current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

CCNA.00016
Query: ACL93483.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# E-value Template Links and tools%idFirst MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARALELEAYPGFTDAAITEIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPFWKKEHGPEGPRWIEPTARDRTDAQRWDQEALast
1 3.000e-58gi|399519447|ref|ZP_10760242.1| molybdopterin synthase subunit MoaE [Pseudomonas pseudoalcaligenes CECT 5344]  clstr ali  46  22MTIRVQAQPFDPGTELNALHAANLGIGAVVTFVGYVRDFNEGVGGMFLEHFPGMTEKALAKIADEARERWPLLGIEIIHRIGRLEPGEPIVFVGTSSAHRQAAFDACNFIMDYLKTRAPFWKKEDTSEGPRWVEGRCSDQSAAERWK... 170
2 2.000e-57gi|398832754|ref|ZP_10590908.1| molybdopterin converting factor, large subunit [Herbaspirillum sp. YR522]  clstr ali  40  1MPVRVQTADFDLSTEVARLRLANPGVGAVVTFLGTVRDLNEGVSTLELEHYPAMTERALQQIVDQARARWPIFDALVIHRVGPMQPQEQIVLVAVTAPHRGEAFAACEFIMDYLKTQAPFWKKEQTPDGARWVDARESDDIARDKW.... 148
3 5.000e-57gi|152980396|ref|YP_001353006.1| molybdenum cofactor biosynthesis protein E [Janthinobacterium sp. Marseille]  clstr ali  41  1MPVRVQTENFDVSHEVAALRAHSPQVGAVVTFIGTVRDMNDGVAEMELEHYPGMTEKALQNIVEQAKARWPIFDALVIHRIGPLLPLEQIVLVAVTSAHRGEAFSACEFIIDYLKTDAPFWKKEQTPQGARWVDARTTDDTALAKWKQPS 152
4 5.000e-57gi|340787494|ref|YP_004752959.1| molybdopterin converting factor subunit 2 [Collimonas fungivorans Ter331]  clstr ali  36  3MPIRVQAEDFDFAAELAQLRLSNPKIGAVVSFLGTVRDLSDGVAQMELEHYPGMTEKALSAIIDQAKQRWEIFDALVIHRIGPLLPLDQIVLVAVSSAHRGDAFAACEYIIDYLKTEAPFWKKEHTEQGARWVDARSTDDEALAKWEQDA 154
5 9.000e-57gi|393778256|ref|ZP_10366535.1| molybdenum cofactor biosynthesis protein E [Ralstonia sp. PBA]  clstr ali  43  1MPIRVQTEDFDLGREIAALRAGSPQVGAVASFIGTVRDINDGVSAMELEHYPGMTEKALEQIVAAARQRWEIIDALVIHRVGPLRPLDQIVLVAVTSAHRGEAFAACEFIMDYLKSEAPFWKKEQTPAGARWVDARVSDDAALKRWGIE. 151
6 1.000e-56gi|374703706|ref|ZP_09710576.1| molybdopterin synthase subunit MoaE [Pseudomonas sp. S9]  clstr ali  44  1MSIRVQPDAFDPGDELSRLHAQNLGVGAVVTFVGYVRDFNEGVGGMFLEHFPGMTEKALGKIVDEATQRWPLLKVELIHRIGRLEPGEPIVFVGTSSAHREAAFEACAFIMDYLKTRAPFWKKEDTADGPRWVEGRCSDQQAAQRWKQD. 151
7 2.000e-56gi|94310900|ref|YP_584110.1| molybdopterin synthase, large subunit [Cupriavidus metallidurans CH34]  clstr ali  46  1MAVRVQHEDFDLGAEVAALRAGNPGVGAVASFIGTVRDVSEGVSTMELEHYPGMTEKALETIEAAARERWPLLGVTIVHRVGLLQPLDQIVLVAVSSAHRGAAFAACEFIMDYLKSEAPFWKKEDTPEGARWVDARVSDDAALRRWGIES 152
8 4.000e-56gi|399020497|ref|ZP_10722627.1| molybdopterin converting factor, large subunit [Herbaspirillum sp. CF444]  clstr ali  38  1MPIRVQTADFDLSAEIGALRLTNPKVGAVVSFVGTVRDLNDGVQEMELEHYPGMTEKALAQIVADAKARWEIFDALVIHRVGPLLPLDQIVLVAVTSKHRGEAFAACEFIMDYLKTQAPFWKKEQTPDGARWVDARESDDKAVSKWD... 149
9 5.000e-56gi|410663642|ref|YP_006916013.1| molybdopterin-converting factor subunit 2 MoaE [Simiduia agarivorans SA1 = DSM 21679]  clstr ali  40  4.HIAVQTEDFDHTSLYQRLLSDTPEIGAIVTFTGLVRDLNDAVAGLFLEHYPGMTEKSLQAIVDEARQRWPIMRVELIHRVGQLAPADQIVYVGVSASHRGDAFAACEFIMDYLKTRAPFWKREATPEGDRWVDARDSDHQAATRWK... 151
10 5.000e-56gi|374369791|ref|ZP_09627812.1| molybdopterin synthase subunit MoaE [Cupriavidus basilensis OR16]  clstr ali  45  1MSVRVQCEDFDLGAEVAALRHGQPGVGAVASFVGTVRDMNDGVSAMELEHYPGMTEKALARIEAVARERWALLGVTIVHRVGPLLPLDQIVLVAVASAHRGNAFAACEFIMDYLKSEAPFWKKEQTPDGARWVDARVTDESALARWGIRS 152
11 7.000e-56gi|395761757|ref|ZP_10442426.1| molybdenum cofactor biosynthesis protein E [Janthinobacterium sp. PAMC 25724]  clstr ali  41  3ISVRVQQADFDLGQEIAQLRAGNPKVGAVVGFVGTVRDMNDGVAAMELEHYPGMTEKAILAIVEQARARWPVSAALVIHRVGPLLPQEQIVLVAVSSAHRGEAFAACEFIIDYLKTEAPFWKKEDTPEGARWVDARDSDATALDKW.... 150
12 7.000e-56gi|94501722|ref|ZP_01308236.1| molybdenum cofactor biosynthesis protein E [Oceanobacter sp. RED65]  clstr ali  34  3.KIAVQEADFDIAQEYQAMRQDNPNDGAIVFFTGLVRDFNQGVTGLFLEHYPGMTEKSLENIVEQAKQRWPINRVSLIHRIGQLHISDQIVFVSASSPHREAAFDACRFIMDYLKHEAPFWKKETTQEGDRWVKANQKDKDALKKW.... 149
13 9.000e-56gi|429211940|ref|ZP_19203105.1| molybdopterin converting factor, large subunit [Pseudomonas sp. M1]  clstr ali  48  1MAVRVQESPFDPGAEVNALHAANVGIGAVVGFVGYVRDFNDGVGGMFLEHYPGMTERALEKIAGQARERWPLLRLEILHRIGRLEPGEPIVFVGTASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGPRWVEGRCSDQAAAQRWDK.. 150
14 9.000e-56gi|113868238|ref|YP_726727.1| molybdopterin biosynthesis protein E [Ralstonia eutropha H16]  clstr ali  47  1MSVRVQREDFDLGAEVAALRAGNPAVGAVASFIGTVRDVSDGVSAMELEHYPGMTEKALAQIEAAACARWALLGVTIIHRVGPMQPLDQIVMVAVASAHRGNAFAACEFIMDYLKSEAPFWKKEDTPEGARWVDARVTDEAALQRWGIAS 152
15 2.000e-55gi|421750158|ref|ZP_16187444.1| molybdopterin biosynthesis protein E [Cupriavidus necator HPC(L)]  clstr ali  46  1MSVRVQREDFDLGAEVAALRAGRPGVGAVASFIGTVRDVNDGVQAMELEHYPGMTEKALERIEAVARERWALDGVTIIHRVGPLQPQDQIVLVAVASAHRGNAFAACEFIMDYLKSEAPFWKKESTPDGARWVDARVTDEAALARWGVRS 152
16 2.000e-55JCVI_PEP_1096690520567 /source_dna_id=JCVI_ORF_1096690520566 /offset=0 /translation_table=11 /length=169 /full_length=169  ali  42  7..VQIQYEDFDLCREVAQLRQPDPGVGAVVSFLGTVRDRDEGISSLELEHYPGMTESAIQAMIDQARSRFDIRAVRIIHRIGVLNPQDQIVLVAVASAHRGQAFDACEFLMDYLKTQAPFWKKQSSPEGAAWVDARQSDDTAAHRWG... 154
17 3.000e-55gi|186475700|ref|YP_001857170.1| molybdopterin biosynthesis MoaE protein [Burkholderia phymatum STM815]  clstr ali  40  1MTVRVQTEDFDLSTEVAALRAQNPKVGAVACFVGTVRDINEGVETMELEHYPGMTEKSLEAIVDAARERWPGTEVLIVHRVGKLQPLDQIVLVATTSKHRGNAFASCEFVMDYLKTQAPFWKKEKTESGERWVDARVADEQALARWGLES 152
18 4.000e-55gi|37679386|ref|NP_933995.1| molybdenum cofactor biosynthesis protein E [Vibrio vulnificus YJ016]  clstr ali  39  4.RISVQVEDFDIAAEYAWLSQGS-AAGAIVTFVGKVRDMNDNVTGLSLEHYPGMTEKALGEICDQAEQRWPLLNVRVIHRVGDLNIGDQIVYVGVSSAHRGAAFEACEFIMDYLKTKAPFWKKERTTETTRWVESRESDAQAAERWQS.. 151
19 4.000e-55gi|171058703|ref|YP_001791052.1| molybdopterin biosynthesis MoaE protein [Leptothrix cholodnii SP-6]  clstr ali  43  5.RVTIQQADFDLSAEVAALRAGDGGVGAVASFIGTVRDRSDGVSAMELEHYPGMTERSIEAMIDTALQRFDIRAARVIHRVGLLQPQDQIVLVAVSSAHRGQAFQACEFLMDYLKTEAPFWKKETTPEGARWVDARVSDDDALRRWGIT. 154
20 4.000e-55gi|394988824|ref|ZP_10381659.1| molybdopterin synthase subunit MoaE [Sulfuricella denitrificans skB26]  clstr ali  41  1MEVRIQTEDFDLGAEILNLRRGNPGIGAVASFVGLVRDHSTTVTEMTLEHYPGMTEKALAEIMGEAKQRWNIIGALVIHRIGPLKPTDQIVLVAVSSAHRGDAFAACEFIMDYLKTRAPFWKKEQTEAGAHWVDARESDETAAQRW.... 148
21 4.000e-55gi|424070924|ref|ZP_17808352.1| molybdenum co factor biosynthesis protein E [Pseudomonas syringae pv. avellanae str. ISPaVe037]  clstr ali  45  2MSVRVQAAAFDPGTEVNALHAANLGIGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALAKIIAEAEQRWPLLRVDVLHRVGALEPGEPIVFVGVASAHRQAAFEACDFVMDYLKTRAPFWKRENTSEGTHWVEGRHSDHQAADRWK... 150
22 6.000e-55gi|365093658|ref|ZP_09330719.1| molybdopterin biosynthesis MoaE protein [Acidovorax sp. NO-1]  clstr ali  38  5.RVSIQTEDFDLSTEVAALRRENKGIGAVCSFIGTVRDRNEGVSSMELEHYPGMTEKSIEAMVDEAFRRFDIFGARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEETPQGARWVDARVSDDAALARWGITA 155
23 8.000e-55gi|388546215|ref|ZP_10149492.1| molybdopterin biosynthesis MoaE [Pseudomonas sp. M47T1]  clstr ali  46  1MGVRVQPDAFDPGAEVNAMHAANVGVGAVVSFVGYVRDFNDGVSGMCLEHYPGMTEKALGKIVIEAEQRWPLLKVEVLHRVGALEPGEPIVFVGVASAHRQAAFDACNFIMDYLKTRAPFWKKEQTGEGERWVEGKASDNQAADRWQ... 149
24 9.000e-55gi|330811541|ref|YP_004356003.1| molybdopterin converting factor subunit 2 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]  clstr ali  44  1MAIRVQVEPFDAGGEVNAMHAANVGVGAVVSFVGYVRDFNDGVSGMFLEHYPGMTEKALGKIATEAEQRWPLLKLEVLHRIGALEPGEPIVFVGAASAHRQAAFDACAFVMDYLKTRAPFWKKENTVDGPRWVEGRDSDHAAADRWKQ.. 150
25 9.000e-55gi|319943316|ref|ZP_08017599.1| molybdenum cofactor biosynthesis protein large subunit [Lautropia mirabilis ATCC 51599]  clstr ali  43  7.LIHVQTQDFDVGAELKRLQALTREVGAVASFVGYVRDSNDGVTGMTLEHYPGMTEKALADICQRAQTRWPLLGVTVIHRVGPLAPGEQIVLVAVASRHRDAAFEACRFIMDFLKTEAPFWKKEATTDGERWVDARDSDEAALSRWQ... 155
26 1.000e-54gi|239814843|ref|YP_002943753.1| molybdopterin biosynthesis MoaE protein [Variovorax paradoxus S110]  clstr ali  41  5.RVSIQTADFDLGQEVAALRAGDKRVGAVCSFVGTVRDRNDGVASMELEHYPGMTEKAIEAMIDEAHKRFDILGARVIHRVGLLQPLDQIMMVAVVSAHRGQSFEACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGITA 155
