current user: public

anford Burnham Prebys Medical Discovery Institute

Query: ACL93483.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
33 4.000e-84JGI.Meta 7062523745 SRS017227_Baylor_scaffold_27253__gene_31941 moaE protein [Human Supragingival plaque microbiome from visit number 1 of s  ali  42  53.HVCVQTGDFDVGAELRRLQRLTLETGGVASFVGYVRDQGDTIGGLTLEHYPGMTERSLERICAQAEARWPLLGVTVIHRVGPLAPGDQIVLVATASRHRDAAFESCRFIMDYLKTEAPFWKKESTPDGERWVDARDSDEAARRRWEQ.. 201
41 6.000e-84gi|740705228|ref|WP_038490517.1| molybdenum cofactor biosynthesis protein MoaE [Janthinobacterium agaricidamnosum]  clstr ali  43  4..VRIQTDDFDLSSEVARLRAGQPQVGAVVTFVGTVRDMNDGVSEMELEHYPGMTEQAITAIVEQAKQRWPLYGALVIHRVGPLKPLEQIVLVATSAAHRGEAFAACEFIIDYLKTEAPFWKKEQTPQGARWVDARVSDDIALSKW.... 149
52 2.000e-83gi|515528283|ref|WP_016961500.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio norvegicus]  clstr ali  40  1.MISVQHEDFSLAEEYQRLN-DSDSDGAIVTFIGKVRDMGDNVTGLTLEHYPGMTEKSLNEIVLQAKQRWPLTHIRVIHRVGALNIGDQIVFVGVTSAHRNAAFEACEFIMDYLKTRAPFWKKERLNDDERWVEARESDDTAANRW.... 146
61 3.000e-83gi|519208746|gb|EPM92880.1| molybdenum cofactor biosynthesis protein E [Pseudomonas syringae pv. actinidiae ICMP 19070]  clstr ali  44  1MTIRVQAAAFDPGTEVNALHAANLGIGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALAKIVEEAEQRWPLLRLDVLHRVGALEPGEPIVFVGVASAHRQAAFEACDFVMDYLKTRAPFWKKENTSQGPQWVEGRDSDQAA........ 144
77 9.000e-83gi|515577318|ref|WP_017010076.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterovibrio calviensis]  clstr ali  40  1.MISVQRDDFSVAEEYQWLN-DNASDGAVVTFVGKVRDMGDNVTGLTLEHYPGMTEKSLEEICNDAKTRWPLGKVRVIHRVGALNLGDQIVFVGVSSAHRKAAFDACEFIMDFLKTRAPFWKKEKLVDDERWIEARDSDDEAANRW.... 146
102 4.000e-82gi|491624876|ref|WP_005482416.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio parahaemolyticus]  clstr ali  39  4.RVSVQVEDFSVDQEYQRLSEG-TASGAVVTFIGKVRDMGDNVIGLHLEHYPGMTEKSLSDICDEAEARWPLLGVRVIHRVGDMDSGDQIVFVGVSSAHRGAAFDACEFIMDYLKTKAPFWKKERTTNEDRWIESRDTDHQAARRWENR. 152
105 5.000e-82gi|493273383|ref|WP_006231194.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photobacterium profundum]  clstr ali  38  1.MISVQFDDFSVAEEYALLSEG-TDAGAVVTFIGKVRDFGDDVTGLSLEHYPGMTEKSLEEIVVQARERWPLLKTRVIHRVGDLGLGDQIVFVGVTSAHRGAAFEACEFIMDFLKTRAPFWKKEQTSNETRWVDARDTDTSAADRWQNK. 149
128 2.000e-81gi|494074662|ref|WP_007016718.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bermanella marisrubri]  clstr ali  34  3.KIAVQEADFDIAQEYQAMRQDNPNDGAIVFFTGLVRDFNQGVTGLFLEHYPGMTEKSLENIVEQAKQRWPINRVSLIHRIGQLHISDQIVFVSASSPHREAAFDACRFIMDYLKHEAPFWKKETTQEGDRWVKANQKDKDALKKW.... 149
130 2.000e-81gi|515789778|ref|WP_017222196.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Moritella dasanensis]  clstr ali  39  5.SIQIQTEDFDLATEYAALGQSH-STGAIVTFIGKVRDFGDNVSGLTLEHYPGMTEKSLAKILVEAETRWSIQGVKVIHRIGELALGDQIVFVGVASMHRGDAFQACEFIMDYLKTQAPFWKKEATEDGSHWVDARETDTTAADRWK... 151
