current user: public

Query: ACL93483.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
25 2.000e-81gi|515528283|ref|WP_016961500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio norvegicus]  clstr ali  40  1.MISVQHEDFSLAEEYQRL-NDSDSDGAIVTFIGKVRDMNDNVTGLTLEHYPGMTEKSLNEIVLQAKQRWPLTHIRVIHRVGALNIGDQIVFVGVTSAHRNAAFEACEFIMDYLKTRAPFWKKERLNDDERWVEARESDDTAANRW.... 146
42 5.000e-81gi|515577318|ref|WP_017010076.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio calviensis]  clstr ali  40  1.MISVQRDDFSVAEEYQWL-NDNASDGAVVTFVGKVRDMNDNVTGLTLEHYPGMTEKSLEEICNDAKTRWPLGKVRVIHRVGALNLGDQIVFVGVSSAHRKAAFDACEFIMDFLKTRAPFWKKEKLVDDERWIEARDSDDEAANRW.... 146
49 1.000e-80gi|491624876|ref|WP_005482416.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio parahaemolyticus]  clstr ali  40  4.RVSVQVEDFSVDQEYQRLSEG-TASGAVVTFIGKVRDMNDNVIGLHLEHYPGMTEKSLSDICDEAEARWPLLGVRVIHRVGDMDSGDQIVFVGVSSAHRGAAFDACEFIMDYLKTKAPFWKKERTTNEDRWIESRDTDHQAARRWEN.. 151
51 1.000e-80gi|494074662|ref|WP_007016718.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bermanella marisrubri]  clstr ali  34  4..IAVQEADFDIAQEYQAMRQDNPNDGAIVFFTGLVRDFNQGVTGLFLEHYPGMTEKSLENIVEQAKQRWPINRVSLIHRIGQLHISDQIVFVSASSPHREAAFDACRFIMDYLKHEAPFWKKETTQEGDRWVKANQKDKDALKKW.... 149
54 2.000e-80gi|519208746|gb|EPM92880.1| molybdenum cofactor biosynthesis protein E [Pseudomonas syringae pv. actinidiae ICMP 19070]  clstr ali  44  1MTIRVQAAAFDPGTEVNALHAANLGIGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALAKIVEEAEQRWPLLRLDVLHRVGALEPGEPIVFVGVASAHRQAAFEACDFVMDYLKTRAPFWKKENTSQGPQWVEGRDSDQAA........ 144
61 3.000e-80JGI.Meta 7062523745 SRS017227_Baylor_scaffold_27253__gene_31941 moaE protein [Human Supragingival plaque microbiome from visit number 1 of s  ali  42  54..VCVQTGDFDVGAELRRLQRLTLETGGVASFVGYVRDTNQGIGGLTLEHYPGMTERSLERICAQAEARWPLLGVTVIHRVGPLAPGDQIVLVATASRHRDAAFESCRFIMDYLKTEAPFWKKESTPDGERWVDARDSDEAARRRWEQG. 202
64 3.000e-80gi|493273383|ref|WP_006231194.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium profundum]  clstr ali  38  1.MISVQFDDFSVAEEYALLSEG-TDAGAVVTFIGKVRDFNDDVTGLSLEHYPGMTEKSLEEIVVQARERWPLLKTRVIHRVGDLGLGDQIVFVGVTSAHRGAAFEACEFIMDFLKTRAPFWKKEQTSNETRWVDARDTDTSAADRWQNK. 149
70 5.000e-80gi|504859354|ref|WP_015046456.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Simiduia agarivorans]  clstr ali  40  5..IAVQTEDFDHTSLYQRLLSDTPEIGAIVTFTGLVRDLNDAVAGLFLEHYPGMTEKSLQAIVDEARQRWPIMRVELIHRVGQLAPADQIVYVGVSASHRGDAFAACEFIMDYLKTRAPFWKREATPEGDRWVDARDSDHQAATRWK... 151
118 4.000e-78gi|500842046|ref|WP_012005758.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia proteamaculans]  clstr ali  42  6.RIRVGEAPFNVGEEYQWL-AQCDDDGAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALAEIVDEARSRWPLQRATVIHRVGELFPGDEIVFVGVTSAHRSMAFEASEFIMDYLKTRAPFWKREAVGQGDRWVDARDSDRQAAERWHK.. 153