27 1.000e-54gi|70731086|ref|YP_260827.1| molybdopterin converting factor subunit 2 [Pseudomonas protegens Pf-5]  clstr ali  45  1MSIQVQTQALSLDQLNAGLQAGDASVGGVVTFIGYVRDLNEAVHSLFLEHYPGMTERSLQRIVEQAQARWPLNRVSLVHRVGLLQVGEPIVFVGVASAHRQAAFEACAFIMDYLKTRAPFWKREVTPTGERWIDGRESDRQAAERWGVE. 151
28 1.000e-54gi|334131974|ref|ZP_08505736.1| Molybdopterin-converting factor subunit 2 [Methyloversatilis universalis FAM5]  clstr ali  44  3VSVSVQQADFDIGAEIDALLAGRTDVGAVATFTGLVRDINDGVHAMTLEHYPGMTEAALEDIVAQAKARWDILAVRVIHRVGTLQPADRIVLVIVAGSHRGEAFSACEFIMDYLKTRAPFWKREDTPDGSRWVDARDSDDSAAQRWMQQG 154
29 1.000e-54Oral.Meta HOMD rpic_c_1_4823 Ralstonia pickettii 12D [1340111 - 1340656] molybdopterin biosynthesis MoaE protein  ali  43  10MSVRVQEADFDLGAEIAALRAGRPNIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALAGIVSAAMQRWELIDALVIHRVGKLKPQDQIVLVAVASKHRGESFAACEFIMDYLKSEAPFWKKEQTPQGARWVDARVTDDKALVRWGIAS 161
30 2.000e-54gi|171463222|ref|YP_001797335.1| molybdopterin biosynthesis MoaE protein [Polynucleobacter necessarius subsp. necessarius STIR1]  clstr ali  34  25MSIRIQEGDFDLSFEIASLRKGDPRVGAAVAFLGTVWDMNDGIKGMTLEHYPGMTEKSLQEILDQAKARWDIYHTLVIHRIGSLLPEDQIVLVAVTSAHRGEAFAACEFIMDYLKTAAPFWKKEDTPDGARWVDARVTDEAAMARWKKT. 175
31 2.000e-54gi|308051426|ref|YP_003914992.1| molybdopterin synthase subunit MoaE [Ferrimonas balearica DSM 9799]  clstr ali  37  1.MIAVQTQDFSVADEYAKL-ADNPGCGAVVTFVGKVRDFSRGVSAMTLEHYPGMTEAVLHQIEAEARQRWPLDEVTIIHRVGELQLCDQIVFIGVSSAHRKAAFAACEFLIDFLKTRAPFWKKETSDDGTVWVDAKDADQQAAEQWQR.. 148
32 2.000e-54gi|372488796|ref|YP_005028361.1| molybdopterin converting factor, large subunit [Dechlorosoma suillum PS]  clstr ali  42  1MSVRVQQEDFDLSAEVAALRAGQPGVGAVAAFVGLVRDMNEGVSEMALEHYPGMTEKALEAIVAEARARWDILGARIIHRVGTLQPCDQIVLVAVSSAHRGEAFAACEFIMDYLKTRAPFWKREVTPAGARWVDARETDDSAAARWEK.. 150
33 2.000e-54gi|90411675|ref|ZP_01219685.1| putative molybdenum cofactor biosynthesis protein E [Photobacterium profundum 3TCK]  clstr ali  38  1.MISVQFDDFSVAEEYALLSEGTD-AGAVVTFIGKVRDFNQGVTGLSLEHYPGMTEKSLEEIVVQARERWPLLKTRVIHRVGDLGLGDQIVFVGVTSAHRGAAFEACEFIMDFLKTRAPFWKKEQTSNETRWVDARDTDTSAADRWQNK. 149
34 2.000e-54gi|91775616|ref|YP_545372.1| molybdopterin synthase subunit MoaE [Methylobacillus flagellatus KT]  clstr ali  38  1MTVRVQEQDFDVGEEITRLRLQYPQAGAVVSFTGQVRDLNDGVASLKLEHYPGMTEKSLAAIVEQARKRWPIFDAVVIHRIGTLAPQAQIVLVVVASAHRGDAFAACEFIMDYLKTEAPFWKKEATPEGEKWLDSRESDQAARGRWQ... 149
35 2.000e-54gi|388471357|ref|ZP_10145566.1| molybdopterin converting factor, subunit 2 [Pseudomonas synxantha BG33R]  clstr ali  47  1MPIQVQTELLDLGELTRSVHAEDPGVGAVATFVGYVRDINQGVSALFLEHYPGMTERALQLIVDQAHERWPLQRVSIVHRVGPLKVGEPIVFVGVASQHRLDAFEACAFLMDYLKTRAPFWKREQTPAGERWVEGRESDRLAQERW.... 148
36 3.000e-54gi|421478002|ref|ZP_15925779.1| molybdopterin converting factor, subunit 2 [Burkholderia multivorans CF2]  clstr ali  45  5..VRVQTDDFDLNAEVAALRARNPKIGAVACFVGTVRDLNEGVAALELEHYPGMTEKALEKIAAEAGRRWPGIDVAIVHRVGKLYPLDQIVMVATVAAHRGDAFASCEFVMDYLKTDAPFWKKETTPNGERWVDARSTDDAALARWGIES 154
37 3.000e-54gi|145588629|ref|YP_001155226.1| molybdopterin biosynthesis protein MoaE [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]  clstr ali  39  6..IRIQEQDFDLSAEIVALRKGDARVGAVVSFLGTVRDLSDGVKGMTLEHYPGMTEKSLQAILDQAATRWNIFQTLVIHRVGLLLPEDQIVLVAVTSAHRGEAFSACEFIMDYLKTAAPFWKKEDTPEGSRWVDARVTDETAMARWNK.. 153
38 4.000e-54gi|333899235|ref|YP_004473108.1| molybdopterin biosynthesis MoaE protein [Pseudomonas fulva 12-X]  clstr ali  44  1MGIRVQQAVFDPGLETNAVHAANTGVGAVACFVGYVRDFNDGVAGMFLEHFPGMTEKALAGIESQARERWPLLGVEVIHRVGRLEPGEPIVFVGVASAHRQAAFQACEFIMDYLKTRAPFWKKEDTPSGPRWVEGRDSDQASARRWQADS 152
39 4.000e-54gi|154252720|ref|YP_001413544.1| molybdopterin biosynthesis protein MoaE [Parvibaculum lavamentivorans DS-1]  clstr ali  42  1.MIRIQTEDFDIGAEIAALTEGRTDIGAVVTFSGLVRE-TGGIASMELEHYPGMTEKKLARIESEATARWPLQATLIIHRVGKLLPGDNIVLVVAASAHRQAAFDAASFLMDYLKTRAPFWKREQTGDKSHWVDARESDGTAAAKWD... 145
40 4.000e-54gi|402699516|ref|ZP_10847495.1| molybdopterin converting factor subunit 2 [Pseudomonas fragi A22]  clstr ali  44  1MTVRVQAAAFDPGAQVNALHAANLGVGAVVSFVGYVRDFNDGVAGMFLEHYPGMTEKALDKIVLEAEQRWPLLRLEVLHRVGALEPGEPIVFVGVASAHRQAAFDACAFVMDYLKTRAPFWKKEQTGDGPRWVEGRVSDEEAADRWKK.. 150
41 5.000e-54gi|71908342|ref|YP_285929.1| molybdopterin synthase subunit MoaE [Dechloromonas aromatica RCB]  clstr ali  43  1MTVRVQGADFDVGAELAALRAGDARVGALASFLGLVRDLNDGVSEMTLEHYPGMTEKALEEIVAEARGRWELYDALVIHRVGPLKPCEQIVLVAVTSAHRGEAFAACEFIMDYLKTRAPFWKREATPDGGRWVDARETDDSAAARWQK.. 150
42 5.000e-54gi|359782907|ref|ZP_09286125.1| molybdopterin converting factor large subunit [Pseudomonas psychrotolerans L19]  clstr ali  45  1MAIRVQAAAFDPGQELNALHAANTGIGAVVGFVGYVRDFNDGVGGLFLEHFPGMTEKALARIVEEAKQRWPLLGVDILHRIGRLEPGEPIVFVGTASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGPRWVEGRASDQDAAGRWAK.. 150
43 5.000e-54gi|92114199|ref|YP_574127.1| molybdopterin synthase subunit MoaE [Chromohalobacter salexigens DSM 3043]  clstr ali  47  2IEVRVQSAVFDVGEEQQRLLSGRHDVGAVVTFTGLVRDFNEDVEALSLEHYPGMTEAALHDIARQATARWPLDGIRIVHRIGRLSPGDPIVLVMVASAHRRAAFEACDFLMDYLKTRAPFWKKEHTASGTYWVSARDSDAQDAARWEAT. 152
44 7.000e-54gi|264677173|ref|YP_003277079.1| molybdopterin biosynthesis MoaE [Comamonas testosteroni CNB-2]  clstr ali  41  15.RVSIQTQDFDLSAEIAALRAGDARVGAVCSFVGTVRDRNEGVSSMELEHYPGMTEKSIEAIIDKAVARFGIYGARVIHRIGLLQPMDQIVLVAVSSAHRGKSFEACEYIMDYLKSEAPFWKKEQTEQGARWVDARVSDEQALARW.... 161
45 7.000e-54gi|329910933|ref|ZP_08275413.1| Molybdenum cofactor biosynthesis protein E; Molybdopterin converting factor subunit 2 [Oxalobacteraceae bacterium IMC  clstr ali  40  1MTIRIQQADFDMSTELANLRAGSPQVGAIVSFVGTVRDLNDGVSQMELEHYPGMTEKSIAVIVERARAHWPIADALVIHRIGPLLPTEQIVLVAVAAAHRGEAFAACEFIMDYLKTEAPFWKKEQTPEGARWVDARAVDDAALAKW.... 148
46 7.000e-54gi|254507737|ref|ZP_05119868.1| molybdopterin converting factor, subunit 2 [Vibrio parahaemolyticus 16]  clstr ali  39  4.RISVQTADFSVGAEYDALAQGT-SAGAVVTFTGKVRDMNDNVTGLSLEHYPGMTEKALGDICDQAEQRWPILNMRVIHRVGDLDIGDQIVFVGVSSAHRGAAFEACEFVMDYLKTKAPFWKKERTTDATRWVESRDSDAKAAERWTEK. 152
47 7.000e-54gi|388570196|ref|ZP_10156556.1| molybdopterin biosynthesis MoaE protein [Hydrogenophaga sp. PBC]  clstr ali  38  6.RVSIQTADFDLSTEVARLREQDKGVGAVCSFIGTVRDRNDGVSAMELEHYPGMTEKAVEAMIDEAFRRFQILGARVIHRVGPLQPLDQIVLVVVSSAHRGQSFQACEFLMDYLKTQAPFWKKEETPEGARWVDARVSDDAALARWGIQA 156
48 7.000e-54gi|389681037|ref|ZP_10172382.1| molybdopterin converting factor, subunit 2 [Pseudomonas chlororaphis O6]  clstr ali  43  1MTVHVQAEVLDLDRLHREVHGGDPSIGAVVTFVGYVRDLNDQVGSLFLEHYPGMTERALQRIVDEANQRWPLQRVRVVHRVGLLQVAEPIVFVGVASAHRQAAFAACAFLMDYLKTRAPFWKREQTLSGERWVEGRESDQLAASRW.... 148
49 7.000e-54Oral.Meta HOMD mlot_c_1_24128 Mesorhizobium loti MAFF303099 [6538290 - 6539003] RecName: Full=Molybdopterin synthase catalytic subunit; AltName:sFull  ali  50  88..VRIQRQDFDVAAEIAALTQGRADVGAVVSFSGLCRDEQGALSALELEHYPGMAEAEIGRIAAEAVERWPLQGLTVIHRHGKIRPGENIVLVVAASAHRQAAFEAANFLMDYLKSRAPFWKKEHRTDGSEWVEAKETDTQAAKRWKSSS 237
50 8.000e-54gi|17546051|ref|NP_519453.1| molybdopterin MPT converting factor subunit 2 [Ralstonia solanacearum GMI1000]  clstr ali  43  4..IRVQEADFDLGAEIAALRAGRPQIGAVASFIGTVRDINDGVSEMELEHYPGMTEKALANIVDAAMQRWDLIDALVIHRVGKLRPEDQIVLVAVASGHRGEAFAACEFIMDYLKSEAPFWKKEQTAQGARWVDARVTDERALARWG... 150
51 8.000e-54gi|89900703|ref|YP_523174.1| molybdopterin biosynthesis MoaE [Rhodoferax ferrireducens T118]  clstr ali  40  9.RVSIQTADFDLSTEVALLRAQDPRVGAVCSFIGTVRDRTAGISSMELEHYPGMTEKSIEAMMDAALKRFDIYGARVIHRVGLLQPLDQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALARWGIAA 161
52 9.000e-54gi|297538419|ref|YP_003674188.1| molybdopterin biosynthesis MoaE protein [Methylotenera versatilis 301]  clstr ali  42  1MTVRVQTQDFDAGFEISLLRNARKDTGAVVSFIGQVRDLNEGVSQLTLEHYPGMTEKALEAIVNQAQSRWDIFDAIVIHRVGILQPTDQIVLVAVSSAHRGEAFKACEFIMDYLKTEAPFWKKEVTSQGERWVDAKLTDDDARERWK... 149
53 1.000e-53gi|253996391|ref|YP_003048455.1| molybdopterin biosynthesis MoaE protein [Methylotenera mobilis JLW8]  clstr ali  40  1MTVRVQTADFDIGAEINQLRQARKNVGAVVSFVGLVRDLNDGVSQLTLEHYPGMTEKSLAAIIEQAKNRWSIMDALIVHRVGTLQPSDQIVLVIVTSAHRGDAFSACEFMMDYLKTEAPFWKKEANSTGEHWIEAKSADDTARDRWNIE. 151
54 1.000e-53gi|427401774|ref|ZP_18892846.1| molybdopterin synthase catalytic subunit [Massilia timonae CCUG 45783]  clstr ali  41  4..VRVQAGDFDLGQEVARLRANDARIGAVVSFVGTVRDLNDGVSEMELEHYPGMTEKSLEAIAARACERWPLYGTLVIHRVGPLAPLDQIVLVACSAAHRGDAFAACEFIMDYLKTEAPFWKKEQTPDGARWVDARVTDDSAKARWE... 150