143 5.000e-81gi|344226424|gb|EGV52760.1| molybdopterin synthase catalytic subunit [endosymbiont of Riftia pachyptila (vent Ph05)]  clstr ali  41  6..IRVQSEPFDPNVEVDLLRNHSPSIGGVVSFIGQVRDFNDDVLAMTLEHYPGMTEKALAAIVDEANARWELMGVRVVHRVGRMLPKDPIVLVAVASSHRGEAFQACEFIIDYLKTRAPFWKREESVEGARWVDARESDDHAEARWK... 152
164 2.000e-80gi|334731119|gb|AEG93495.1| Candidate molybdopterin converting factor subunit 2 (MPT synthase subunit 2) [Ramlibacter tataouinensis TTB310]  clstr ali  40  6.RVVIQEQDFDLSAEVAALRGRDTGVGAVCCFVGTVRDRNDGVSTLELEHYPGMTEKAIEAMIDEAMRRFDIRAARVVHRIGPLQPQEQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEQTPTGARWVDARVSDDAALARWGIAS 156
195 6.000e-80gi|736862803|ref|WP_034862641.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacteriaceae bacterium B14]  clstr ali  42  5.RISVQQAAFDVGEEYRWL-AECDDDGAIVTFTGKVRNHGDNVSALTLEHYPGMTEKAMENIVAEARQRWPLQRVTLIHRIGELFPGDEIVFVGTTSAHRSASFEAAEFMMDYLKTQAPFWKREAIPEGDRWVESRDSDQKAAERW.... 150
216 2.000e-79gi|739091001|ref|WP_036961964.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Providencia alcalifaciens]  clstr ali  41  5.HIAVQTENFSVGEQYSWLAQDSDSDGAVVTFTGKVRNHGDSVAALTLEHYPGMTEKALSDIVMQSRERWSLQRVSVIHRIGTLQPGEEIVFVGVTSAHRNAAFQAAEFIMDYLKTKAPFWKKESLPDNERWVEAKESDEASANRW.... 152
233 4.000e-79gi|495318206|ref|WP_008042953.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Reinekea blandensis]  clstr ali  38  4..IRVQQDDFSVQREYDGLCRENTDDGAVVFFVGRVRDEGDTVTGMFLEHYPGMTEKTLQSIADEARHRWPLNRIRIVHRVGALNPSDQIVFVGVSSPHRGAAFDGAQYIMDFLKTRAPFWKKESTPEGDRWVDARSSDTEQENRW.... 149
242 5.000e-79gi|490543038|ref|WP_004408162.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio nigripulchritudo]  clstr ali  36  4..VSVQKEDFSLADEYDVLAQG-TSSGAVVTFVGKVRDMGDNVIGLSLEHYPGMTEKSLESLCEQAKQRWSIENIRVIHRVGDLDIGDQIVFVGVSSAHRGDAFNACEFVMDYLKTQAPFWKKERTTDSVRWVESRESDAAAASRWAEQG 152
243 5.000e-79gi|971094447|emb|CRI65042.1| Molybdopterin-converting factor subunit 2 (MPT synthase subunit 2) (Molybdopterin synthase subunit 2) (Molybdenum cofact  clstr ali  40  3.RIRVQRDLFDIAEEQKILSRDKPQVGAVVTFIGLMRDINEGVAAMTLEHYPGMTEKALGAIAEEAAQRWDLEDISILHRVGELRPQDPIVFVGVSSRHRGDAFSACEFLIDYLKTRAPFWKKEQTAQGERWVDARVTDDEAARRWAEVS 153
252 8.000e-79gi|847180396|ref|WP_047964557.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus khoisanae]  clstr ali  41  5.RISVQREIFNVGDEYQWLSQCDED-GAVVTFTGKVRNHGDNVKALTLEHYPGMTEKMLRTIADEARQRWSLQRISIIHRVGELYPGDEIVFVGVTSSHRSMAFTAAEFIMDYLKTKAPFWKKESLTKGERWVETRKSDEDAANRW.... 150
264 1.000e-78gi|498913082|ref|WP_010848258.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus nematophila]  clstr ali  40  5.RIRVQRERFHVGDEYQWLSQCDED-GAVVTFTGKVRNHGDNVNALTLEHYPGMTEKMLQKIADEARQRWPVQRITIIHRIGELYPGDEIVFVGVTSSHRNMAFTAAEFMMDYLKTKAPFWKKESLAEGERWVEIKQHDQEAANRWQ... 151
266 1.000e-78gi|260219647|emb|CBA26492.1| Molybdopterin-converting factor subunit 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  40  10.RVRIQTEAFDLGLEISQLQAADPRVGAVCSFVGTVRDRNGSVQTLELEHYPGMTEKSIEAMVDAAFARFDIYGARVVHRVGVLQPTEGVVLVAVTSAHRGQSFQACEFIMDYLKTQAPFWKKETTPEGAHWVDARVSDDEALARWGITA 163