121 5.000e-78gi|516713441|ref|WP_018059390.1| molybdenum cofactor biosynthesis protein MoaE [Oxalobacteraceae bacterium JGI 0001004-K23]  clstr ali  41  4..VRVQTADFDVSAELAALRAGDARVGALVTFVGTVRDMNEGVAEMELEHYPGMTERAIETIVEQARARWPLFAALVIHRVGPLKPMEQIVLVACTAAHRGEAFAACEFIIDYLKTEAPFWKKEQTPDGARWVDARVSDDQALRKWS... 150
124 6.000e-78gi|495318206|ref|WP_008042953.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Reinekea blandensis]  clstr ali  38  4..IRVQQDDFSVQREYDGLCRENTDDGAVVFFVGRVRDLNEGVTGMFLEHYPGMTEKTLQSIADEARHRWPLNRIRIVHRVGALNPSDQIVFVGVSSPHRGAAFDGAQYIMDFLKTRAPFWKKESTPEGDRWVDARSSDTEQENRW.... 149
134 1.000e-77gi|498913082|ref|WP_010848258.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus nematophila]  clstr ali  40  5.RIRVQRERFHVGDEYQWLSQCD-EDGAVVTFTGKVRNHNDNVNALTLEHYPGMTEKMLQKIADEARQRWPVQRITIIHRIGELYPGDEIVFVGVTSSHRNMAFTAAEFMMDYLKTKAPFWKKESLAEGERWVEIKQHDQEAANRWQS.. 152
164 4.000e-77gi|490543038|ref|WP_004408162.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio nigripulchritudo]  clstr ali  36  4..VSVQKEDFSLADEYD-VLAQGTSSGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLESLCEQAKQRWSIENIRVIHRVGDLDIGDQIVFVGVSSAHRGDAFNACEFVMDYLKTQAPFWKKERTTDSVRWVESRESDAAAASRWAEQG 152
201 2.000e-76gi|498123029|ref|WP_010437185.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio cyclitrophicus]  clstr ali  38  10.RVVVTAEDFSVGDEYDYLAQG-TAAGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLSEICDQAEARWPIEKMRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFVMDFLKTKAPFWKKERTTETTRWVDSRDSDAKAAERWEK.. 157
208 3.000e-76gi|503874917|ref|WP_014108911.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Glaciecola nitratireducens]  clstr ali  35  8..ISVQEQDFDLALEYTQIRKHSDSDGAIVTFTGLVRELTGNLKYMTLEHYPGMTEKSLMNICEQARERWPIGSIRIIHRIGKLPPDEQIVFVGVSSKHRKAAFAATEFMMDFLKTQAPFWKKELTTEGEFWVDAKSSDKHKANDW.... 153
211 5.000e-76gi|490355923|ref|WP_004235696.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Morganella morganii]  clstr ali  45  5.RIAVQTDNFSVGEEYQWL-AGCADDGAVVTFTGKVRNHNDNVAALSLEHYPGMTEKALADIVTQARERWELQRVTLIHRVGSLYPNDEIVFVGVSAAHRGMAFEAAEFLMDYLKTRAPFWKKETLPEGTRWVDARESDQKAADRW.... 151
215 6.000e-76gi|653020989|ref|WP_027272890.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Leminorella grimontii]  clstr ali  42  7.RIVVGAAPFSVGEEYQWLSQCD-DDGAVVTFTGKVRNHNDSVSALTLEHYPGMTEKSLAEIVVAARERWPLQRVSVNHRVGELFPGDEIVFVGVTSAHRGSAFDAAEFIMDYLKTKAPFWKREATQEGDRWVESRDSDREAAERW.... 152
216 6.000e-76gi|506315285|ref|WP_015835060.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photorhabdus asymbiotica]  clstr ali  40  5.RIFVGLENFNVGDEYEWLSQCD-EDGAIVTFTGKVRNHNDRVSGLRLEHYPGMTEKVLRNIVVEARSRWPLQRISIIHRVGALYPGDEIVFVGVTSAHRSMAFDAAEFIMDYLKTKAPFWKKEFLPDGERWVESRESDQEAARRW.... 150