55 1.000e-53METAHIT O2 GL0072640 [Complete] locus=scaffold47540_3:1953:2417:+  ali  41  7.KILVTTEPFDIGEETARIREGSPDMGAIVTFTGVVRNVNDGVTAMTLEHYPGMTQKSLAKIVETARGRWPLGDVTVIHRVGRMVVGEEIVLVAVASRHRHAAFEAASFIMDWLKTEAPFWKKEETPEGARWVDARESDDLAKARWG... 154
56 2.000e-53gi|229525638|ref|ZP_04415043.1| molybdenum cofactor biosynthesis protein E [Vibrio cholerae bv. albensis VL426]  clstr ali  42  4.RVSVQTEDFSVAQEYEALAQGS-QAGAVVTFVGKVRDMNDNVVGLHLEHYPGMTEKSLLEICDMAQERWPLQRVRIIHRIGDMLSGDQIVLVGVTSAHRNAAFAACEFIMDYLKTRAPFWKKELTTEASRWIDSRDSDHQAAQRWEQQ. 152
57 2.000e-53gi|358636850|dbj|BAL24147.1| molybdenum cofactor biosynthesis protein E [Azoarcus sp. KH32C]  clstr ali  45  1MSVSVQESDFDVGAEIAALSEDRREVGAVASFVGLVRDISEGVAAMTLEHYPGMTEQALEEIVAEARSRWSLHAVRVIHRYGRLEPGDRIVFVGVAGAHRGESFAACEFIMDYLKTRAPFWKKEETPDGARWVDARDSDDSAARRWER.. 150
58 2.000e-53gi|398804065|ref|ZP_10563068.1| molybdopterin converting factor, large subunit [Polaromonas sp. CF318]  clstr ali  42  5.RVLITTDDFNLADEVAALRAGDKRVGAVCTFTGTVRDRNDGVSSMELEHYPGMTEKAIEAMIDEAMARFDIFGARVVHRVGLLQPLDQVVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVADDAALAKWGITA 155
59 2.000e-53gi|337280042|ref|YP_004619514.1| molybdopterin converting factor subunit 2 [Ramlibacter tataouinensis TTB310]  clstr ali  40  6.RVVIQEQDFDLSAEVAALRGRDTGVGAVCCFVGTVRDRNDGVSTLELEHYPGMTEKAIEAMIDEAMRRFDIRAARVVHRIGPLQPQEQIVLVAVTSAHRGESFQACEFLMDYLKTQAPFWKKEQTPTGARWVDARVSDDAALARWGIAS 156
60 3.000e-53gi|260898241|ref|ZP_05906737.1| molybdopterin converting factor, subunit 2 [Vibrio parahaemolyticus Peru-466]  clstr ali  40  4.RVSVQVEDFSVDQEYQRLSEGTAS-GAVVTFIGKVRDMNDNVIGLHLEHYPGMTEKSLSDICDEAEARWPLLGVRVIHRVGDMDSGDQIVFVGVSSAHRGAAFDACEFIMDYLKTKAPFWKKERTTNEDRWIESRDTDHQAARRWEN.. 151
61 3.000e-53gi|253999439|ref|YP_003051502.1| molybdopterin biosynthesis MoaE protein [Methylovorus glucosetrophus SIP3-4]  clstr ali  39  1MTIRVQADDFDVGAEINRLRQQRPDIGAVAAFVGQVRDLNQGIAGMTLEHYPGMTEKSLEAIVQQAKARWDIMDAVVIHRIGELKPLDQIVLVAVAGAHRGEAFHACEFIMDYLKTEAPFWKKEQTPEGERWVDARSSDDAARARWQD.. 150
62 3.000e-53Oral.Meta HOMD daci_c_1_27013 Delftia acidovorans SPH-1 ATCC15668 [5779294 - 5778728] molybdopterin biosynthesis MoaE protein  ali  42  41.RVSIQTEDFDVSAELAALRGGDARVGAVCSFIGTVRDRNEGVASMELEHYPGMTEKSIEAIIDEAVHRFGIHGARVIHRIGPLQPMDQIVLVAVTASHRGMAFQACEYIMDYLKSLAPFWKKEQTPEGARWVDARVSDEEALARWRQ.. 189
63 3.000e-53gi|383815680|ref|ZP_09971089.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia sp. M24T3]  clstr ali  42  5.RIVVDAAPFSVGEEYQWLAQSDSD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKALAEIVEEARQRWPLQRVSVYHRVGALFPGDEIVFVGVTSAHRGMAFDATEFIMDYLKTRAPFWKREATEQGDRWVESRESDKTAASRWSSSS 154
64 3.000e-53gi|260219647|emb|CBA26492.1| Molybdopterin-converting factor subunit 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  40  10.RVRIQTEAFDLGLEISQLQAADPRVGAVCSFVGTVRDRNGSVQTLELEHYPGMTEKSIEAMVDAAFARFDIYGARVVHRVGVLQPTEGVVLVAVTSAHRGQSFQACEFIMDYLKTQAPFWKKETTPEGAHWVDARVSDDEALARWGITA 163
65 3.000e-53gi|398991929|ref|ZP_10695008.1| molybdopterin converting factor, large subunit [Pseudomonas sp. GM24]  clstr ali  43  1MAIRVQHKSFDVGQLTADLHARNPRVGAVVNFVGYVRDLNMGVNELFLEHYPGMTEKALEQIAEEARERWPLLGVEIVHRVGALSVSEPIVFVGVSSKHRHMAFEACAFIMDVLKTRAPFWKRETTPEGSHWVEGRESDRDAALRWS... 149
66 4.000e-53gi|121595502|ref|YP_987398.1| molybdopterin synthase subunit MoaE [Acidovorax sp. JS42]  clstr ali  40  3.RVSIQTHDFDVSTELAALRARDARVGAVCCFVGTVRDRNEGVASMELEHYPGMTEKSIEAMVDAAFARFNLYGVRVIHRVGLLAPLDQIVMVAVTSAHRGESFQACEFVMDYLKTQAPFWKKEQTPDGARWVDARVSDDAALARWGIAA 153
67 4.000e-53gi|330817197|ref|YP_004360902.1| Molybdopterin biosynthesis MoaE [Burkholderia gladioli BSR3]  clstr ali  43  4LRARVQTGDFEVGAELAALRARNPKIGAVACFVGTVRDLNEGVAALELEHYPGMTEKALEAIADEAIARWPGIEVAIIHRVGRLLPLDQIVFVATVAAHRGDAFASCEFVMDYLKTEAPFWKKESTPSGERWVDARSSDDAALARWGLRS 155
68 4.000e-53gi|149190385|ref|ZP_01868657.1| molybdenum cofactor biosynthesis protein E [Vibrio shilonii AK1]  clstr ali  39  3LRVSVQHEDFSVGAEYDALAEGTAS-GAIVTFTGKVRDMNDNVTGLSLEHYPGMTERSLEKICDEAEERWMLNGIRVIHRVGDMDAGDQIVFVGVSSAHRGSAFEACEFIMDYLKTKAPFWKKERTTESTRWVESRDSDAEAAARWQEK. 152
69 4.000e-53gi|187923800|ref|YP_001895442.1| molybdopterin biosynthesis protein MoaE [Burkholderia phytofirmans PsJN]  clstr ali  41  1MPVRVQTEDFDLTAEVAALRARNPKIGAVACFVGTVRDLNDGVETMELEHYPGMTEKSLEAIIVSARERWPGIEVSIVHRVGKLYPLDQIVMVATTAAHRGEAFVSCEFVMDYLKTQAPFWKKEKTEAGERWVDARVTDDAALARWGIKS 152
70 4.000e-53gi|300722426|ref|YP_003711714.1| molybdopterin converting factor subunit 2 [Xenorhabdus nematophila ATCC 19061]  clstr ali  40  5.RIRVQRERFHVGDEYQWLSQCDED-GAVVTFTGKVRNHNDNVNALTLEHYPGMTEKMLQKIADEARQRWPVQRITIIHRIGELYPGDEIVFVGVTSSHRNMAFTAAEFMMDYLKTKAPFWKKESLAEGERWVEIKQHDQEAANRWQS.. 152
71 5.000e-53Oral.Meta HOMD pstu_c_1_4405 Pseudomonas stutzeri A1501, CGMCC 0351 [1285129 - 1285590] molybdenum cofactor biosynthesis protein E  ali  45  3MAVRVQQGSFDPGAELNALHAANLGIGAVAGFVGYVRDFNDGVAGMFLEHAPGMTEKALEKIVQEAEQRWPLLRLDVLHRVGSLEPGEPIVFVGAASAHRDAAFDACRFVMDYLKTRAPFWKKENTSAGPRWVEGRASDQLAAERWNEES 154
72 7.000e-53gi|336124626|ref|YP_004566674.1| molybdopterin converting factor, large subunit [Vibrio anguillarum 775]  clstr ali  39  5.RISVQISDFSVDAEYRDLSQGT-SAGAVVTFIGKVRDMNDNVIGLTLEHYPGMTEKALSDICDQAQARWPVQKIRVIHRIGDLDIGDQIVFVGVSSSHRGAAFEACEFVMDYLKAKAPFWKKERTTEQTRWVESRDSDAQAAQRWANH. 153
73 7.000e-53gi|399910697|ref|ZP_10779011.1| molybdenum cofactor biosynthesis protein E [Halomonas sp. KM-1]  clstr ali  48  1.MIRVQEAPFDAGVEQQRLLADRSDIGAVVSFTGLVRDFNEDVTALTLEHYPGMTEAALGEIVNQAEARWSLQGVRVIHRVGRLTPGDPIVLVVVASAHRRAAFEACDFIMDYLKTRAPFWKKEHSITGDYWVAERESDYRDASRWESE. 150
74 7.000e-53gi|56479248|ref|YP_160837.1| molybdenum cofactor biosynthesis protein E [Aromatoleum aromaticum EbN1]  clstr ali  45  1MSVSVQQADFDVGAEIAALSQGRHEVGAVASFVGLVRDVSGGVAAMTLEHYPGMTERSLEDIVGEARRRWQLDGVRVIHRYGRLEPGDRIVFVGVAGAHRGEAFAACEFVMDYLKTRAPFWKLEETPDGAHWVDARDSDDSAAARWD... 149
75 8.000e-53gi|262274526|ref|ZP_06052337.1| molybdenum cofactor biosynthesis protein E [Grimontia hollisae CIP 101886]  clstr ali  37  1.MISVQEQDFSVAEEYERLNDHAGD-GAIVTFVGKVRDMNDNVTGLTLEHYPGMTEKSLSNIVEQAKGRWPLTHVRVIHRIGALDIGDQIVFVGISSAHRKAAFEACEFVMDYLKTQAPFWKKERLVANERWVEARDSDQEAAKRW.... 146
76 8.000e-53gi|422022154|ref|ZP_16368662.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Providencia sneebia DSM 19967]  clstr ali  43  5.HIAVQTNNFDVGEQYQWL-AQCDSDGAVVTFTGKVRNHNDSVAALTLEHYPGMTEKALENIIEEARRRWALQRVSVIHRVGTLQPGDEIVFVGVTSAHRGAAFEAAEFIMDYLKTKAPFWKKETLPDNERWVEAKESDEKSANRWS... 151
77 1.000e-52gi|377821027|ref|YP_004977398.1| molybdopterin biosynthesis protein MoaE [Burkholderia sp. YI23]  clstr ali  42  6.KIRVQEADFDIGAEVAALRADNPKVGAVACFVGTVRDLNEGVETMELEHYPGMTEKSLEAIADQARARWRGSDVLIVHRVGKLKPLDQIVLVATTAMHRAEAFESCAFVMDYLKTQAPFWKKEKTEAGERWVDARESDDAALARWQN.. 154
78 1.000e-52gi|310815058|ref|YP_003963022.1| molybdopterin converting factor subunit 2 [Ketogulonicigenium vulgare Y25]  clstr ali  48  1MDIRVTEQPFDGGAELNAFSARVAGAGAVVTFNGVVRDVPGSLQMLEVEHYPGMTELALREAAAQAITRWSLVDVLIIHRYGRLSAGEQIMMVATAAPHRLGAFEAAEFLMDYLKSRAPFWKKEVTADGEAWVEARCSDEEALKRWS... 147
79 1.000e-52gi|350563755|ref|ZP_08932575.1| molybdopterin biosynthesis MoaE protein [Thioalkalimicrobium aerophilum AL3]  clstr ali  41  6..VRVQEADFDLSTEVNWLREQHADVGAVVSFIGTVRDINQGVNQLELEHYPGMTEKALEAIRQQAHQRWQLESSLIIHRIGKMQPKDQIVLVAVASRHRENAFHAAHFIMDYLKTNAPFWKKEWTPEGERWVDARLSDEQAMQRW.... 151
80 1.000e-52gi|345876588|ref|ZP_08828355.1| hypothetical protein Rifp1Sym_ac00470 [endosymbiont of Riftia pachyptila (vent Ph05)]  clstr ali  41  6..IRVQSEPFDPNVEVDLLRNHSPSIGGVVSFIGQVRDFNDDVLAMTLEHYPGMTEKALAAIVDEANARWELMGVRVVHRVGRMLPKDPIVLVAVASSHRGEAFQACEFIIDYLKTRAPFWKREESVEGARWVDARESDDHAEARWK... 152
81 1.000e-52gi|74317045|ref|YP_314785.1| molybdopterin synthase subunit MoaE [Thiobacillus denitrificans ATCC 25259]  clstr ali  48  1MKIAVQNEAFDLGSEVAALTHGRRDVGAVASFVGLARDINEGVAAMTLEHYPGMTEKALAALVDEACARWALLDVSVVHRVGRLLPGDPIVLVAVASAHRGEAFAACEFIMDALKTRAPFWKKEETPDGERWVEARASDEAAAGRWEK.. 150