276 2.000e-78gi|927432505|emb|CRN09511.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Bathymodiolus azoricus thioautotrophic gill symbiont]  clstr ali  36  3.KIVVQEKDFDLSTEVALAQANDGNIGAVVSFVGLVRDLNDPIQKMTLEHYPGMTEKALQSIVDKARNQWSIGNITIIHRVGDLAVNDQIVLVVTTSKHRKNAFDACEFIMDYLKTQAPFWKKEVSKEGGKWVEAKDSDQDRIK...... 146
283 3.000e-78JGI.Meta 7008186891 SRS065099_LANL_scaffold_75854__gene_134260 moaE protein [Human Supragingival plaque microbiome from visit number 2 of su  ali  42  5..IHVQTQDFDVGAELKRXXXXXREVGAVASFVGYVRDQGDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRPRAAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQ... 161
293 4.000e-78gi|502353039|ref|WP_012770224.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Dickeya chrysanthemi]  clstr ali  41  4.RIRVGQEPFSVGDEYAWL-ATSDMDGAVVTFTGKVRNHGDHVSALTLEHYPGMTEKALAEIVDDARQRWPIQRVSLIHRVGALFPGDEIVFVGVSGAHRQASFDAAQFIMDYLKTRAPFWKREATSDGDRWVDARDSDRQAAERWS... 150
297 5.000e-78gi|740429516|ref|WP_038262025.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus cabanillasii]  clstr ali  42  5.RICVQKEMFNVGAEYQWLAQCDED-GAVVTFTGKVRNHGDDVRALILEHYPGMTENMLQKIADEARQRWRLQRINIIHRIGKLYPGDEIVFVGVTSTHRSMAFAAAEFLMDYLKTQAPFWKKEFLNDGERWVEAKESDREAASRW.... 150
302 6.000e-78gi|898313839|ref|WP_049583484.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photorhabdus luminescens]  clstr ali  41  5.RIFVGPENFNVEDEYQWLAQCDED-GAIVTFTGKVRNHGDNVGALRLEHYPGMTEKTLQRIVTEARSRWPLQRISVVHRVGTLSPGDQIVFVGVTGAHRHMAFEAAEFIMDYLKTQAPFWKKEFLPDGERWVESRESDQEAAKRWS... 151
309 7.000e-78gi|490355923|ref|WP_004235696.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Morganella morganii]  clstr ali  45  5.RIAVQTDNFSVGEEYQWL-AGCADDGAVVTFTGKVRNHGDNVAALSLEHYPGMTEKALADIVTQARERWELQRVTLIHRVGSLYPNDEIVFVGVSAAHRGMAFEAAEFLMDYLKTRAPFWKKETLPEGTRWVDARESDQKAADRW.... 151
321 1.000e-77gi|488369995|ref|WP_002439380.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shimwellia blattae]  clstr ali  42  5.RIRVGHDGFSVGDEYQWLAQCDAD-GAVVTFTGKVRNHGDSVSALTLEHYPGMTEKALAEIVASARERWPLQRVSVIHRTGELWPGDEIVFVGVTGAHRGSAFEAAEYIMDYLKTRAPFWKREKTADGDRWVDARESDQQAASRW.... 150
325 1.000e-77gi|503874917|ref|WP_014108911.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Glaciecola nitratireducens]  clstr ali  36  8..ISVQEQDFDLALEYTQIRKHSDSDGAIVTFTGLVREERGNLKYMTLEHYPGMTEKSLMNICEQARERWPIGSIRIIHRIGKLPPDEQIVFVGVSSKHRKAAFAATEFMMDFLKTQAPFWKKELTTEGEFWVDAKSSDKHKANDW.... 153
330 2.000e-77gi|931447893|gb|KPK31975.1| molybdenum cofactor biosynthesis protein MoaE [Betaproteobacteria bacterium SG8_40]  clstr ali  46  1MPVRVQHEDFDVGAEIAKLREGNPAIGAVASFVGIVRDEGDAVATLTLEHYPGMTEKSLEEIVAQARQRWDIYDALVVHRVGTLKPLDQIVLVVVTSAHRGESFEACEFLMDYLKTRAPFWKKEVTPEGARWV................. 135
331 2.000e-77gi|506315285|ref|WP_015835060.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Photorhabdus asymbiotica]  clstr ali  40  5.RIFVGLENFNVGDEYEWLSQCDED-GAIVTFTGKVRNHGDRVSGLRLEHYPGMTEKVLRNIVVEARSRWPLQRISIIHRVGALYPGDEIVFVGVTSAHRSMAFDAAEFIMDYLKTKAPFWKKEFLPDGERWVESRESDQEAARRW.... 150
