVLLQISQQACERWPLNKVTIIHRVGRLSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDTGAKWVEARDSDQQAAKMWQK.. 156
227 7.000e-75gi|500094461|ref|WP_011770468.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ingrahamii]  clstr ali  36  1.MIRVQTEDFNQQREYDRLREQS-SVGAVVTFTGLVRDFNQGVASLTLEHYPLMTEKSLAQIVMQAKQRWNILACTLIHRVGELKISEQIVFVGIATAHRQDAFAACEYIMDYLKTEAPFWKKECNSQGSYWVDARESDRSALNKWS... 148
234 1.000e-74gi|518446484|ref|WP_019616691.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ossibalaenae]  clstr ali  35  1.MIKVQSEDFNQQVEYDRLRK-DPSVGAVVTFSGLVRDINQGVSSLTLEHYPGMTESSLAEIVKQAESRWNIIDCTVIHRIGELQLLDQIVFVGIASLHRQDAFAACEFIMDYLKTQAPFWKKETNAQQESWVDARESDQEALNKW.... 147
253 2.000e-74gi|502752553|ref|WP_012987537.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus bovienii]  clstr ali  41  3....VQRERFNVGDEYQWLSQCDDD-GAVVTFTGKVRNYNDSVKALTLEHYPGMTEKMLQVIIDEARQRWPLQRISVIHRIGELYPGEEIVFVGVTSAHRSMAFTAAEFIMDYLKTRAPFWKKESLVEGERWVATRESDQEAAGRW.... 145
263 5.000e-74gi|499513561|ref|WP_011200201.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Mannheimia succiniciproducens]  clstr ali  35  15IKIAVQEAEFDQNSEYRWLSQSD-SVGASVIFVGKVRDLNDEVSSLYLEHYPAMTEKALNEIVDEAKSRWDIQRVVVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTKAPFWKKEKTDKGERWIESRDSDQQAAEKW.... 161
265 5.000e-74gi|503132351|ref|WP_013367012.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacter lignolyticus]  clstr ali  45  5.RIIVDTAAFDVGAEYRWL-AGRDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVEEARSRWPLGRVTLIHRIGEMWPGEEIVFVGVTSAHRSSAFAAGEFVMDYLKTRAPFWKREATPEGERWVDARDSDREAAERWQ... 151
266 5.000e-74gi|530669879|dbj|BAN68295.1| molybdopterin synthase catalytic subunit [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  42  4.RIAVQTEPFDLAEETARLSAGDATIGAVASFVGLVRGHNRDITTLILEHYPGMTEKALSRIVDAAAERWPLQAVTVIHRVGELRLGEPIVLVLTASAHRQAAFESCQFIMDILKTEAPFWKKERLPDGERWVDARESDSEAAARWLRD. 158
267 6.000e-74gi|503341713|ref|WP_013576374.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rahnella sp. Y9602]  clstr ali  43  6..IVVDAAPFSVGDEYNWLAQSDAD-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALAEIVAKARTRWPLQRVSVYHRVGPMYPGDEIVFVGVTSAHRGMAFEANEFIMDHLKTRAPFWKREATEEGDRWVDARDSDKQAAARW.... 150
270 6.000e-74gi|488369113|ref|WP_002438498.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Escherichia hermannii]  clstr ali  44  5.RIRVGHEGFSVGDEYQWLASCDED-GAVVTFTGKVRNHNESVSAMTLEHYPGMTEKALAEIVAEARQRWALQRVSVIHRIGELWPGDEIVFVGVTGAHRSQAFEAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDHQAAERW.... 150
272 6.000e-74gi|497815607|ref|WP_010129763.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus sputorum]  clstr ali  37  6..IQVQEDNFDQNAIYQWLSAEH-SVGATTLFVGKVREMNDNVSGLYLEHYPAMTEKALQEIVAQARQRWDLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKRETTQEGERWIEGRESDQQAADKWE... 151