82 1.000e-52gi|148253254|ref|YP_001237839.1| molybdopterin synthase subunit MoaE [Bradyrhizobium sp. BTAi1]  clstr ali  43  5VTVRVQPEDFDTAAEIAALSHGRTDIGAVVSFSGLCRDHDTPISALVLEHYPGMAEAEIMRHAEEAMARWPLQGLTVIHRFGRITPGENIVLVVTASSHRRAAFEAAEFLMDYLKTNAPFWKREETADGGSWVEAKSHDDAAAARWTS.. 154
83 1.000e-52gi|288958384|ref|YP_003448725.1| molybdenum cofactor biosynthesis protein E [Azospirillum sp. B510]  clstr ali  44  1MAIRVQAGDFDVGAEYAAFTAGRTSVGGVAMFVGLVRDIAGGVSAMTLEHYPGMTERQLEAIEEEARRRWPLDDVLVIHRHGRLEPGDRIVMVATASAHRDAAFDSCRFLMDWLKTKAPFWKLEATPDGERWVEAKESDDAAAARWAE.. 150
84 1.000e-52gi|149909604|ref|ZP_01898257.1| putative molybdenum cofactor biosynthesisprotein E [Moritella sp. PE36]  clstr ali  40  6..IQIQTEDFDLATEYAALGKSH-STGAVVTFIGKVRDFNQGVSGLTLEHYPGMTEKSLAKILIEAETRWSIQGVKVIHRIGELALGDQIVFVGVASMHRGDAFQACEFIMDYLKTQAPFWKKEATQAGSHWVDARETDTTAADRWK... 151
85 2.000e-52gi|83647894|ref|YP_436329.1| molybdopterin converting factor, large subunit [Hahella chejuensis KCTC 2396]  clstr ali  40  5IRIDVTTDDFDLGEETRRLTDGDTAVGAVCSFVGLVRDFSDDVKGLYLEHYPAMTEKSLTKIAKEAFQRWDLNGVRVIHRVGELWAGDQIVLVVTASAHRGDAFAACEFIMDYLKVQAPFWKKELTAEGEHWVEAKESDQVRAGEWSSE. 155
86 2.000e-52gi|251790120|ref|YP_003004841.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Dickeya zeae Ech1591]  clstr ali  41  4.RIRVGQEPFSVGDEYAWLATSDMD-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALAEIVDDARQRWPIQRVSLIHRVGALFPGDEIVFVGVSGAHRQASFDAAQFIMDYLKTRAPFWKREATSDGDRWVDARDSDRQAAERWS... 150
87 2.000e-52gi|157369567|ref|YP_001477556.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia proteamaculans 568]  clstr ali  42  6.RIRVGEAPFNVGEEYQWLAQCDDD-GAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALAEIVDEARSRWPLQRATVIHRVGELFPGDEIVFVGVTSAHRSMAFEASEFIMDYLKTRAPFWKREAVGQGDRWVDARDSDRQAAERWHK.. 153
88 2.000e-52gi|260769042|ref|ZP_05877976.1| molybdenum cofactor biosynthesis protein E [Vibrio furnissii CIP 102972]  clstr ali  42  4.RVSVQTQDFSVADEYAQLSAGT-QAGAVVTFVGKVRDMNDNVAGLHLEHYPGMTEKALLEICDEAARRWPLQNVRVIHRVGDMDIGDQIVFVGVSSAHRSASFEACEFVMDYLKTKAPFWKKERTTEATRWVDSRESDAKAAERWQQ.. 151
89 2.000e-52gi|407771591|ref|ZP_11118945.1| molybdenum cofactor biosynthesis protein E [Thalassospira xiamenensis M-5 = DSM 17429]  clstr ali  46  3.RVSVQENDFDPGAELAALTDGRTDIGAAVSFVGLVRDIHGGVSALTLDHYPGMTERELENIVDEAARRWPLDDVRIVHRFGRMLPGERIVLVITLSAHRRAAFEACDFIMDFLKTRAPFWKREQTPKGDHWVTAKASDDADAERWNTD. 152
90 3.000e-52gi|392382460|ref|YP_005031657.1| molybdenum cofactor biosynthesis protein E [Azospirillum brasilense Sp245]  clstr ali  44  1MTVKVQSEDFDVGAELAAMTGGKTGIGGVTLFVGLVRDMAGGVSAMTLEHYPGMTERQLEAIEAEARARWPLDDALIIHRYGRLEPGDRIVLVATASAHREAAFESCHFLIDWLKTKAPFWKMEATPEGERWVEAKESDDTAAARWTKPA 152
91 3.000e-52gi|398921672|ref|ZP_10659978.1| molybdopterin converting factor, large subunit [Pseudomonas sp. GM49]  clstr ali  38  1MTVRVQREVFDISQLIDSLQANDPGVGAVVNFVGYVRDINQGVAGLFLEHYPGMTERSLQTIIDNARARWPLRAVEIVHRIGPLSISEPIVFVGVSSQHRQAAFEACAFITDYLKTDAPFWKREDVASGARWVDARDSDRSAVERWADT. 151
92 3.000e-52gi|422348532|ref|ZP_16429425.1| hypothetical protein HMPREF9465_00315 [Sutterella wadsworthensis 2_1_59BFAA]  clstr ali  41  6..IRVSEADFNPGEEIERLIESSPEAGGVASFVGVVRNRNDGVTHLTLEHYPAMTERALAGIVERARARWDVCGVTVIHRVGEMAVGEHIVLVVVTSAHRREAFEACEFIMDWLKTEAPFWKKERTPEGERWVDARESDEEARRRWGEAA 155
93 3.000e-52gi|427426971|ref|ZP_18917016.1| Molybdenum cofactor biosynthesis protein MoaE [Caenispirillum salinarum AK4]  clstr ali  46  1MAVRVQREDFDVGAEMAAFCAGDTSVGAVASFVGLVRADSGAVSAMTLEHYPGMTERQLEAIEADARERWPLHDVLVVHRYGRMEPGERIVLVLTASSHRQAAFDACAFLMDWLKTKAPFWKLEETPNGGRWVDARESDDAAAARWGGD. 154
94 4.000e-52NEWGM CAP jgi|Capca1|120230|e_gw1.39313.1.1|Capitella sp.1|JGI  ali  44  2.LISIQVEDFNPGHEYERM-EGNKSSGAIVTFTGTVRDMNDAVGGLFLEHYPGMTEKALQEIIDEAMERWELKVVRVIHRIGQMHPGDRIVFVGVASAHRKEAFAACEFIMDYLKTRAPFWKKETTPDGDRWVDERGSDQKAADRW.... 147
95 4.000e-52gi|212637681|ref|YP_002314206.1| molybdenum cofactor biosynthesis protein E [Shewanella piezotolerans WP3]  clstr ali  37  1.MIRVQTTDFSVPDEYQLISQDNGD-GAVVTFVGKVRDFNDGVTDLTLEHYPGMTESVLNQIEAQARERWPLNHVTIIHRVGKMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGEEGASWVEARDSDEQAADVWNKK. 149
96 4.000e-52gi|390951176|ref|YP_006414935.1| molybdopterin converting factor, large subunit [Thiocystis violascens DSM 198]  clstr ali  43  3.RVQIQTEPFDIAAEQESLWHGNPRVGALVTFVGLMRDLHEGVSRMTLEHYPGMTEKALAEIAEEANARWKLEGVTIVHRLGKLEPQDPIVFVGVASHHRGDAFRACEFLIDYLKTRAPFWKKEQTEQGERWVESKVSDDVAARRW.... 149
97 4.000e-52gi|307944208|ref|ZP_07659549.1| molybdopterin converting factor, subunit 2 [Roseibium sp. TrichSKD4]  clstr ali  45  7..VRVQAENFDLTEETAKLTAGRFDIGAVVTFTGLCRDEGGQLSALELEHYPGMAEAEISRIAERAAERWPITGLTVIHRFGKIAPGENIVLVIAASPHRQAAFDAANFLMDFLKTRAPFWKKEHLKSGQDWVDAKDLDEQALTRWEQ.. 154
98 4.000e-52gi|291616778|ref|YP_003519520.1| MoaE [Pantoea ananatis LMG 20103]  clstr ali  43  5..IRVGPAAFDMAQEYQWL-AGCPEDGAVVTFTGKVRNHNDDVAALTLEHYPGMTEKALQEIIDDARQRWPLQRVSVIHRIGELFPGDEIVFVGVTSAHRSSAFAAAEFIMDYLKTRAPFWKRETTEQGDRWVDARNSDHEAAQRWD... 150
99 5.000e-52gi|348029344|ref|YP_004872030.1| molybdenum cofactor biosynthesis protein E [Glaciecola nitratireducens FR1064]  clstr ali  35  8..ISVQEQDFDLALEYTQIRKHSDSDGAIVTFTGLVRELTGNLKYMTLEHYPGMTEKSLMNICEQARERWPIGSIRIIHRIGKLPPDEQIVFVGVSSKHRKAAFAATEFMMDFLKTQAPFWKKELTTEGEFWVDAKSSDKHKANDW.... 153
100 6.000e-52METAHIT MH0083 GL0075865 [Complete] locus=scaffold78862_2:131:589:+  ali  38  6..IRVSPEDFSVDAEVARVREASPSAGAVVSFVGVVRNRNDGVSKMTLEHYPGMTEKALGKIVEKARERFHLEDVVVIHRVGDLSVGDQIVLCLVSASHRGEAFEGCEYIMDWLKTEAPFWKRETTPEGERWVDARESDDRAKARWG... 152
101 6.000e-52gi|88800263|ref|ZP_01115830.1| putative molybdenum cofactor biosynthesisprotein E [Reinekea blandensis MED297]  clstr ali  38  4..IRVQQDDFSVQREYDGLCRENTDDGAVVFFVGRVRDLNEGVTGMFLEHYPGMTEKTLQSIADEARHRWPLNRIRIVHRVGALNPSDQIVFVGVSSPHRGAAFDGAQYIMDFLKTRAPFWKKESTPEGDRWVDARSSDTEQENRW.... 149
102 6.000e-52gi|120609935|ref|YP_969613.1| molybdopterin synthase subunit MoaE [Acidovorax citrulli AAC00-1]  clstr ali  40  18.RVSIQPQDFDVSAELAALRARDGRVGAVCCFVGTVRDRSDGVAAMELEHYPGMTEKSIEAMVDEALGRFDIFGARVVHRVGLLAPQDQIVMVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPLGARWVDARVSDDAALARWGIVS 168
103 6.000e-52gi|124266740|ref|YP_001020744.1| molybdopterin synthase subunit MoaE [Methylibium petroleiphilum PM1]  clstr ali  41  11.RVTIQTEDFDLSSEVAALRAHQRGVGAVASFVGTVRDRNDGVSRMELEHYPGMTERAIEAMIDAAFARFDLLGARVIHRIGPLEVGEQIVLVVVSSAHRGQAFQACEFLMDYLKTQAPFWKKEQTPQGARWVDARVADDDALRRWGIAA 161
104 6.000e-52gi|253990406|ref|YP_003041762.1| molybdopterin converting factor subunit 2 [Photorhabdus asymbiotica]  clstr ali  40  5.RIFVGLENFNVGDEYEWLSQCDED-GAIVTFTGKVRNHNDRVSGLRLEHYPGMTEKVLRNIVVEARSRWPLQRISIIHRVGALYPGDEIVFVGVTSAHRSMAFDAAEFIMDYLKTKAPFWKKEFLPDGERWVESRESDQEAARRW.... 150
105 7.000e-52gi|126734006|ref|ZP_01749753.1| molybdopterin converting factor, subunit 2 [Roseobacter sp. CCS2]  clstr ali  47  1MTVRVQSDPFDAGAELNSFAQDRTDIGAVVSFTGVVRDTKGDLQEMLIEHYPGMTQSAITKIADEAVQRWALADVLVIHRYGPLKPGEPIMMVATVSAHRAASFEAADFLMDYLKSRAPFWKKEVTAEGAAWVDAKDTDEDALKRW.... 146
106 7.000e-52gi|343497403|ref|ZP_08735473.1| molybdenum cofactor biosynthesis protein E [Vibrio nigripulchritudo ATCC 27043]  clstr ali  36  4..VSVQKEDFSLADEYD-VLAQGTSSGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLESLCEQAKQRWSIENIRVIHRVGDLDIGDQIVFVGVSSAHRGDAFNACEFVMDYLKTQAPFWKKERTTDSVRWVESRESDAAAASRWAEQG 152
107 7.000e-52gi|375105814|ref|ZP_09752075.1| molybdopterin converting factor, large subunit [Burkholderiales bacterium JOSHI_001]  clstr ali  42  4.RVRIQTEDFDLGTEVAAVRAGNPAVGAVAAFVGTVRDRNAGISAMELEHYPGMTEKAIEAMIDDAMRRFRVLGARVIHRVGPLKPLDQIVLVVVTSTHRGDAFQACEFLMDYLKTQAPFWKKETTPEGARWVDARVADDAALARWGITA 156
108 8.000e-52gi|23016727|ref|ZP_00056480.1| COG0314: Molybdopterin converting factor, large subunit [Magnetospirillum magnetotacticum MS-1]  clstr ali  44  1MAVRVQREEFDPGAELARFSAGKTSVGGICLFIGLVRDYMGAVNAMTLEHYPGMTERQLEAIEAEAHARWPLDDTLVIHRYGRLEPGERIVLVAASSAHRDAAFEACRFLMDWLKTKAPFWKVEHTPDGDAWVDAKESDEAAASRWNQ.. 155
109 9.000e-52gi|421495969|ref|ZP_15943214.1| moaE [Aeromonas media WS]  clstr ali  39  11.RILVQRADFSLGEEYERLATRHDS-GAIVTFVGKVRDFNQGVKGLSLEHYPGMTEKALVDIVNQARARWPLQECTLIHRIGDLLLGDQIVLVAVSSAHREAAFEACHFIMDFLKTRAPFWKKELTAEGQRWVEAKQSDDAAAARWRQD. 160