333 2.000e-77gi|498123029|ref|WP_010437185.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Vibrio cyclitrophicus]  clstr ali  38  10.RVVVTAEDFSVGDEYDYLAQG-TAAGAVVTFVGKVRDMGDNVIGLSLEHYPGMTEKSLSEICDQAEARWPIEKMRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFVMDFLKTKAPFWKKERTTETTRWVDSRDSDAKAAERWEK.. 157
352 3.000e-77gi|497966771|ref|WP_010280927.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Pectobacterium carotovorum]  clstr ali  44  5.RIRVGEENFNVGDEYQWLAQCDED-GAVVTFTGKVRNHNKDVSALTLEHYPGMTEKALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDKQAAQRW.... 150
353 3.000e-77gi|518446484|ref|WP_019616691.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ossibalaenae]  clstr ali  34  1.MIKVQSEDFNQQVEYDRLRKD-PSVGAVVTFSGLVRDQGEQVSSLTLEHYPGMTESSLAEIVKQAESRWNIIDCTVIHRIGELQLLDQIVFVGIASLHRQDAFAACEFIMDYLKTQAPFWKKETNAQQEYWVDARESDQEALNKWTGK. 150
355 3.000e-77gi|893086759|emb|CNT65782.1| molybdopterin converting factor subunit 2 [Salmonella enterica subsp. enterica serovar Bovismorbificans]  clstr ali  46  91.RIVVGPAPFSVGEEYSWL-AARDEDGAVVTFTGKVRNHGDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGDRWVEARDSDQQLAKRW.... 236
366 4.000e-77gi|759380321|ref|WP_043107013.1| molybdenum cofactor biosynthesis protein MoaE [endosymbiont of unidentified scaly snail isolate Monju]  clstr ali  42  4.RIAVQTEPFDLAEETARLSAGDATIGAVASFVGLVRGHNRDITTLILEHYPGMTEKALSRIVDAAAERWPLQAVTVIHRVGELRLGEPIVLVLTASAHRQAAFESCQFIMDILKTEAPFWKKERLPDGERWVDARESDSEAAARWLRD. 158
370 5.000e-77gi|755039728|ref|WP_042392256.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Escherichia vulneris]  clstr ali  44  5.RIRVGHDPFSVGEEYTWL-AERDEDGAVVTFTGKVRNHGDSVRALTLEHYPGMTEKTLADIVQQARDRWPLGRITVVHRIGELWPGDEIVFVGVTSVHRGSAFAAGEYIMDYLKTRAPFWKREATEEGDRWVEARESDQQAAKRW.... 150
373 6.000e-77gi|499954843|ref|WP_011635577.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella frigidimarina]  clstr ali  37  8IVVRVHTEDFSVADEYALL-ACDKQDGAVVNFVGKVRDFNDGVTDLTLEHYPGMTESVLLQISQQACERWPLNKVTIIHRVGRLSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDTGAKWVEARDSDQQAAKMWQK.. 156
380 8.000e-77gi|503132351|ref|WP_013367012.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Enterobacter lignolyticus]  clstr ali  45  5.RIIVDTAAFDVGAEYRWL-AGRDEDGAVVTFTGKVRNHGDSVKALTLEHYPGMTEKALAEIVEEARSRWPLGRVTLIHRIGEMWPGEEIVFVGVTSAHRSSAFAAGEFVMDYLKTRAPFWKREATPEGERWVDARDSDREAAERWQ... 151
391 1.000e-76gi|500094461|ref|WP_011770468.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Psychromonas ingrahamii]  clstr ali  36  1.MIRVQTEDFNQQREYDRLREQS-SVGAVVTFTGLVRDFNQGVASLTLEHYPLMTEKSLAQIVMQAKQRWNILACTLIHRVGELKISEQIVFVGIATAHRQDAFAACEYIMDYLKTEAPFWKKECNSQGSYWVDARESDRSALNKWS... 148
396 2.000e-76gi|800930514|ref|WP_045959016.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Xenorhabdus poinarii]  clstr ali  40  5.RINVQREVFHVGEEYQWLSQGDEE-GAIVTFTGKVRHHGDSVHSLTLEHYPGMTEKQLQNIVDEARQRWPLQRVSVIHRVGELYPGDEIVFVGVTSSHRHRAFMAAEFIMDYLKTQAPFWKKESLAEGERWVETRQSDQEAINRWS... 153