273 7.000e-74JGI.Meta JGI_HUM.5609150 7002975176 C2680359__gene_119763 moaE protein [Human Tongue dorsum microbiome from visit number 2 of subject 159207311]  ali  36  6..IQVQEDNFDQNAIYQWLSAEH-SVGATTLFVGKVREMNDNVSGLYLEHYPAMTEKALQEIVAQARQRWDLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKRETTQEGERWIEGRESDQQAADKWELD. 153
289 2.000e-73gi|499813836|ref|WP_011494570.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella denitrificans]  clstr ali  35  5VKIAVQEADFDHAQEYARIAQDNND-GAVVTFCGKVRDFNEGITRLTLEHYPGMTESVLAQICQQALQRWSINHLTVIHRVGSLDLGEQIVFIGVSSAHRGDAFAACEYLIDFLKTKAPFWKLEATHQGERWLDARDTDEVAANTWQQ.. 153
290 2.000e-73gi|495494509|ref|WP_008219168.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera nanhaiensis]  clstr ali  41  3IFVAVQSDDFCVASEYNELRRQS-GCGAIVTFSGLVRELSDNLHSMTLEHYPGMTEQALTAIAEQAQQRWQLGAVHLIHRVGTLKPHEQIVFVGIASPHRAAAFAACEFIMDYLKNRAPLWKKEHTSNGDYWVEAKTSDQHALTRWD... 149
292 3.000e-73gi|499148425|ref|WP_010861753.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Plesiomonas shigelloides]  clstr ali  39  7.RIRVSEDDFDIAAEYTWLNQDD-SCGAVVTFTGKVRNHSGSVNGLHLEHYPAMTDKALNDIISEARARWPLGRVSLIHRVGELGSGEQIVYVGVSSGHRLAAFAAAEFIMDYLKVRAPFWKKEQMPDGARWVEAKTSDQEAARRWQSE. 155
301 4.000e-73gi|501410404|ref|WP_012441970.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia tasmaniensis]  clstr ali  41  4.RIRVGDAPFSMGDEHRWLSASDLD-GAVVTFTGKVRNHNDDVNALTLEHYPGMTEKALAAIVAEARQRWAMQRVTIIHRIGELFPGDDIVLVGVSAVHRGAAFDAAEFIMDQLKTRAPFWKREATADGQRWVAARESDRHAAARWK... 150
304 5.000e-73JGI.Meta JGI_HUM.7591836 7055301230 SRS054590_LANL_scaffold_12536__gene_37184 moaE protein [Human Stool microbiome from visit number 1 of subject 338793263]  ali  38  5.TIRVGEADFSVSDELAKLN-DQADCGAVVSFLGVVRRANEGVYAMTLEHYPAMTEKALAGIVERARARWQLGDITVIHRVGRLLPGDQIVLVAVAASHRGEAFQACEFIMDWLKTEAPFWKKEETPDGARWVDARVSDDEAKRRWE... 151
325 2.000e-72gi|501020732|ref|WP_012073403.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Actinobacillus succinogenes]  clstr ali  34  4IRIAVQEAEFDQNAEYRWLSENH-SIGATTIFVGKVREMNDEVASLYLEHYPAMTEKALREIVEEAKQRWDIQRISVIHRVGLLQTGDPIVLVGVSSAHRGDAYAANEFIMDYLKTRAPFWKKEQTAQGERWLESRDSDHQAVGKWSRE. 153
331 3.000e-72JGI.Meta JGI_HUM.0554194 7070023873 SRS047634_LANL_scaffold_56701__gene_65197 moaE protein [Human Supragingival plaque microbiome from visit number 2 of sub  ali  36  10..IAVQEQPFDQNAVYLWLSESH-SVGASVIFVGKVRDLNDGVSSLYLEHYPAMTAKALRDIVTEAKSRWDIQRVAVIHRIGLLHTGDEIVLVGVSSAHRGDAYSANEFIMDYLKTKAPFWKKEQTDKGERWIESRDSDKQAADKW.... 154