223 1.000e-75gi|488369995|ref|WP_002439380.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shimwellia blattae]  clstr ali  42  5.RIRVGHDGFSVGDEYQWLAQCDAD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKALAEIVASARERWPLQRVSVIHRTGELWPGDEIVFVGVTGAHRGSAFEAAEYIMDYLKTRAPFWKREKTADGDRWVDARESDQQAASRW.... 150
229 1.000e-75gi|500085621|ref|WP_011761634.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella amazonensis]  clstr ali  37  5.RILVQTADFSVPEEYQRIAADN-QDGAVVTFVGKVRDFNEGVSDLTLEHYPGMTEKVLDQIADQARERWPLNHLTIIHRVGTMHLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLETSDKGQGWVEARDADDQAAKAWEQ.. 152
233 2.000e-75gi|260219647|emb|CBA26492.1| Molybdopterin-converting factor subunit 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  40  10.RVRIQTEAFDLGLEISQLQAADPRVGAVCSFVGTVRDRNGSVQTLELEHYPGMTEKSIEAMVDAAFARFDIYGARVVHRVGVLQPTEGVVLVAVTSAHRGQSFQACEFIMDYLKTQAPFWKKETTPEGAHWVDARVSDDEALARWGITA 163
234 2.000e-75gi|497966771|ref|WP_010280927.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pectobacterium carotovorum]  clstr ali  45  5.RIRVGEENFNVGDEYQWL-AQCDEDGAVVTFTGKVRNHNKDVSALTLEHYPGMTEKALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDKQAAQRW.... 150
243 3.000e-75gi|499954843|ref|WP_011635577.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella frigidimarina]  clstr ali  37  8IVVRVHTEDFSVADEYA-LLACDKQDGAVVNFVGKVRDFNDGVTDLTLEHYPGMTESVLLQISQQACERWPLNKVTIIHRVGRLSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDTGAKWVEARDSDQQAAKMWQK.. 156
253 6.000e-75gi|500094461|ref|WP_011770468.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ingrahamii]  clstr ali  36  1.MIRVQTEDFNQQREYDRLREQS-SVGAVVTFTGLVRDFNQGVASLTLEHYPLMTEKSLAQIVMQAKQRWNILACTLIHRVGELKISEQIVFVGIATAHRQDAFAACEYIMDYLKTEAPFWKKECNSQGSYWVDARESDRSALNKWS... 148
264 1.000e-74gi|518446484|ref|WP_019616691.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ossibalaenae]  clstr ali  35  1.MIKVQSEDFNQQVEYDRLRKD-PSVGAVVTFSGLVRDINQGVSSLTLEHYPGMTESSLAEIVKQAESRWNIIDCTVIHRIGELQLLDQIVFVGIASLHRQDAFAACEFIMDYLKTQAPFWKKETNAQQESWVDARESDQEALNKW.... 147
268 1.000e-74gi|666602493|emb|CDH29830.1| molybdopterin converting factor, subunit 2 [Xenorhabdus bovienii str. Jollieti]  clstr ali  41  10....VQRERFNVGDEYQWLSQCD-DDGAVVTFTGKVRNYNDSVKALTLEHYPGMTEKMLQVIIDEARQRWPLQRISVIHRIGELYPGEEIVFVGVTSAHRSMAFTAAEFIMDYLKTRAPFWKKESLVEGERWVATRESDQEAAGRW.... 152
272 2.000e-74gi|503132351|ref|WP_013367012.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacter lignolyticus]  clstr ali  45  5.RIIVDTAAFDVGAEYRWL-AGRDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVEEARSRWPLGRVTLIHRIGEMWPGEEIVFVGVTSAHRSSAFAAGEFVMDYLKTRAPFWKREATPEGERWVDARDSDREAAERWQ... 151