410 2.000e-76gi|666602493|emb|CDH29830.1| molybdopterin converting factor, subunit 2 [Xenorhabdus bovienii str. Jollieti]  clstr ali  41  10....VQRERFNVGDEYQWLSQCD-DDGAVVTFTGKVRNLGDSVKALTLEHYPGMTEKMLQVIIDEARQRWPLQRISVIHRIGELYPGEEIVFVGVTSAHRSMAFTAAEFIMDYLKTRAPFWKKESLVEGERWVATRESDQEAAGRW.... 152
411 2.000e-76gi|829958249|ref|WP_047371187.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Kluyvera intermedia]  clstr ali  41  5.RIVVDHAAFNVGEEYQWLSE-RDEDGAVVTFTGKVRNHGDNVSALTLEHYPGMTEKTLAGIVEEARERWPLGNVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDFLKTRAPFWKREATAQGDRWVEARDSDKQAAQRW.... 150
412 3.000e-76gi|500085621|ref|WP_011761634.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella amazonensis]  clstr ali  37  5.RILVQTADFSVPEEYQRIAADN-QDGAVVTFVGKVRDFNEGVSDLTLEHYPGMTEKVLDQIADQARERWPLNHLTIIHRVGTMHLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLETSDKGQGWVEARDADDQAAKAWEQ.. 152
432 5.000e-76gi|495494509|ref|WP_008219168.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Rheinheimera nanhaiensis]  clstr ali  41  3IFVAVQSDDFCVASEYNELRRQS-GCGAIVTFSGLVRELSDNLHSMTLEHYPGMTEQALTAIAEQAQQRWQLGAVHLIHRVGTLKPHEQIVFVGIASPHRAAAFAACEFIMDYLKNRAPLWKKEHTSNGDYWVEAKTSDQHALTRWD... 149
466 2.000e-75gi|499148425|ref|WP_010861753.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Plesiomonas shigelloides]  clstr ali  39  7.RIRVSEDDFDIAAEYTWLNQDD-SCGAVVTFTGKVRNHSGSVNGLHLEHYPAMTDKALNDIISEARARWPLGRVSLIHRVGELGSGEQIVYVGVSSGHRLAAFAAAEFIMDYLKVRAPFWKKEQMPDGARWVEAKTSDQEAARRWQSE. 155
472 2.000e-75gi|516742628|ref|WP_018077462.1| molybdenum cofactor biosynthesis protein MoaE [Thiobacillus denitrificans]  clstr ali  48  1MKIVIQCEAFDLGAEVDAMRRGRTGIGAIASFIGLARDEGSGVHAMTLEHYPGMTEKALAALVDEANSRWTLLDVTVIHRIGRLLPGDPIVLVAVASQHRGEAFAACEFIMDYLKTQAPFWKKEATPEGERWV................. 135
488 3.000e-75gi|491950460|ref|WP_005687384.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Haemophilus influenzae]  clstr ali  36  4IQISVQEQPFDQNAVYQWLSAQH-SVGATVIFVGKVRDLGDTVSSLYLEHYPAMTEKALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALEKW.... 150
505 7.000e-75gi|499813836|ref|WP_011494570.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Shewanella denitrificans]  clstr ali  35  5VKIAVQEADFDHAQEYARIAQDN-NDGAVVTFCGKVRDFNEGITRLTLEHYPGMTESVLAQICQQALQRWSINHLTVIHRVGSLDLGEQIVFIGVSSAHRGDAFAACEYLIDFLKTKAPFWKLEATHQGERWLDARDTDEVAANTWQQ.. 153
507 7.000e-75gi|931420295|gb|KPK06688.1| molybdenum cofactor biosynthesis protein MoaE [Betaproteobacteria bacterium SG8_39]  clstr ali  42  1MKIAIQREDFDAGAEARALSAGNPAVGAVASFVGLVRDRNDGVATMTLEHYPGMTEKAIARIVDEARGRWQVIDCTVIHRIGELSPAEQIVLVAVASGHRGDAFAACEFIMDFLKTQAPFWKKEATPDGARWV................. 135
509 8.000e-75JCVI_PEP_1096678544949 /source_dna_id=JCVI_ORF_1096678544948 /offset=0 /translation_table=11 /length=155 /full_length=155