332 3.000e-72gi|517166714|ref|WP_018355532.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pasteurella pneumotropica]  clstr ali  36  4INISVQEAEFDQNEVYQWLSAQH-SVGAVVIFVGKVRDLNDDVSSLYLEHYPAMTEKALREIVFEAKQRWDIQRVAVIHRVGLLHTGDEIVLVGVSSAHRGNAYQANEFIMDYLKSKAPFWKKEQTKKGERWIESQDSDKKALEKW.... 150
335 4.000e-72JGI.Meta JGI_HUM.4755234 7071923912 C5470264__gene_149455 moaE protein [Human Stool microbiome from visit number 2 of subject 764002286]  ali  39  10..IRVGEADFSLDEELSRIMRESPSAGGVASFVGLVRNKNDGVSRMTLEHYPGMTEKSLAKIAAAARERFHLVDVIVVHRVGELKVGDRIVLCLTSAEHRGDAFAGCEYIMDWLKTEAPFWKKEQTPDGERWVDARESDDKARERW.... 155
336 4.000e-72JGI.Meta JGI_HUM.0907961 7067540983 SRS024435_LANL_scaffold_33659__gene_89960 moaE protein [Human Stool microbiome from visit number 2 of subject 159571453]  ali  37  7..IRVSHDDFDVSEEIAALEREGRNAGAVVTFTGVVRS-DDGVTAMHLEHYPEMTEKSLAQIVEKARARWNIEDVVIIHRVGGLKAGDRIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKEVTAQGGRWVDARESDEIAKNRWGK.. 151
338 4.000e-72gi|491889064|ref|WP_005654170.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus influenzae]  clstr ali  36  4IQIAVQEQSFDQNAVYQWLSELH-SVGATVIFVGKVRDLNDAVSSLYLEHYPAMTEKALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALEKW.... 150
341 5.000e-72gi|491992601|ref|WP_005709952.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus paraphrohaemolyticus]  clstr ali  35  6..VKVQTEPFDQNEVYHWLSEHH-SVGATTIFVGKVREMNDDVSGLYLEHYPAMTEKSLHEIVEEARSRWELQRIAVIHRIGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTNHGERWIEGRDSDQQAAVKW.... 150
342 5.000e-72gi|652426791|ref|WP_026822146.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Arsenophonus nasoniae]  clstr ali  39  5.RLVIQQANFNVAEQYEWL-AQCQDDGAVVTFTGKVRNHNDNIKTLTLEHYPVMTEKALQNIANEARCRWQLQRICIIHRIGTLQPGEEIVFVGVTSEHRSSAFSAAEFIMDYMKTKAPFWKKEHFTQGQRWVEARLSDQAAFERW.... 150
346 6.000e-72JGI.Meta JGI_HUM.5006440 7012385415 SRS024289_LANL_scaffold_19784__gene_24256 moaE protein [Human Supragingival plaque microbiome from visit number 2 of sub  ali  35  4VHISVQEAEFDQNAVYHWLSESH-SVGATVIFVGKVRDLNDDVSSLYLEHYPAMTEKALQEIISEAQSRWNIQRVSVIHRVGLLHTGDEIVLVGISSAHRGDAYHANEFIMDYLKSKAPFWKKEQTNKGERWIEARDSDKEALKKW.... 150
349 6.000e-72gi|491430314|ref|WP_005288109.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Edwardsiella tarda]  clstr ali  40  5.RIVVNTAHFAVADEYSWLAQCDED-GAVVTFTGKVRNHNDDVSALTLEHYPGMTEKALAQIVEQARARWPLGRVSVYHRIGPMQPGEEIVFVGVTSAHRGMAFQAAEFIMDYLKTRAPFWKREASNGHERWVDARDSDRQAAERW.... 150
350 6.000e-72gi|653000343|ref|WP_027252547.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium halotolerans]  clstr ali  39  4.RIVVGPKPFDTQAEYNWL-AGDDQDGAVVTFHGKVRNLGDDVSKLALEHYPGMTEKALRDIIEQARQRWTLNRVTIIHRVGELGAGEDIVMVGVSSAHRNNAFAAAEFMMDILKTQAPFWKRESTPDGERWLDARDSDHQAVKRW.... 149