292 4.000e-74gi|488369113|ref|WP_002438498.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Escherichia hermannii]  clstr ali  44  5.RIRVGHEGFSVGDEYQWL-ASCDEDGAVVTFTGKVRNHNESVSAMTLEHYPGMTEKALAEIVAEARQRWALQRVSVIHRIGELWPGDEIVFVGVTGAHRSQAFEAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDHQAAERW.... 150
293 4.000e-74gi|530669879|dbj|BAN68295.1| molybdopterin synthase catalytic subunit [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  42  4.RIAVQTEPFDLAEETARLSAGDATIGAVASFVGLVRGHNRDITTLILEHYPGMTEKALSRIVDAAAERWPLQAVTVIHRVGELRLGEPIVLVLTASAHRQAAFESCQFIMDILKTEAPFWKKERLPDGERWVDARESDSEAAARWLRD. 158
294 4.000e-74gi|503341713|ref|WP_013576374.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rahnella sp. Y9602]  clstr ali  44  6..IVVDAAPFSVGDEYNWL-AQSDADGAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALAEIVAKARTRWPLQRVSVYHRVGPMYPGDEIVFVGVTSAHRGMAFEANEFIMDHLKTRAPFWKREATEEGDRWVDARDSDKQAAARW.... 150
311 1.000e-73gi|497815607|ref|WP_010129763.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus sputorum]  clstr ali  37  6..IQVQEDNFDQNAIYQWLSAEH-SVGATTLFVGKVREMNDNVSGLYLEHYPAMTEKALQEIVAQARQRWDLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKRETTQEGERWIEGRESDQQAADKWE... 151
314 1.000e-73gi|495494509|ref|WP_008219168.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera nanhaiensis]  clstr ali  41  3IFVAVQSDDFCVASEYNELRRQS-GCGAIVTFSGLVRELSDNLHSMTLEHYPGMTEQALTAIAEQAQQRWQLGAVHLIHRVGTLKPHEQIVFVGIASPHRAAAFAACEFIMDYLKNRAPLWKKEHTSNGDYWVEAKTSDQHALTRWD... 149
315 1.000e-73gi|499513561|ref|WP_011200201.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [[Mannheimia] succiniciproducens]  clstr ali  35  15IKIAVQEAEFDQNSEYRWLSQSD-SVGASVIFVGKVRDLNDEVSSLYLEHYPAMTEKALNEIVDEAKSRWDIQRVVVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTKAPFWKKEKTDKGERWIESRDSDQQAAEKW.... 161
320 2.000e-73gi|501410404|ref|WP_012441970.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia tasmaniensis]  clstr ali  41  4.RIRVGDAPFSMGDEHRWLSASDLD-GAVVTFTGKVRNHNDDVNALTLEHYPGMTEKALAAIVAEARQRWAMQRVTIIHRIGELFPGDDIVLVGVSAVHRGAAFDAAEFIMDQLKTRAPFWKREATADGQRWVAARESDRHAAARWK... 150
327 2.000e-73gi|499148425|ref|WP_010861753.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Plesiomonas shigelloides]  clstr ali  39  7.RIRVSEDDFDIAAEYTWLNQDD-SCGAVVTFTGKVRNHSGSVNGLHLEHYPAMTDKALNDIISEARARWPLGRVSLIHRVGELGSGEQIVYVGVSSGHRLAAFAAAEFIMDYLKVRAPFWKKEQMPDGARWVEAKTSDQEAARRWQSE. 155
372 3.000e-72gi|517166714|ref|WP_018355532.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pasteurella pneumotropica]  clstr ali  36  4INISVQEAEFDQNEVYQWLSAQH-SVGAVVIFVGKVRDLNDDVSSLYLEHYPAMTEKALREIVFEAKQRWDIQRVAVIHRVGLLHTGDEIVLVGVSSAHRGNAYQANEFIMDYLKSKAPFWKKEQTKKGERWIESQDSDKKALEKW.... 150