110 1.000e-51gi|395003975|ref|ZP_10388064.1| molybdopterin converting factor, large subunit [Acidovorax sp. CF316]  clstr ali  42  9..VSIQTEDFDLSAEVAALRHGDRRVGAVCAFVGTVRDRNDGVASLELEHYPGMTEKSIAAMVDAAFGRFELFGVRVIHRVGLLQPLDQIVLVAVTSAHRGQSFEACEFLMDYLKTQAPFWKKEVTPAGARWVDARVSDDAALARW.... 154
111 1.000e-51gi|359784723|ref|ZP_09287889.1| molybdopterin synthase subunit MoaE [Halomonas sp. GFAJ-1]  clstr ali  43  8IAVEVQAAPFSMDYGYESTLQQRTDIGAIVSFTGLVRDFNEDVTGLTLEHYPGMTERTLAEIGEQAWERWSLQAVRIIHRVGHLSPGDPIVRVLVASAHRRDAFNACDFIMDYLKTQAPFWKKEHSREGAYWVKERDSDQQDADRWSS.. 157
112 1.000e-51gi|372271097|ref|ZP_09507145.1| molybdenum cofactor biosynthesis protein MoaE [Marinobacterium stanieri S30]  clstr ali  42  3.RIEISTKDYDLTEVQNWLKQGDTPCGATVTFTGLVRDEEGGLDGLYLEHYPGMTQNALDNIIQQARQRWSLGPVCIHHRIGWLTPGDNIVLVALASPHRAEAFEAAEFLMDYLKRDAPFWKKERINGEEHWVEQKESDRQAAKRWQTE. 151
113 1.000e-51gi|385329971|ref|YP_005883922.1| molybdenum cofactor biosynthesis protein E [Marinobacter adhaerens HP15]  clstr ali  36  1.MISVQSDDFDVAAEYAALRDSGAGTGAIATFTGLVRDSGDGVTGLYLEHYPGMTEQVIQGLIDDASKRWDVRKARVIHRVGRLALCDQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITSDGEHWVEQKESDRARSEDWK... 148
114 1.000e-51gi|387889910|ref|YP_006320208.1| molybdopterin converting factor subunit 2 [Escherichia blattae DSM 4481]  clstr ali  42  5.RIRVGHDGFSVGDEYQWLAQCDAD-GAVVTFTGKVRNHNDSVSALTLEHYPGMTEKALAEIVASARERWPLQRVSVIHRTGELWPGDEIVFVGVTGAHRGSAFEAAEYIMDYLKTRAPFWKREKTADGDRWVDARESDQQAASRW.... 150
115 2.000e-51gi|383934401|ref|ZP_09987842.1| molybdopterin synthase catalytic subunit [Rheinheimera nanhaiensis E407-8]  clstr ali  41  3IFVAVQSDDFCVASEYNELRRQS-GCGAIVTFSGLVRELSDNLHSMTLEHYPGMTEQALTAIAEQAQQRWQLGAVHLIHRVGTLKPHEQIVFVGIASPHRAAAFAACEFIMDYLKNRAPLWKKEHTSNGDYWVEAKTSDQHALTRWD... 149
116 2.000e-51gi|84393379|ref|ZP_00992138.1| Molybdenum cofactor biosynthesis protein E [Vibrio splendidus 12B01]  clstr ali  39  10.RVLVTAEDFSVGGEYDYLAQGT-AAGAVVTFVGKVRDMNDNVIGLSLEHYPGMTEKSLSEICDQAEARWPIQKMRVIHRVGDLDIGDQIVYVGVSSAHRGAAFEACEFVMDFLKTKAPFWKKERTTEATRWVDSRDSDAKAAERWKK.. 157
117 2.000e-51gi|89070178|ref|ZP_01157506.1| Molybdopterin converting factor subunit 2 [Oceanicola granulosus HTCC2516]  clstr ali  46  1MSVRVQPEPFDAGAELNAFAARASGAGAVVTFTGLVRDISGGLAHMEIEHYPGMTERAISSIVAEATERFGLDAALVIHRHGRLAPAEPIMMVATAARHRGSAFEAAVFLMDYLKSRAPFWKKEVTADGAEWVAARDEDEAALSRW.... 146
118 2.000e-51gi|374336023|ref|YP_005092710.1| putative molybdenum cofactor biosynthesis protein E [Oceanimonas sp. GK1]  clstr ali  39  1.MIRVQTEDFCLATEYAALSQSH-QTGAVVTFVGKVREMNQGVSGMTLEHYPGMTEHALAQIVSEAQGRWPLLECRVIHRVGALELGDQIVFVGVASAHREAAFAACHFIMDYLKTRAPFWKKERTADGERWVDAKDSDTDAARKW.... 146
119 2.000e-51gi|359396792|ref|ZP_09189843.1| Molybdopterin synthase catalytic subunit [Halomonas boliviensis LC1]  clstr ali  47  7IKVAIQAAPFSMAYGYDDALAGRSDIGAVVSFTGLVRDFNEDVTGLTLEHYPGMTERTLTDIGEQAWQRWSLQAVRIIHRVGYLAPGDPIVRVLVASAHRREAFEACDFIMDYLKTQAPFWKKEHSTQGEYWVTERHSDQQDAARWE... 155
120 2.000e-51gi|120553414|ref|YP_957765.1| molybdopterin biosynthesis MoaE [Marinobacter aquaeolei VT8]  clstr ali  37  1.MISIQTDDFDVGTEYEALRSTGPSTGAIVTFSGLVRDSGDGVTGLFLEHYPGMTEQVIQGLIDEAGRRWDVQRARVIHRVGRLALADQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITREGEHWVEQKESDVARSRNWE... 148
121 2.000e-51gi|290474033|ref|YP_003466907.1| molybdopterin converting factor subunit 2 [Xenorhabdus bovienii SS-2004]  clstr ali  41  3....VQRERFNVGDEYQWLSQCDDD-GAVVTFTGKVRNYNDSVKALTLEHYPGMTEKMLQVIIDEARQRWPLQRISVIHRIGELYPGEEIVFVGVTSAHRSMAFTAAEFIMDYLKTRAPFWKKESLVEGERWVATRESDQEAAGRW.... 145
122 2.000e-51gi|40063018|gb|AAR37874.1| molybdopterin converting factor, subunit 2 [uncultured marine bacterium 560]  clstr ali  34  3.KIVVQTEDFDLTTEVAHTRSNNPQIGAIVSFIGTVRDHPGSISSMTLEHYPEMTEKSLKSIVTEARERWDLQNITIIHRIGKLKVNDQIVLVVTTSKHRQAAFESCHFIMDYLKTDAPFWKKESTEQKEEWVESRESDDEQKKRWQS.. 150
123 2.000e-51gi|260072594|gb|ACX30493.1| molybdenum cofactor biosynthesis protein E [uncultured SUP05 cluster bacterium]  clstr ali  38  3.KINIQKKDFDLTLEVNLARGDDSDIGAVVSFVGTVRDLDDAIQKMTLEHYPGMTEKALESIATQAQGRWPLGNITIIHRVGDLDINDQIVLVVTTSKHRKSAFEACEFIMDYLKTQAPFWKKEHTTNESKWVEAKDNDNDAASRW.... 148
124 2.000e-51gi|365835765|ref|ZP_09377177.1| molybdopterin converting factor, subunit 2 [Hafnia alvei ATCC 51873]  clstr ali  41  7.RIRVGQENFSVGDEYQWLSQCEDD-GAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALGEIVAEARERWPLQRISLIHRVGAMYPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATEQGDRWVDARDSDHQAAKRW.... 152
125 3.000e-51gi|256822551|ref|YP_003146514.1| molybdopterin biosynthesis protein MoaE [Kangiella koreensis DSM 16069]  clstr ali  44  1MLVKVQHEDFDLALVRDYFKQYGAEVGAVVTFTGLVRDFQHQVEALTLEHYPGMTESVLTQLAEDAKSRWNLTGVVIIHRVGTLHPGDNIVLVATASAHRQDAFNSCQYIMDTLKTTAPFWKKEETDHGARWVEAKQSDHGEMDKWQASA 156
126 3.000e-51gi|307545568|ref|YP_003898047.1| molybdenum cofactor biosynthesis protein E [Halomonas elongata DSM 2581]  clstr ali  48  1.MIRVQQQAFDAGDEQRDLLAGRHDIGAVVGFTGLVRDFNEEVQALSLEHYPGMTESALTEIVAEAEARWPLQDVRLVHRVGRLEPGDPIVLVLVASAHRRAAFEACDFIMDYLKTRAPFWKKEHTASGDYWVAERETDHRDARRWETSS 151
127 3.000e-51gi|78484505|ref|YP_390430.1| molybdopterin biosynthesis MoaE [Thiomicrospira crunogena XCL-2]  clstr ali  40  7..VKVQKEDFDLSTEVKMLRKGHKDIGAVVSFVGTVRDINEGISVLELEHYPGMTEKALETIRLEAHQRWPLQSSLIIHRIGEMQPCDQIVLVAVTSRHREAAFEAAHFIMDYLKTNAPFWKKETFPNGERWVDARVTDKEAEARW.... 153
128 3.000e-51gi|410085283|ref|ZP_11282002.1| Molybdenum cofactor biosynthesis protein MoaE [Morganella morganii SC01]  clstr ali  44  5.RIAVQTDNFSVGEEYQWLAGCADD-GAVVTFTGKVRNHNDNVAALSLEHYPGMTEKALADIVTQARERWELQRVTLIHRVGSLYPNDEIVFVGVSAAHRGMAFEAAEFLMDYLKTRAPFWKKETLPEGTRWVDARESDQKAADRW.... 151
129 4.000e-51gi|237748629|ref|ZP_04579109.1| molybdopterin-converting factor subunit 2 [Oxalobacter formigenes OXCC13]  clstr ali  39  1MSIRIQTEDFDLSAELDRLRSDHRDIGAVVSFVGTVRDDDDGILSMELEHYPGMTEAALEEIESRARQRWDILDSIIIHRVGVLKPADQIVLVAVASRHRGEAFRACEYMIDALKTQAPFWKKEQTAKGGRWVKAKDSDESALKKW.... 149
130 4.000e-51gi|419953285|ref|ZP_14469430.1| molybdenum cofactor biosynthesis protein E [Pseudomonas stutzeri TS44]  clstr ali  43  1MSVRVQQAAFDPGAELNALHAANLGIGAVAAFVGYVRDFNDGIAGMFLEHAPGMTEKALGKIIAEAETRWPLLGIDVLHRVGALEPGEPIVFVGVTSAHREAAFEACRFVMDYLKTRAPFWKKESTPAGERWVDGRDSDQAAAERWQR.. 150
131 5.000e-51gi|340385693|ref|XP_003391343.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Amphimedon queenslandica]  clstr ali  40  5..IRIQQEPFDAGSIIEDTGRNTPKTGAVAAFVGRMRDINAGIAQMTLEHYPGMTERAIENICQEASKRWELLDIRVVHRIGPLKPLDTIVLVAVASPHRQNAFLACEFIMDFLKTRAPFWKKETTEDGAEWVESRTSDELAAERWHEKS 155
132 5.000e-51gi|119776660|ref|YP_929400.1| molybdenum cofactor biosynthesis protein E [Shewanella amazonensis SB2B]  clstr ali  37  5.RILVQTADFSVPEEYQRIAADNQD-GAVVTFVGKVRDFNEGVSDLTLEHYPGMTEKVLDQIADQARERWPLNHLTIIHRVGTMHLGEQIVFIGVSSAHRKAAFAACEFLIDFLKTKAPFWKLETSDKGQGWVEARDADDQAAKAWEQ.. 152
133 5.000e-51gi|84685239|ref|ZP_01013138.1| molybdopterin converting factor, subunit 2 [Maritimibacter alkaliphilus HTCC2654]  clstr ali  47  3.MIRVQSEPFSLGDEAEAFAKGRTDTGAVVTFTGIVRD-TGGMARMEIEHYPGMTEKAISGIVDQAMDRWSLDDALVIHRYGSLAPGERIMMVATASRHRVAAFEAAEFLMDYLKSRAPFWKKEFGPDGAEWVAAKDEDEDALSRW.... 146
134 5.000e-51gi|312796154|ref|YP_004029076.1| molybdopterin converting factor, large subunit [Burkholderia rhizoxinica HKI 454]  clstr ali  43  1MTVSVQARDFDVTTELARLRARNPRIGAVVSFVGTVRELSDGISALELEHYPGMTERALEAIVAEAERRWAGIDVCVVHRYGRLDAGEQIVLVAVAAAHRGDAFAACEFVMDYLKSNAPFWKKERTEQGERWVDARATDDAALARWGIAS 152
135 6.000e-51METAHIT MH0016 GL0013392 [Complete] locus=scaffold79696_1:5117:5572:-  ali  36  6.KIRVSHDDFDVSEEIAALEREGRNAGAVVTFTGVVR-SDDGVTAMHLEHYPEMTEKSLAQIVEKARARWNIEDVVIIHRVGELKAGDRIVLTVVTSAHRREAFEASEFIMDWLKTEAPFWKKEVTAQGGRWVDARESDEIAKNRWGK.. 151
136 7.000e-51gi|237745842|ref|ZP_04576322.1| molybdopterin-converting factor subunit 2 [Oxalobacter formigenes HOxBLS]  clstr ali  40  2ISIHVQTGDFDLTEEVNRLRSDRRDIGAVVSFLGTVRDIHGDVLSMELEHYPGMTEQVLQEIAEEACRRWDVMDLAVIHRVGKLEPSDQIVLVAAGSRHRGEAFRACEYVIDQLKTRAPFWKKEETPEGSRWVAAKPDDETASRKW.... 149
137 7.000e-51METAHIT V1 GL0028585 [Complete] locus=scaffold64266_1:3615:4124:-  ali  38  1MKIAVQTEDFDVQAEVAAL-HGSPKVGAVVMFLGTVRDLNEGVASMTLEHYPGMTEKALTAIVKEAKKRWDIMDATVIHRVGELFATDQIVFVGVSGAHRGEAFKACEFIIDYLKTEAPFWKKEKVGEGTRWVQAKETDEAAKSKWSKEA 151