358 8.000e-72gi|506352194|ref|WP_015871913.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Edwardsiella ictaluri]  clstr ali  43  6..IVVSAAPFSVAEQYQWL-AQRDEDGAVVTFSGKVRNHNDDVSALTLEHYPGMTEKALAEIVALARRRWPLGRIAVYHRVGPMFPGEEIVFVGVTSAHRGMAFEAAEFIMDYLKTRAPFWKRETSEGADRWVDARDSDRQAAERW.... 150
369 1.000e-71gi|518504281|ref|WP_019674488.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera perlucida]  clstr ali  43  3IFVAVQSDDFCLASEYSELRR-NAACGAIVTFSGLVRELHDTVLGMTLEHYPGMTEQALTQIATDALNHWQLAAVHVIHRVGRLKPNEQIVFVGVASAHRPAAFAACEFIMDYLKNRAPFWKKEHTAEGDYWVEAKASDQHALARWE... 149
371 2.000e-71gi|643887588|ref|WP_025267097.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bibersteinia trehalosi]  clstr ali  35  5..IKVQTENFDQNAVYRWL-AENHRVGATTVFVGKVREMNDSVSGLYLEHYPAMTEKALNEIVAEARQRWELERVAVIHRVGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTAQGDRWVEERESDLQAAEKWQ... 150
376 3.000e-71gi|494452462|ref|WP_007243365.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus pittmaniae]  clstr ali  36  4IQIAVQSQTFDQNAVYQWLSESH-SIGASVIFVGKVRDLNDNVSSLFLEHYPAMTEKALREIVEEACSRWQLERVSVIHRVGLLHTGDEIVLVGTASAHRGDAYAANEFIMDFLKSKAPFWKKEQTDQGERWIEARDSDKQALTKW.... 150
383 4.000e-71gi|516416876|ref|WP_017806274.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Avibacterium paragallinarum]  clstr ali  34  4IQIAVQSEPFDQNAVYRWVAEPH-SVGAAVIFVGKVREMNDNVSSLFLEHYPAMTEKALREIVEEACQRWQLLRIAVIHRVGLLYTGDEIVLVAVSSPHRGEAYQANEFIMDFLKSKAPFWKKEQTENGERWVEHRESDSAALRKW.... 150
385 4.000e-71gi|446467347|ref|WP_000545201.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Salmonella enterica]  clstr ali  45  5.RIVVGPAPFSVGEEYSWLAARDED-GAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGARWVEARDSDQQSAKRW.... 164
386 5.000e-71gi|503512715|ref|WP_013747234.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Gallibacterium anatis]  clstr ali  38  4IEISVQTEPFDQNAIYQW-SSASAESGATVIFVGKVRDMNDNVSGLYLEHYPAMTEKALREIAEQAAQRWQLQRIYIVHRVGQLYTGDEIVAVAVSSAHRGSAYQANEFIMDFLKTKAPFWKKETTKSGDRWLDSRESDQQAAHRWE... 151
388 5.000e-71gi|516742628|ref|WP_018077462.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  47  1MKIVIQCEAFDLGAEVDAMRRGRTGIGAIASFIGLARDCNEGVHAMTLEHYPGMTEKALAALVDEANSRWTLLDVTVIHRIGRLLPGDPIVLVAVASQHRGEAFAACEFIMDYLKTQAPFWKKEATPEGERWV................. 135
390 5.000e-71gi|643486994|ref|WP_025217316.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Mannheimia varigena]  clstr ali  37  6..IEVQEAEFDQNQIYRWLSEYH-SVGATTLFIGKVREINDNVSGLFLEHYPAMTKKALQAIVDEARQRWDLQRVAVVHRIGQLNTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKREQTQEGERWIEGRDSDQQAAEKWK... 151
391 6.000e-71gi|502358598|ref|WP_012771500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Aggregatibacter aphrophilus]  clstr ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGASVIFVGKVRDLNDKVSSLYLEHYPAMTHKALLDIAQQAKVRWDLQKISIIHRVGQLNTGDEIVLVGTSSAHRGDAYHANEFIMDYLKTQAPFWKKEQTTKGERWIEGRDSDYVAAEKWK... 151