379 4.000e-72gi|501020732|ref|WP_012073403.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Actinobacillus succinogenes]  clstr ali  34  4IRIAVQEAEFDQNAEYRWLSENH-SIGATTIFVGKVREMNDEVASLYLEHYPAMTEKALREIVEEAKQRWDIQRISVIHRVGLLQTGDPIVLVGVSSAHRGDAYAANEFIMDYLKTRAPFWKKEQTAQGERWLESRDSDHQAVGKWSRE. 153
380 4.000e-72gi|506352194|ref|WP_015871913.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Edwardsiella ictaluri]  clstr ali  43  6..IVVSAAPFSVAEQYQWL-AQRDEDGAVVTFSGKVRNHNDDVSALTLEHYPGMTEKALAEIVALARRRWPLGRIAVYHRVGPMFPGEEIVFVGVTSAHRGMAFEAAEFIMDYLKTRAPFWKRETSEGADRWVDARDSDRQAAERW.... 150
385 5.000e-72gi|518504281|ref|WP_019674488.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera perlucida]  clstr ali  43  3IFVAVQSDDFCLASEYSELRR-NAACGAIVTFSGLVRELHDTVHGMTLEHYPGMTEQALTQIATDALNHWQLAAVHVIHRVGRLKPNEQIVFVGVASAHRPAAFAACEFIMDYLKNRAPFWKKEHTAEGDYWVEAKASDQHALARWE... 149
389 5.000e-72gi|653000343|ref|WP_027252547.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium halotolerans]  clstr ali  39  4.RIVVGPKPFDTQAEYNWL-AGDDQDGAVVTFHGKVRNLGDDVSKLALEHYPGMTEKALRDIIEQARQRWTLNRVTIIHRVGELGAGEDIVMVGVSSAHRNNAFAAAEFMMDILKTQAPFWKRESTPDGERWLDARDSDHQAVKRW.... 149
391 6.000e-72JGI.Meta 7070023873 SRS047634_LANL_scaffold_56701__gene_65197 moaE protein [Human Supragingival plaque microbiome from visit number 2 of sub  ali  36  10..IAVQEQPFDQNAVYLWLSESH-SVGASVIFVGKVRDLNDGVSSLYLEHYPAMTAKALRDIVTEAKSRWDIQRVAVIHRIGLLHTGDEIVLVGVSSAHRGDAYSANEFIMDYLKTKAPFWKKEQTDKGERWIESRDSDKQAADKW.... 154
394 7.000e-72gi|491430314|ref|WP_005288109.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Edwardsiella tarda]  clstr ali  41  5.RIVVNTAHFAVADEYSWL-AQCDEDGAVVTFTGKVRNHNDDVSALTLEHYPGMTEKALAQIVEQARARWPLGRVSVYHRIGPMQPGEEIVFVGVTSAHRGMAFQAAEFIMDYLKTRAPFWKREASNGHERWVDARDSDRQAAERW.... 150
398 8.000e-72gi|491889064|ref|WP_005654170.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus influenzae]  clstr ali  36  4IQIAVQEQSFDQNAVYQWLSELH-SVGATVIFVGKVRDLNDAVSSLYLEHYPAMTEKALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALEKW.... 150
400 9.000e-72gi|692294329|ref|WP_032115349.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Arsenophonus endosymbiont of Nilaparvata lugens]  clstr ali  41  5.RLLIQQANFNVGEQYEWL-AQCYDDGAVVTFTGKVRNHNDSINTLTLEHYPVMTEKALQDIANEARGRWQLQRICIIHRIGTLQPGEEIVFVGVTSDHRSSAFLAAEFIMDYMKTKAPFWKKEHLAQGSRWVEARASDQAAFQRW.... 152
401 9.000e-72gi|692175163|ref|WP_032093858.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Necropsobacter rosorum]  clstr ali  38  6..IAVQPQPFDQNAVYQWLAAPD-SVGAAVVFVGKVRDLNDPVSTLYLEHYPAMTEKALKDIVAQAKRRWTIQRVSVIHRVGLLHTGDEIVLVGVSAAHRGDAYHANEFIMDYLKSNAPFWKKERTDKGERWIEQRKSDNDALKKWQQ.. 152