138 7.000e-51gi|357025118|ref|ZP_09087253.1| molybdopterin biosynthesis MoaE protein [Mesorhizobium amorphae CCNWGS0123]  clstr ali  46  9..VRIQREDFDVAAEIARLSEGRADIGAVVTFSGLCRDEQGRLSALELEHYPGMAEAEIARIASEAIERWPLHGLTVIHRHGKVRPGGNIVLVVTASAHRQAAFEAANFLMDYLKSRAPFWKKEHHADGSAWVDAKEIDDKAAGRWKAPS 158
139 7.000e-51gi|119897855|ref|YP_933068.1| molybdenum cofactor biosynthesis protein E [Azoarcus sp. BH72]  clstr ali  45  1MSISVQEEDFDVGAEIDALTAGRVDVGAVASFVGLVRDANEGVSAMTLEHYPGMTEQALADIVAEAEARWRLNAVRVIHRYGRLVPGNRIVFVAVAGAHRGEAFAACEFIMDYLKTRAPFWKREETPQGARWVDAREGDAAAAARWG... 149
140 8.000e-51gi|338998524|ref|ZP_08637197.1| molybdopterin synthase subunit MoaE [Halomonas sp. TD01]  clstr ali  43  11IAVRVQEEPFKMDDGYESLLRKRTDIGAIVTFTGLVRDFNEDVIGLTLEHYPGMTERTLTQIGEQAYQRWALQAVQIIHRIGDLTPGDPIVRVLVASAHRRDAFQACDFIMDFLKTQAPFWKKEHSRQGAYWVKERHTDQQAAERW.... 158
141 9.000e-51gi|343509630|ref|ZP_08746895.1| molybdenum cofactor biosynthesis protein E [Vibrio scophthalmi LMG 19158]  clstr ali  41  4.RVAVQVEDFNVGDEYQVLAQGSAS-GAVVTFVGKVRDMNDNVVGLSLEHYPGMTEKALAEICDEAEKRWPLEAIRVIHRVGDMDTGDQIVFVGVASAHRGAAFDACEFVMDYLKTKAPFWKKERTTEATRWVDSRDSDAKAAERWQQ.. 151
142 1.000e-50gi|359450594|ref|ZP_09240025.1| molybdopterin synthase catalytic subunit [Pseudoalteromonas sp. BSi20480]  clstr ali  41  3ISINVQTQDFSVGKQHDALCSNNKSDGAVVTFTGLVREFSDNVIALELEHYPGMTEQLLQSIAEQAQTRWQLARISIIHRVGYLALGEQIVFVGVTSRHRQAAFEGAQFIMDYLKNHATFWKKEHFKDSSNWVEFKQSDKQALNKWQS.. 152
143 1.000e-50gi|322833778|ref|YP_004213805.1| molybdopterin biosynthesis protein MoaE [Rahnella sp. Y9602]  clstr ali  43  5.KIVVDAAPFSVGDEYNWLAQSDAD-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALAEIVAKARTRWPLQRVSVYHRVGPMYPGDEIVFVGVTSAHRGMAFEANEFIMDHLKTRAPFWKREATEEGDRWVDARDSDKQAAARW.... 150
144 1.000e-50JCVI_PEP_1096665653177 /source_dna_id=JCVI_ORF_1096665653176 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  38  5MSVRITEDDFDIALEHEKLKSRD--AGAIVTFTGTVRDNGGGLNAMTLEHYPGMTESEIEMIIDQAKARWPLVNVTVIHRVGRMLPTENIVFVGCSSAHRGAAFDGANFIMDFLKTKAPFWKLEDGPNGAKWVDARDSDSKALDRWN... 151
145 1.000e-50gi|149926844|ref|ZP_01915103.1| probable molybdopterin mpt converting factor (subunit 2) protein [Limnobacter sp. MED105]  clstr ali  42  5.KVLVQEADFDVTEEIRWLRQGLPEIGAVATFIGTVRDINENVSAMTLEHYPGMTEKALENILQVADARFDITSAMIIHRVGPLYPEDQIVFAAATSEHRQQAFLACEFMMDYLKTEAPFWKKEDTPEGSRWVSARDSDDSAKERWEQ.. 153
146 1.000e-50gi|167581667|ref|ZP_02374541.1| molybdopterin converting factor, subunit 2 [Burkholderia thailandensis TXDOH]  clstr ali  44  4..VRVQTDDFDVSAEIAALRARNPKVGAVACFVGTVRDLNEGVDALELEHYPGMTEKALAAIADDAIARWPGIDVAIVHRVGKLRPLDQIVFVATVSAHRGDAFQSCEFVMDYLKTQAPFWKKENTPAGERWVDARSADDAALARWGVES 153
147 1.000e-50gi|163745643|ref|ZP_02153003.1| molybdopterin converting factor, subunit 2 [Oceanibulbus indolifex HEL-45]  clstr ali  45  1MRVLVQEAPFDLAEETARFAKGEGGSGAIVTFTGVVRDNGAGLSAMEIEHYPGMTEKALCEIAEQAMARFELQDALVIHRYGRLVPGEQIMMVASAARHRRSAFEAAEFLMDYLKSRAPFWKREITAEGEAWVAAKDEDEAALERW.... 147
148 2.000e-50gi|398866070|ref|ZP_10621572.1| molybdopterin converting factor, large subunit [Pseudomonas sp. GM78]  clstr ali  38  1MTVRVQYKTFDTGQLIDRLRANDPGVGAVVNFVGYVRDINQGVTSLFLEHYPGMTERSLQKIIDNAKTRWPLKAVEIVHRIGQLSVSDPIVFVGVSSQHRQAAFDACAFIMDYLKTDAAFWKREDVASRARWVDARDSDRSAAGRWETVS 152
149 2.000e-50gi|192359605|ref|YP_001981980.1| molybdenum cofactor biosynthesis protein E [Cellvibrio japonicus Ueda107]  clstr ali  40  5..IAVQEADFDVGTEYQALIVGDTRAGAHVLFVGRVRDMNMEVQGLFLEHYPGMTEQVLQSLVDDARKRWELLGVRLIHRVGYLRPGDQIVLVATSSAHRAHAFEAAEFLMDLLKTKAPFWKKEHSSGGAVWLESRAQDNEAGKRW.... 150
150 2.000e-50gi|378822294|ref|ZP_09845096.1| molybdopterin converting factor, subunit 2 [Sutterella parvirubra YIT 11816]  clstr ali  41  7..IRVGEAPFDAGAETAALYAGDPSVGGVATFVGVVRNRNDGVAKLTLEHYPAMTEKALAGIVKRARARWTLGAVTVIHRVGPLDVSDPIVFVGVAAEHRGEAFAACEFIMDWLKTEAPFWKKEATPEGERWVDARESDDKAKARWGE.. 154
151 2.000e-50gi|121610554|ref|YP_998361.1| molybdopterin biosynthesis MoaE [Verminephrobacter eiseniae EF01-2]  clstr ali  41  5.RVVIQTQDFDLSSEIAALRRDNRGVGAVCSFVGVVRDRNDAVLSIELEHYPGMTEKSIEAMVDEAVRRFDIVGARVIHRVGRLQPLEQIVLVAVASAHRGQGFQACEFLIDYLKTQAPFWKKEHTPQGVRWVDARVSDDAALARWG... 163
152 2.000e-50gi|332143247|ref|YP_004428985.1| molybdenum cofactor biosynthesis protein E [Alteromonas macleodii str. `Deep ecotype`]  clstr ali  36  1.MISVQRGDFDHCEQYQALKEEADGDGAVVTFTGLVRDFNGAVSGIRIEHYPGMTEKSLMHICSEARKRWQLGQIRVIHRVGTIGPQEQIVFVGVTSKHRKNAFEACEFIIDYLKTSAPLWKQEGTSEGMKWVTSRSSDQEAMDRWANTA 151
153 2.000e-50gi|119945827|ref|YP_943507.1| molybdopterin biosynthesis MoaE [Psychromonas ingrahamii 37]  clstr ali  36  1.MIRVQTEDFNQQREYDRLREQS-SVGAVVTFTGLVRDFNQGVASLTLEHYPLMTEKSLAQIVMQAKQRWNILACTLIHRVGELKISEQIVFVGIATAHRQDAFAACEYIMDYLKTEAPFWKKECNSQGSYWVDARESDRSALNKWS... 148
154 2.000e-50gi|17987537|ref|NP_540171.1| molybdopterin (MPT) converting factor, subunit 2 [Brucella melitensis bv. 1 str. 16M]  clstr ali  41  11..ISVRSEDFDIAAEIDRIGKNRREIGAIVTFTGLCRDEDGQLAALELEHYPGMAQAEISRMAKQALERWPLNGLTIIHRYGLIKPGENIVLVVAASRHRHAAFEAASFLMDYMKTNAPFWKREHLADGTAWVSSKEEDEESRKRWEE.. 158
155 3.000e-50gi|377555639|ref|ZP_09785367.1| molybdenum cofactor biosynthesis protein E [endosymbiont of Bathymodiolus sp.]  clstr ali  34  3.KIVIQEKDFDLSTEVALVQTNDGNIGAVVSFVGLVRDLSDPIQKMTLEHYPGMSEKALQSIVDKARKHWSLGNITIIHRVGDLAVNEQIVLVITTSKHRKNAFDACEFMMDYLKTQAPFWKKEVSKDGSKWVESKDSDQDRIKQHQD.. 150
156 3.000e-50gi|149376211|ref|ZP_01893975.1| Molybdopterin converting factor, large subunit [Marinobacter algicola DG893]  clstr ali  40  1.MIRVQQQDFDPAEEYRALRNSGSGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEQVIEGLVLEASRRWDVRDARIIHRVGSLALADQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKEITGDTEHWVEQKAADLDRTQSWD... 148
157 3.000e-50JCVI_PEP_1096695085025 /source_dna_id=JCVI_ORF_1096695085024 /offset=0 /translation_table=11 /length=206 /full_length=206  ali  41  47.RVLIQTADFDVSAEIDALRAQDLRVGAVCSFVGTVRDTQDEVQAMELEHYPGMTEKSIEAMIDEAHTRFDFYGARVVHRVGRLLPADQIVLVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGAHWVDARVSDDAALARWGIQA 202
158 4.000e-50gi|407974522|ref|ZP_11155431.1| molybdopterin converting factor subunit 2 [Nitratireductor indicus C115]  clstr ali  46  2...RVQQEDFDLSEEVAALTAGRRDVGAVVSFAGLCRDENGRLTALELEHYPGMAEAEISRIAAEALGRWPLTGLTVIHRFGKILPGGNIVLVVASSEHRRAAFEAADFLMDFLKSKAPFWKKEHTVDGTQWVTAKDSDEEDIKRWK... 147
159 4.000e-50gi|22126896|ref|NP_670319.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Yersinia pestis KIM10+]  clstr ali  44  7.RIRVGAEAFSVGDEYTWLSQCDED-GAVVTFTGKVRNHNLGVSALTLEHYPGMTEKALTEIIADARSRWSLQRVSVIHRVGPLFPGDEIVFVGVTSAHRSMAFEAAEFIMDYLKTRAPFWKREATVEGERWVESRDSDHIAAKRW.... 152
160 4.000e-50gi|119476719|ref|ZP_01617029.1| Molybdopterin biosynthesis MoaE [marine gamma proteobacterium HTCC2143]  clstr ali  40  6MSVSVQQQDFDVSAELRRLRDQSAQVGAVASFVGVVRDINDTVSVLELEHYPGMTEQSIADIIIMAGERWQLVGARVIHRVGKLLPTDQIVLVAVTSRHRGDAFAACEFIMDYLKTRAPFWKKEQTEEGARWLDARSADQAAVDRWEQ.. 155
161 4.000e-50gi|377579757|ref|ZP_09808719.1| molybdopterin synthase catalytic subunit [Escherichia hermannii NBRC 105704]  clstr ali  44  5.RIRVGHEGFSVGDEYQWLASCDED-GAVVTFTGKVRNHNLGVSAMTLEHYPGMTEKALAEIVAEARQRWALQRVSVIHRIGELWPGDEIVFVGVTGAHRSQAFEAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDHQAAERW.... 150
162 5.000e-50gi|344339974|ref|ZP_08770901.1| molybdopterin biosynthesis MoaE protein [Thiocapsa marina 5811]  clstr ali  40  3.RIRVQHDLFDSAEEQKILSRDKPRVGAVVTFVGLMRDFNEGVVAMTLEHYPGMTEKALGAIAEEAAQRWDLEDISILHRVGELRPQDPIVFVGVSSRHRGEAFRACEFLIDSLKTRAPFWKKEQTSEGERWVDARVTDDAAARRWAE.. 151
163 5.000e-50gi|407781408|ref|ZP_11128627.1| molybdopterin biosynthesis protein MoaE [Oceanibaculum indicum P24]  clstr ali  40  1.MIRVQREDFDIGAEIAALTDGNHAIGGVASFTGLVRDMDAGIGAMTLEHYPGMTEKALARIEAEAQERWPLQASLIIHRYGRLEPGDRIVLVVTASAHRQAAFDSAMFLMDYLKTQAPFWKLEETGEGAQWVDARESDDHALARW.... 147
164 5.000e-50gi|84499779|ref|ZP_00998067.1| molybdopterin converting factor, subunit 2 [Oceanicola batsensis HTCC2597]  clstr ali  53  1MKVAVQEAAFDLGAEANAFAAGHREMGAVVTFSGLVRA-DGGLAALEIEHYPGMTEKAIRTIAEEARDRWSLGDVLVIHRHGRLEPGEAIMMVATAAPHRRDAFEAAEFLMDYLKSRAPFWKKEIGAEGTAWVAAKDEDEAALGRW.... 145