395 8.000e-71gi|497290896|ref|WP_009605113.1| molybdenum cofactor biosynthesis protein MoaE [SAR116 cluster alpha proteobacterium HIMB100]  clstr ali  41  4..ITITTDNFNAGDEIEALRLA--GVGAIVTFTGIVRDKAEDLTAMTLEHFPGMTEQEIQAIIDEARTRWPLQGVRVIHRVGRLLPQENIVFVGTASAHRQAAFDSASFIMDYLKTKAPFWKKEETPAGASWVEARDCDDKALEKWQ... 148
398 8.000e-71JGI.Meta JGI_HUM.1370826 7030754592 C3544874__gene_274945 moaE protein [Human Supragingival plaque microbiome from visit number 2 of subject 159510762]  ali  34  4IRIAVQEAEFDQNAVYHWLSEQN-SVGAAVIFVGKVRELNDDVSSLYLEHYPAMTEKALKEIVAEAKQRWEIQRVAVIHRVGLLQTGDEIVLVGVSSSHRGEAYRANEFIMDFLKSKAPFWKKEQTDKGERWIDARTSDKQALEKW.... 150
400 9.000e-71gi|499247710|ref|WP_010945250.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus ducreyi]  clstr ali  35  6..IEVQQAPFDQHAIYQWLSEPH-SVGATTIFVGKVREMNDNVSGLYLEHYPAMTKKALQEIVNQARQRWELQRIAVIHRIGQLHTGDEIVLVGVSSAHRGDAYLANEFIMDYLKTKAPFWKRETTAEGERWIESRESDEQQLEKW.... 150
402 1.000e-70JGI.Meta JGI_HUM.4617030 7021232954 C3121381__gene_190630 moaE protein [Human Tongue dorsum microbiome from visit number 2 of subject 159571453]  ali  36  4IQIAVQSQTFDQNAVYHWLSESH-SIGASVIFVGKVRDLNDNVSSLFLEHYPAMTEKALREIVEEACSRWQLERVSVIHRVGLLHTGDEIVLVGTASAHRGDAYAANEFIMDFLKSKAPFWKKEQTDQGERWIEARDSDKQALTKW.... 150
419 2.000e-70gi|501463678|ref|WP_012487123.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Cellvibrio japonicus]  clstr ali  40  4.SIAVQEADFDVGTEYQALIVGDTRAGAHVLFVGRVRDMNMEVQGLFLEHYPGMTEQVLQSLVDDARKRWELLGVRLIHRVGYLRPGDQIVLVATSSAHRAHAFEAAEFLMDLLKTKAPFWKKEHSSGGAVWLESRAQDNEAGKRW.... 150
425 3.000e-70gi|506298013|ref|WP_015817788.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Teredinibacter turnerae]  clstr ali  36  1.MIRVQQADFDVAGEYRNLQQ-HGLAGAIVTFSGLVRDFAGDTSRFFLQHYPGMTESVLNKIVSQAQSRWPLLAVTVIHRVGHLQAGDQIVFVGVSSAHRKSAFAACEYIIDLLKTEAPFWKKE----GRQWVDAKQSDQAAADRW.... 141
431 4.000e-70JGI.Meta JGI_HUM.0297187 7062616834 SRS017227_Baylor_scaffold_97884__gene_125030 moaE protein [Human Supragingival plaque microbiome from visit number 1 of  ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGATVMFVGKVRDMNDEVSSLYLEHYPAMTHKALMDIAQQAKVRWDLQKISIIHRVGELNTGDEIVLVGTASAHRGDAYHANEFIMDYLKNQAPFWKKEQTEKGERWIEGRDSDYAAADKWK... 151
440 7.000e-70gi|652476222|ref|WP_026870909.1| molybdenum cofactor biosynthesis protein MoaE [Inquilinus limosus]  clstr ali  48  1MTVRVQEADFDPGAEIAALSDGRTDVGGVACFVGLVRDIASGVRAMTLEHYPGMTERQLAEIEAEARDRWPLLEVRIVHRIGRLEPGDRIMFCGVASAHRGAAFEACAFLMDWLKTQAPFWKKEETPEGERWV................. 135