405 1.000e-71gi|491992601|ref|WP_005709952.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus paraphrohaemolyticus]  clstr ali  35  6..VKVQTEPFDQNEVYHWLSE-HHSVGATTIFVGKVREMNDDVSGLYLEHYPAMTEKSLHEIVEEARSRWELQRIAVIHRIGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTNHGERWIEGRDSDQQAAVKW.... 150
417 2.000e-71gi|493005383|ref|WP_006086549.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella baltica]  clstr ali  38  7..VRVQEVDFSVADEYRQLAQDDSD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTEAVLEQIVVEARSRWPLNKVTVIHRVGTMALGEQIVFIGVTSAHRKGAFAACEFLIDFLKTKAPFWKLEAGEQGKSWVEAKDADEQAAELWQ... 152
423 3.000e-71JGI.Meta 7012385415 SRS024289_LANL_scaffold_19784__gene_24256 moaE protein [Human Supragingival plaque microbiome from visit number 2 of sub  ali  36  6..ISVQEAEFDQNAVYHWLSESH-SVGATVIFVGKVRDLNDDVSSLYLEHYPAMTEKALQEIISEAQSRWNIQRVSVIHRVGLLHTGDEIVLVGISSAHRGDAYHANEFIMDYLKSKAPFWKKEQTNKGERWIEARDSDKEALKKW.... 150
424 3.000e-71gi|446467347|ref|WP_000545201.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Salmonella enterica]  clstr ali  46  5.RIVVGPAPFSVGEEYSWL-AARDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGARWVEARDSDQQSAKRW.... 164
430 3.000e-71gi|516742628|ref|WP_018077462.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  47  1MKIVIQCEAFDLGAEVDAMRRGRTGIGAIASFIGLARDCNEGVHAMTLEHYPGMTEKALAALVDEANSRWTLLDVTVIHRIGRLLPGDPIVLVAVASQHRGEAFAACEFIMDYLKTQAPFWKKEATPEGERWV................. 135
433 4.000e-71gi|494452462|ref|WP_007243365.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus pittmaniae]  clstr ali  36  4IQIAVQSQTFDQNAVYQWLSESH-SIGASVIFVGKVRDLNDNVSSLFLEHYPAMTEKALREIVEEACSRWQLERVSVIHRVGLLHTGDEIVLVGTASAHRGDAYAANEFIMDFLKSKAPFWKKEQTDQGERWIEARDSDKQALTKW.... 150
438 5.000e-71gi|502358598|ref|WP_012771500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Aggregatibacter aphrophilus]  clstr ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGASVIFVGKVRDLNDKVSSLYLEHYPAMTHKALLDIAQQAKVRWDLQKISIIHRVGQLNTGDEIVLVGTSSAHRGDAYHANEFIMDYLKTQAPFWKKEQTTKGERWIEGRDSDYVAAEKWK... 151
444 6.000e-71gi|516416876|ref|WP_017806274.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Avibacterium paragallinarum]  clstr ali  34  4IQIAVQSEPFDQNAVYRWVAEPH-SVGAAVIFVGKVREMNDNVSSLFLEHYPAMTEKALREIVEEACQRWQLLRIAVIHRVGLLYTGDEIVLVAVSSPHRGEAYQANEFIMDFLKSKAPFWKKEQTENGERWVEHRESDSAALRKW.... 150
450 8.000e-71gi|503512715|ref|WP_013747234.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Gallibacterium anatis]  clstr ali  38  4IEISVQTEPFDQNAIYQW-SSASAESGATVIFVGKVRDMNDNVSGLYLEHYPAMTEKALREIAEQAAQRWQLQRIYIVHRVGQLYTGDEIVAVAVSSAHRGSAYQANEFIMDFLKTKAPFWKKETTKSGDRWLDSRESDQQAAHRWE... 151