165 6.000e-50gi|334704370|ref|ZP_08520236.1| molybdopterin converting factor, subunit 2 [Aeromonas caviae Ae398]  clstr ali  39  4.RILVQRDDFSLADEYARLAARQD-TGAIVSFVGKVRDFNQGVKGLALEHYPGMTEKALTNIVAEARGRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMDFLKTRAPFWKKELTADGQRWVEARASDDAALARWQQ.. 152
166 6.000e-50gi|109898472|ref|YP_661727.1| molybdopterin biosynthesis MoaE [Pseudoalteromonas atlantica T6c]  clstr ali  38  4.IIAVQTEDFDHGVLYDALRQDSLSNGAIVTFSGLVRDFNQGVGDLFLEHYPAMTQISLQQIVSQARARWGLGKIILIHRVGHLAQGDQIVFVGVTSMHRKDAFEAAQFIMDYLKTEAPFWKKESTALGEKWVQANISDTAARQRWTSD. 153
167 6.000e-50gi|126726027|ref|ZP_01741869.1| molybdopterin converting factor, subunit 2 [Rhodobacterales bacterium HTCC2150]  clstr ali  42  1MGVRVQTDPFNAGAELKTFSSVQTNAGAVVTFTGIVRDPDNPLAFMEIEHYPGMTEKALEKICDTAIERWKLADALVIHRYGKLTAGEDIMMVATASKHRKDAFEAAEFLMDYLKSRAPFWKKEHAKDGADWVAQRSEDEDALNRW.... 147
168 6.000e-50gi|319941467|ref|ZP_08015795.1| molybdopterin biosynthesis MoaE protein [Sutterella wadsworthensis 3_1_45B]  clstr ali  39  6..IRVGEADFSLDEELSRIMRESPSAGGVASFVGLVRNKNDGVSRMTLEHYPGMTEKSLAKIAAAARERFHLVDVIVVHRVGELKVGDRIVLCLTSAEHRGDAFAGCEYIMDWLKTEAPFWKKEQTPDGERWVDARESDDKARERW.... 151
169 7.000e-50gi|85705895|ref|ZP_01036991.1| molybdopterin converting factor, subunit 2 [Roseovarius sp. 217]  clstr ali  43  1MDVRVQEAAFDLGSEANAFVAKQSGMGAVVTFTGIVRDLDGALSTMEIEHYPGMTQKALDTIANEAASRWNLGDILIIHRYGMLHPDDLIMMVATAARHRADAFQAAEFLMDFLKSRAPFWKKEVTEAGTDWVAARDEDEDALSRW.... 147
170 7.000e-50gi|110681207|ref|YP_684214.1| molybdopterin converting factor subunit 2 [Roseobacter denitrificans OCh 114]  clstr ali  46  1MRVVVQDAPFDFGHEAQAFARGHTSMGAIVTFTGVVRDTNEALEAMEIEHYPGMTEAALTDIAEQAISRWSLGNALVIHRHGRLVPGEMIMMVATAARHRKDAFEAAEFLMDYLKSRAPFWKREITSQGASWVAARDEDEAALERW.... 147
171 7.000e-50JCVI_PEP_1096669575741 /source_dna_id=JCVI_ORF_1096669575740 /offset=0 /translation_table=11 /length=151 /full_length=151  ali  35  1MKIYIQKEDFDISFLIQELKKKSNSVGAIASFIGLMRDINDGKTSMTLEHYPEMTKKTLEDICIKAKDKWKIIDLVVAHRYGVININDNIVFVGVASQHRKDAFEACEFIMDFLKTNATFWKKELHLDGSSWVESRKSDDDALNRWQ... 150
172 7.000e-50gi|52425079|ref|YP_088216.1| MoaE protein [Mannheimia succiniciproducens MBEL55E]  clstr ali  35  15IKIAVQEAEFDQNSEYRWLSQSD-SVGASVIFVGKVRDLNDEVSSLYLEHYPAMTEKALNEIVDEAKSRWDIQRVVVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTKAPFWKKEKTDKGERWIESRDSDQQAAEKW.... 161
173 7.000e-50JCVI_PEP_1096676808227 /source_dna_id=JCVI_ORF_1096676808226 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  45  5VEISIQAEPFSLADESAALARSTGDVGAVATFTGYCRSEGGRLSALELEHYPGMAEEEIQRVVDEAVTRWPLMAVRVIHRFGRMTPGDEIVFVGTVSTHRREAFAACEFLMDYLKTRAPFWKKEYLADGGEWVEAKAADDVATLRWAK.. 154
174 8.000e-50gi|332529048|ref|ZP_08405013.1| molybdopterin synthase subunit MoaE [Hylemonella gracilis ATCC 19624]  clstr ali  40  5.RVSIQTNDFNVAAEIAALRARDARVGAVCSFIGTVRDRNEGVSAMELEHYPGMTEQAIEGMIDEALQRFDIYAARVIHRVGLLQPLDQIVLVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKETTPQGARWVDARVSDDEALARWGISA 184
175 8.000e-50gi|284007129|emb|CBA72405.1| molybdenum cofactor biosynthesis protein E [Arsenophonus nasoniae]  clstr ali  38  5.RLVIQQANFNVAEQYEWLAQCQDD-GAVVTFTGKVRNHNDNIKTLTLEHYPVMTEKALQNIANEARCRWQLQRICIIHRIGTLQPGEEIVFVGVTSEHRSSAFSAAEFIMDYMKTKAPFWKKEHFTQGQRWVEARLSDQAAFERW.... 150
176 9.000e-50JCVI_PEP_1096671195973 /source_dna_id=JCVI_ORF_1096671195972 /offset=0 /translation_table=11 /length=172 /full_length=172  ali  44  26.RIIVSHDRFKVGDEY-PWLAERDEDGAVVTFTGKVRNHNDSVKALTLEHYPGMTEKSLAEIVEQARERWPLGRVTVIHRIGEMWPGEEIVFVGVTSAHRGSAFAAGEFIMDYLKTRAPFWKREATPEGERWVDARDSDREAAERW.... 171
177 1.000e-49gi|384215521|ref|YP_005606687.1| molybdopterin converting factor, large subunit [Bradyrhizobium japonicum USDA 6]  clstr ali  39  10VTIRIQQDDFDIAREIAILTGSRTDIGAVVSFSGICRGDEDKIAALTLEHYPGMAEEEIKRHADEATSRWPLNGVTIIHRVGRFMPGQNIVLVLAASQHRQAAFQAAEFLMDYLKTSAPFWKKEESATGTGWVEAHARDDEAAARWTR.. 159
178 1.000e-49gi|145629236|ref|ZP_01785035.1| molybdopterin converting factor subunit 2 [Haemophilus influenzae 22.1-21]  clstr ali  36  4IQIAVQEQPFDQNAVYQWLSEQH-SIGATVIFVGKVRDLNDAVSSLYLEHYPAMTEKALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHRGDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALEKW.... 150
179 1.000e-49gi|386286649|ref|ZP_10063836.1| molybdopterin biosynthesis MoaE protein [gamma proteobacterium BDW918]  clstr ali  41  3VIVRVGEADFDVGAECRALASHSRQSGAIVQFVGLMRDSNQGVLTMELEHYPGMTERCITEIVNRAQQRWPLFAVTVIHRVGVLQPQDQIVFVGVSAAHRLDAFQSCEFIMDYLKTEAPFWKKECTLNGERWVDARQTDQQARKRWQD.. 153
180 1.000e-49gi|227113007|ref|ZP_03826663.1| molybdopterin synthase large subunit [Pectobacterium carotovorum subsp. brasiliensis PBR1692]  clstr ali  44  5.RIRVGEENFNVGDEYQWLAQCDED-GAVVTFTGKVRNHNKDVSALTLEHYPGMTEKALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDKQAAQRW.... 150
181 1.000e-49gi|359300005|ref|ZP_09185844.1| molybdopterin-converting factor subunit 2 [Haemophilus [parainfluenzae] CCUG 13788]  clstr ali  37  6..IQVQEDNFDQNAIYQWLSAEH-SVGATTLFVGKVREMNDNVSGLYLEHYPAMTEKALQEIVAQARQRWDLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKTRAPFWKRETTQEGERWIEGRESDQQAADKWE... 151
182 1.000e-49gi|254467079|ref|ZP_05080490.1| molybdopterin converting factor, subunit 2 [Rhodobacterales bacterium Y4I]  clstr ali  47  1MRISVQEAPFELGAESDAFATGVAGAGAVVTFTGVVRDADGGLTAMEIEHYPGMTEKALTAIAEEAMKRWSLADALVIHRHGRLTPGERIMMVATAARHRKDAFEAAEYLMDYLKSRAPFWKKEILAGGSDWVAAKDADEDALKRW.... 148
183 2.000e-49gi|188534382|ref|YP_001908179.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia tasmaniensis Et1/99]  clstr ali  41  4.RIRVGDAPFSMGDEHRWLSASDLD-GAVVTFTGKVRNHNDDVNALTLEHYPGMTEKALAAIVAEARQRWAMQRVTIIHRIGELFPGDDIVLVGVSAVHRGAAFDAAEFIMDQLKTRAPFWKREATADGQRWVAARESDRHAAARWK... 150
184 2.000e-49JCVI_PEP_1096669731989 /source_dna_id=JCVI_ORF_1096669731988 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  40  1.MISVQTEDFNVAAEYTALRHQAGDAGAIVLFTGLVRDGSDRTQRLFLEHYPGMTEKQLEAISQQASKRWPLLGVRILHRVGELYPGDQIVLVATASRHRQAAFESADFIMDFLKSRAPFWKKQTSQSESRWIESRESDIDALKRWQE.. 157
185 2.000e-49gi|91791473|ref|YP_561124.1| molybdopterin biosynthesis MoaE [Shewanella denitrificans OS217]  clstr ali  36  5VKIAVQEADFDHAQEYARI-AQDNNDGAVVTFCGKVRDFNEGITRLTLEHYPGMTESVLAQICQQALQRWSINHLTVIHRVGSLDLGEQIVFIGVSSAHRGDAFAACEYLIDFLKTKAPFWKLEATHQGERWLDARDTDEVAANTWQQ.. 153
186 2.000e-49gi|317047402|ref|YP_004115050.1| molybdopterin biosynthesis MoaE protein [Pantoea sp. At-9b]  clstr ali  43  5.RIRVGSAAFNVAEEYAWLSAHDSD-GAVVTFSGKVRNHNDSVAALTLEHYPGMTEKALTEIVEEARQRWALQQVSVIHRVGELFPGEEIVFVGVSSAHRSSAFAAAEFIMDYLKTRAPFWKREATAHGDRWVDARDSDHQAAERWK... 151
187 2.000e-49gi|209695347|ref|YP_002263276.1| molybdopterin-converting factor subunit 2 [Aliivibrio salmonicida LFI1238]  clstr ali  39  1.MISVQEHDFNVGDEYNLLAEGTAS-GAVVTFIGKVRDMNDDVTGLSLEHYPGMTEKSLNDIVAQSKERWRLLKVKVIHRVGDLELGDQIVFVGVSSAHRGAAFESCEFIMDYLKTNAPFWKKERTTKEVRWVESRDTDKSAAQRWEK.. 148
188 2.000e-49gi|410636755|ref|ZP_11347346.1| molybdopterin synthase catalytic subunit [Glaciecola lipolytica E3]  clstr ali  34  8ISINIQKNDFDHGLEYTQLKEHSDQHGAIVTFTGLVRDMNEQVTGLFLEHYPGMTEKVLQKLAAEAAQKWSLGAITIIHRIGQLDVNQQIVFVGVTATHRGEAFDACQFLMDFLKTQAPFWKKEQRGSSAHWLDKRLSDEFAAKKWKE.. 157
189 2.000e-49gi|75676707|ref|YP_319128.1| molybdopterin biosynthesis MoaE [Nitrobacter winogradskyi Nb-255]  clstr ali  43  5ITIRLQEADFDLAHEVAALSRGRTDIGAVVTFSGICRGDEDGIAALTLEHYPGMAEAEIARHAEEAVSRWPLTGITVIHRYGRIVPGENIVLVVTASSHREAAFQGAEFLMDYLKTKAPFWKREEGASGSGWVDAHDRDDTAAARWAK.. 154
190 2.000e-49JCVI_PEP_1096666532085 /source_dna_id=JCVI_ORF_1096666532084 /offset=0 /translation_table=11 /length=179 /full_length=179  ali  35  28.RLRIQTEDFDLATEYQFLRQPSSSVGAVVTFTGLVRDFEGSIDSLSLQHYPGMTEKLLQEIVDQANSRWNLIGTTVIHRVGKLLPCDQIVFVGVASQHRADAFEAAQFIMDYLKTKATFWKKVDQDGQQHWVESKDSDQAASQRWTTD. 177
191 3.000e-49gi|91788069|ref|YP_549021.1| molybdopterin synthase subunit MoaE [Polaromonas sp. JS666]  clstr ali  41  5.RVLITTEDFNLADEVAVLRANDSRVGAVCTFTGTVRDRNGEVLSMELEHYPGMTEKAIEAMIDEAMVRFDIFGVRVIHRVGLLQPLDQVVMVAVTSAHRGESFKACEFLMDYLKTQAPFWKKEQTPEGARWVDARVSDDAALAKWGIQA 185
192 3.000e-49gi|197103744|ref|YP_002129121.1| molybdopterin converting factor subunit 2 [Phenylobacterium zucineum HLK1]  clstr ali  68  1.MIRLTDQPFDPGALLGEFSRARTETGAVATFTGIARAEQGSTAVLELEAYPGFTEAHIGKIAEEAKRRFGLHDLAILHRVGRIAPGEPIVFVATAAGHRRAAFEACDFLMDYLKSKAPFWKKEHGPGGARWIEPTAQDHADRARWEKE. 148