449 1.000e-69gi|492137317|ref|WP_005759086.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pasteurella bettyae]  clstr ali  36  4VKIAVHEAEFDQNAEYRWLSEPN-SVGAAVVFVGKVRDLNDEVSSLYLEHYPVMTEKALREIVDEAIQRWQLQRVSVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKSKAPFWKKEQTDKGERWIEARHSDKEALEKW.... 150
458 3.000e-69JGI.Meta JGI_HUM.1612902 7023387514 SRS022602_Baylor_scaffold_82489__gene_100742 hypothetical protein [Human Supragingival plaque microbiome from visit numb  ali  37  4IQISVQEQPFDQNAVYQWLSEQH-SVGATVIFVGKVRDLNDEVSSLYLEHYPAMTEKALREIVEQAKARWDIQRVSVIHRVGLLHTGDEIVLVGISSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESD........... 143
460 3.000e-69JGI.Meta JGI_HUM.6790266 7066427186 C2680535__gene_97936 hypothetical protein [Human Buccal mucosa microbiome from visit number 2 of subject 159814214]  ali  35  6..VKVQTESFDQNEVYHWLSEHH-SVGATTIFVGKVREMNDDVSGLYLEHYPAMTEKALHEIVEEARSRWELQRIAVIHRIGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTNHGERWIEGRDSDQIKAEKW.... 150
462 4.000e-69gi|491996433|ref|WP_005712884.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus parasuis]  clstr ali  34  6..IQVQQDPFDQNAIYKWLSEQH-SVGATTLFVGKVREMNDSVSGLYLEHYPAMTEKALRAIVDEAKSRWELQRVAVIHRIGQLYTGDEIVLVGVSSAHRGNAYHANEFIMDYLKTKAPFWKRETTDHCDRWIEGRESDQEAADKW.... 150
471 7.000e-69T2D.2475594 [EC:][KEGG:K03635] molybdopterin synthase catalytic subunit;|[COG0314] Molybdopterin converting factor, large subunit  ali  40  1........DFDLSEELKRLRDGRQDIGAVVSFLGTVRDIHDDILSMELEHYPGMTELVLGEIVDEARRRWDIVDLTVIHRVGKLKLSDQIVLVAVASRHRRDAFMACEYLIDMLKARAPFWKKEETASGMRWVKAKSSDQDVLDRWKK.. 142
475 9.000e-69JGI.Meta JGI_HUM.0448702 7058187163 SRS049959_WUGC_scaffold_20054__gene_38114 moaE protein [Human Stool microbiome from visit number 1 of subject 765701615]  ali  36  7..IRVSHEDFDVSAELKALGRAGRRAGAAVTFTGIVR-TDDGVTSMTLEHYPEMTERSLAKIVEKARARWDIEDVVVIHRVGELTAGEQIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKETTAEGGRWVDARESDDLAKSRWGEAS 153
481 2.000e-68gi|490529690|ref|WP_004394880.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio metschnikovii]  clstr ali  42  2............ADEYA-VLAQDSAAGAVVTFVGKVRDLNDDVIGLRLEHYPGMTEKALSHLCDQAQQRWPLQQVRIIHRVGDLDVGAQIVFVGVASAHRGASFAACEFIMDSLKTQAPFWKKERTTHSERWIESRESDHQAAKRW.... 136
506 8.000e-68gi|506359117|ref|WP_015878836.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Tolumonas auensis]  clstr ali  34  5..ILVQQEDFDVAAEYARLS-DNPETGAIVSFIGKVRNFNQDVTGLHLEHYPAMTQLSLEKLVAEAHARWPIQSCTLIHRVGDLTINDQIVLILVASVHRKAAFAACEFLIDELKTSAPFWKKERLTDGSRWVSP............... 139
509 9.000e-68gi|297183999|gb|ADI20119.1| molybdopterin converting factor, large subunit [uncultured alpha proteobacterium EB080_L06A09]  clstr ali  45  1MAVLIQEEDFNLSDELKLLKAGKGDAGAIISFIGSVR-GDKSLRALELEHYPNMTLSSLEEIQDKAISRWKLIDVRIIHRFGYLSLGEQIMMVAVASQHRREAFEAADYIMDFLKSRAPFWKKEHSDTGSTWVDANPEDEKSLARW.... 145