458 1.000e-70JGI.Meta 7030754592 C3544874__gene_274945 moaE protein [Human Supragingival plaque microbiome from visit number 2 of subject 159510762]  ali  34  4IRIAVQEAEFDQNAVYHWLSEQN-SVGAAVIFVGKVRELNDDVSSLYLEHYPAMTEKALKEIVAEAKQRWEIQRVAVIHRVGLLQTGDEIVLVGVSSSHRGEAYRANEFIMDFLKSKAPFWKKEQTDKGERWIDARTSDKQALEKW.... 150
464 2.000e-70gi|655050101|ref|WP_028498682.1| molybdenum cofactor biosynthesis protein MoaE [Microvirgula aerodenitrificans]  clstr ali  40  5..IRVSHDDFDTAAEIARYQ--RPGIGAVTAFVGLVRDFGDGVVALELEHYPGMTESELAAIIDDAGRRWPLDGVTVIHRVGRLELSERIVLVVTASAHRRAAFEGCEFVMDWLKTRAPFWKREWGADGSRWVDAKDSDDSATARWE... 150
467 2.000e-70gi|499247710|ref|WP_010945250.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus ducreyi]  clstr ali  35  6..IEVQQAPFDQHAIYQWLSEPH-SVGATTIFVGKVREMNDNVSGLYLEHYPAMTKKALQEIVNQARQRWELQRIAVIHRIGQLHTGDEIVLVGVSSAHRGDAYLANEFIMDYLKTKAPFWKRETTAEGERWIESRESDEQQLEKW.... 150
470 2.000e-70gi|497290896|ref|WP_009605113.1| molybdenum cofactor biosynthesis protein MoaE [SAR116 cluster alpha proteobacterium HIMB100]  clstr ali  41  4..ITITTDNFNAGDEIEALR--LAGVGAIVTFTGIVRDKAEDLTAMTLEHFPGMTEQEIQAIIDEARTRWPLQGVRVIHRVGRLLPQENIVFVGTASAHRQAAFDSASFIMDYLKTKAPFWKKEETPAGASWVEARDCDDKALEKWQ... 148
477 3.000e-70JGI.Meta 7062616834 SRS017227_Baylor_scaffold_97884__gene_125030 moaE protein [Human Supragingival plaque microbiome from visit number 1 of  ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGATVMFVGKVRDMNDEVSSLYLEHYPAMTHKALMDIAQQAKVRWDLQKISIIHRVGELNTGDEIVLVGTASAHRGDAYHANEFIMDYLKNQAPFWKKEQTEKGERWIEGRDSDYAAADKWK... 151
480 3.000e-70gi|501463678|ref|WP_012487123.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Cellvibrio japonicus]  clstr ali  40  4.SIAVQEADFDVGTEYQALIVGDTRAGAHVLFVGRVRDMNMEVQGLFLEHYPGMTEQVLQSLVDDARKRWELLGVRLIHRVGYLRPGDQIVLVATSSAHRAHAFEAAEFLMDLLKTKAPFWKKEHSSGGAVWLESRAQDNEAGKRW.... 150
491 8.000e-70gi|506298013|ref|WP_015817788.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Teredinibacter turnerae]  clstr ali  36  1.MIRVQQADFDVAGEYRNLQQ-HGLAGAIVTFSGLVRDFAGDTSRFFLQHYPGMTESVLNKIVSQAQSRWPLLAVTVIHRVGHLQAGDQIVFVGVSSAHRKSAFAACEYIIDLLKTEAPFWKKE----GRQWVDAKQSDQAAADRW.... 141
498 1.000e-69gi|652476222|ref|WP_026870909.1| molybdenum cofactor biosynthesis protein MoaE [Inquilinus limosus]  clstr ali  48  1MTVRVQEADFDPGAEIAALSDGRTDVGGVACFVGLVRDIASGVRAMTLEHYPGMTERQLAEIEAEARDRWPLLEVRIVHRIGRLEPGDRIMFCGVASAHRGAAFEACAFLMDWLKTQAPFWKKEETPEGERWV................. 135
512 2.000e-69gi|492137317|ref|WP_005759086.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pasteurella bettyae]  clstr ali  36  4VKIAVHEAEFDQNAEYRWLSEPN-SVGAAVVFVGKVRDLNDEVSSLYLEHYPVMTEKALREIVDEAIQRWQLQRVSVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKSKAPFWKKEQTDKGERWIEARHSDKEALEKW.... 150