193 3.000e-49gi|110634328|ref|YP_674536.1| molybdopterin synthase subunit MoaE [Chelativorans sp. BNC1]  clstr ali  46  6.HIRVQAEDFDLAVEIDRLTDGRRDVGAVVTFTGKCRDEGGRLAALELEHYPGMAEAEMTRIARQAAERWQLSGLTVVHRYGKIRPGENIVLVVTASSHRKAALEAADFLMDYLKSRAPFWKKEHLTDAGQWVEAKAEDENALERWKK.. 154
194 3.000e-49gi|393759909|ref|ZP_10348721.1| molybdopterin converting factor [Alcaligenes faecalis subsp. faecalis NCIB 8687]  clstr ali  35  1.MVRIQTEDFDVAALNAELRATAGGAGAMVTFTGYVRDQADGTTSLFLEHYPGMCEREIETVCEQARQRWPILDTLVVHRVGELHLTEQIVYVGVTSAHRGDAFRACEFIMDVLKTRAPFWKRETLADGKRWVQQRDSDAQKTDSWNNSA 153
195 3.000e-49gi|127511025|ref|YP_001092222.1| molybdopterin biosynthesis MoaE [Shewanella loihica PV-4]  clstr ali  40  7.RVLVQTQDFSVPDEYARI-AADDSDGAVVTFVGKVRDFNDGVTDLTLEHYPGMTEAVLNQIAVEARERWPLTHVTIIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDQGKNWVEAKDADEQAAKMWEKQ. 155
196 3.000e-49METAHIT V1 GL0111328 [Complete] locus=scaffold55032_4:6961:7416:+  ali  32  1VKISVQTEDFDVQKEYGELKA-NPHAGAVVMFVGNVRDINEGIEKMSLEHYPGMTEKSLTKIVKEAQERWHIQDATVIHRVGDLEINDQIVFVGVSGGHRGECFDACEFIIDYLKTEAPFWKKETIDGKGKWVDARESDDEAMSKWN... 148
197 3.000e-49gi|114561273|ref|YP_748786.1| molybdopterin biosynthesis MoaE [Shewanella frigidimarina NCIMB 400]  clstr ali  37  8IVVRVHTEDFSVADEYALL-ACDKQDGAVVNFVGKVRDFNDGVTDLTLEHYPGMTESVLLQISQQACERWPLNKVTIIHRVGRLSLGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGDTGAKWVEARDSDQQAAKMWQK.. 156
198 3.000e-49gi|372279334|ref|ZP_09515370.1| molybdopterin converting factor subunit 2 [Oceanicola sp. S124]  clstr ali  47  7..IRVQSAPFDPGAELSAFTAARAGCGAVVSFTGLVRDLSGGLSAMEIEHYPGMTEKALAGIAADASGRWDLGPVLILHRYGRLGAEEPIMMVATASRHRRAAFEAADFLMDYLKSRAPFWKKESTDAGASWVAAKDEDEDALSRW.... 152
199 3.000e-49gi|238920525|ref|YP_002934040.1| molybdopterin converting factor, subunit 2, putative [Edwardsiella ictaluri 93-146]  clstr ali  42  6..IVVSAAPFSVAEQYQWLAQRDED-GAVVTFSGKVRNHNDDVSALTLEHYPGMTEKALAEIVALARRRWPLGRIAVYHRVGPMFPGEEIVFVGVTSAHRGMAFEAAEFIMDYLKTRAPFWKRETSEGADRWVDARDSDRQAAERW.... 150
200 4.000e-49gi|332290526|ref|YP_004421378.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Gallibacterium anatis UMN179]  clstr ali  38  4IEISVQTEPFDQNAIYQ-WSSASAESGATVIFVGKVRDMNDNVSGLYLEHYPAMTEKALREIAEQAAQRWQLQRIYIVHRVGQLYTGDEIVAVAVSSAHRGSAYQANEFIMDFLKTKAPFWKKETTKSGDRWLDSRESDQQAAHRWE... 151
201 5.000e-49gi|126172540|ref|YP_001048689.1| molybdopterin biosynthesis protein MoaE [Shewanella baltica OS155]  clstr ali  38  7..VRVQEVDFSVTDEYRQL-AQDDSDGAVVTFVGKVRDFNDGVTDLTLEHYPGMTEAVLEQIVVEARSRWPLNKVTVIHRVGTMALGEQIVFIGVTSAHRKAAFAACEFLIDFLKTKAPFWKLEAGEQGKSWVEAKDADEQAAKLWQHK. 154
202 6.000e-49gi|390449047|ref|ZP_10234659.1| molybdopterin converting factor subunit 2 [Nitratireductor aquibiodomus RA22]  clstr ali  48  8.LVRVQAGDFDLATEARRLTDGRRDVGAVVSFTGLCRDEDGRLEALELEHYPGMAEAEIGRIADEAAQRWPLSGLTVIHRFGRIAPGENIVLVVAASAHRRAAFEAADFLMDYLKSRAPFWKKEHAAGETEWVEAKDRDQEDMKRWER.. 156
203 7.000e-49gi|288942798|ref|YP_003445038.1| molybdopterin biosynthesis MoaE protein [Allochromatium vinosum DSM 180]  clstr ali  38  4..IRIQTEPFDIRAEQEALFQDNPRVGALVTFVGLMRDLNEGVARMMLEHYPGMTEKALSALVAEAGERWDLEGIRLVHRVGTLEPLDPIVFVGVVSQHRGDSFRACEFLIDALKTRAPFWKKELTETGERWVEERATDLEAARRW.... 149
204 9.000e-49gi|145299688|ref|YP_001142529.1| molybdopterin converting factor, subunit 2 [Aeromonas salmonicida subsp. salmonicida A449]  clstr ali  39  11.RILVQREDFSLADEYASLATRADS-GAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALADIVQEARRRWPLQECTLIHRIGELWLGDQIVLVAVSSAHRDAAFDACHFIMDFLKTRAPFWKKELTAEGQRWVEALDRDNAAAARWK... 158
205 9.000e-49gi|386390434|ref|ZP_10075223.1| molybdopterin converting factor, subunit 2 [Haemophilus paraphrohaemolyticus HK411]  clstr ali  35  5.LVKVQTEPFDQNEVYHWLSEHH-SVGATTIFVGKVREMNDDVSGLYLEHYPAMTEKSLHEIVEEARSRWELQRIAVIHRIGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTNHGERWIEGRDSDQQAAVKW.... 150
206 1.000e-48gi|296136546|ref|YP_003643788.1| molybdopterin biosynthesis MoaE protein [Thiomonas intermedia K12]  clstr ali  44  4ITIRIQTEPFDLGAELQALRAGRLDVGAIASFVGLCRDHHPGVQAMELEHYPGMTERAIADMVHEAQARWPLLGVTVIHRVGRLLPGDDIVLVLVASAHRAAAFAACEFLMDYLKTQAPFWKKETTPEGGQWVDARESDDAALRRWGVES 159
207 1.000e-48gi|410621881|ref|ZP_11332720.1| molybdopterin synthase catalytic subunit [Glaciecola pallidula DSM 14239 = ACAM 615]  clstr ali  35  8..ISIQAHDFDHACVYAKIQKNADSDGAIVTFTGLVRELTGNLHYMTLEHYPEMTQKSLMNICEQARQRWPLGAINIIHRIGKLTPDEQIVFVGVSSKHRKAAFAATEYIMDFLKTKAPFWKKEVSSEGEFWVQAKLSDKQKADDW.... 153
208 1.000e-48JCVI_PEP_1096678544949 /source_dna_id=JCVI_ORF_1096678544948 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  36  5..VLIQNADFDFAYEYQSLLDNNNKDGAVVCFVGLVRDYNQGVSGLTLEHYPGMTEKALRDIVIKAKKRWPVGQVRVIHRIGELKLSEQIVFVGVTSKHREAAFAANQFIMDYLKNDAPFWKKEQTNKGDRWVEAEKKDLDAKNRWDHTS 154
209 1.000e-48gi|407786747|ref|ZP_11133891.1| molybdopterin converting factor subunit 2 [Celeribacter baekdonensis B30]  clstr ali  45  5VRISVQAEDFDLATELSGF-GHAANTGATVTFTGLVRDDTGALQHMEIEHYPGMCEDAIRKIADEAANRWALTDCLVIHRFGRLVPGEQIMMVATAARHRSEAFAAAEFLMDYLKSRAPFWKKEVTREGAEWVAAKDSDEDALSRW.... 149
210 2.000e-48gi|297183999|gb|ADI20119.1| molybdopterin converting factor, large subunit [uncultured alpha proteobacterium EB080_L06A09]  clstr ali  45  1MAVLIQEEDFNLSDELKLLKAGKGDAGAIISFIGSVRG-DKSLRALELEHYPNMTLSSLEEIQDKAISRWKLIDVRIIHRFGYLSLGEQIMMVAVASQHRREAFEAADYIMDFLKSRAPFWKKEHSDTGSTWVDANPEDEKSLARW.... 145
211 2.000e-48gi|254470068|ref|ZP_05083472.1| molybdopterin converting factor, subunit 2 [Pseudovibrio sp. JE062]  clstr ali  46  10..VRVQAEDFDVLAETEILTKGRKDVGAIVTFTGLCRDEGGTLEALELEHYPGMAEAQISKFAQQAVERWPITGLTIIHRFGKIPPGENIVLVIATSPHRRAAFEAADFLMDFLKTQAPFWKKEHLKDASEWVEAKAADDADAARWNEE. 158
212 2.000e-48gi|114765532|ref|ZP_01444640.1| molybdopterin converting factor, subunit 2 [Pelagibaca bermudensis HTCC2601]  clstr ali  47  7LRVVVQEAPFDFGVEAERFAAGRTDLGAVVTFTGVVRDVAGGLEGMEIEHYPGMTEKALTKIASEAQARWSLGEVLVIHRYGKMAAGERIMMVATASAHRQHAFEAAEYLMDYLKSRAPFWKKESAGGDQSWVAAKDEDEAALDRW.... 152
213 2.000e-48gi|296116313|ref|ZP_06834929.1| molybdopterin biosynthesis MoaE protein [Gluconacetobacter hansenii ATCC 23769]  clstr ali  43  4IHIRVQTEIFDPTHESASLLAGHSDVGAMASFIGMVRE-DGGLRSLELEHYPGMTESMMTRIAESAATRFGLSGCTIIHRVGRLGVGAPIVLVICTAAHRGTAFQAVEFVMDWLKSRAPFWKKEEFSDGTQWVQPREHDAQCLRRWDD.. 151
214 2.000e-48gi|163759151|ref|ZP_02166237.1| probable molybdopterin mpt converting factor, subunit 2 protein [Hoeflea phototrophica DFL-43]  clstr ali  45  20VTVRIQAEDFDIASEIAALAEGRADIGAVATFTGLCRDEGGRLSSLELEHYPGMAERAIRTIANEAAKRFALTGITAIHRYGKIAPGCNIVLVVATAPHRQAAFDGASFLMDYLKTEAPFWKKEHRKGGGEWVSAKDSDDRAKARWDK.. 169
215 2.000e-48gi|170748678|ref|YP_001754938.1| molybdopterin biosynthesis MoaE protein [Methylobacterium radiotolerans JCM 2831]  clstr ali  47  12..VGIQAEPFDTAAEIAGLSAAGGRAGAVVTFTGLCRDEGGRLTALELEHYPGMAEAEIRRVADEAMARWPLQALRVIHRHGLVRPGDGIVLVVTAASHRVAAFEAADFLMDYLKTRAPFWKREHLADGTTWVDATAQDEVAAGRWG... 159
216 2.000e-48gi|261855205|ref|YP_003262488.1| molybdopterin biosynthesis MoaE protein [Halothiobacillus neapolitanus c2]  clstr ali  37  1MKISVQTEDFDVNSVLAELRGRCAHVGAVACFLGTVRDMNDDVAVLTLEHYPGMTERALERVATEAKSRWPVAGVTIVHRYGALFPSDQIVLVAVASAHRHDALDACAFMMDYLKTHAPFWKKETDSSGATWVDARESDAVARARW.... 149
217 2.000e-48gi|254475481|ref|ZP_05088867.1| molybdopterin converting factor, subunit 2 [Ruegeria sp. R11]  clstr ali  45  1MRIAVQDGLFDIGEESNRFAASGANAGAIVTFTGVVRGSDNGDVAMEIEHYPGMTERAIRKIADEAMARWSLADVLVIHRHGRLVPGEQIMMVATASRHRLHAFEAAEFLMDYLKSRAPFWKKELLQDGANWVEAKDSDEEALDRW.... 152
218 2.000e-48gi|126728492|ref|ZP_01744308.1| molybdopterin converting factor, subunit 2 [Sagittula stellata E-37]  clstr ali  45  1MRIVVQDAPFDFGAEAAGFAAGRHDMGAIVTFTGVVRDVDGGLNAMEIEHYPGMTEKALEKIAAEAMDRWSLGDALVIHRYGRMEAGEQIMMVATAARHRKDAFEAAEYLMDYLKSRAPFWKKEFVGDETGWVAARDEDEAALDRW.... 146
219 2.000e-48gi|114771341|ref|ZP_01448761.1| molybdopterin converting factor, subunit 2 [Rhodobacterales bacterium HTCC2255]  clstr ali  44  1MSILVQKGDFNLSDELKLLKTGDGDAGAIISFIGVVRGDS-SLKALELEHYPKMTITALEEIKHQALKKWELLDVRIIHRFGYLSLGEQIMMVAVASAHRREAFEAADYIMDFLKSRAPFWKKEHSVDGSNWVNVNPEDEKSLTRW.... 145
220 2.000e-48gi|410616941|ref|ZP_11327925.1| molybdopterin synthase catalytic subunit [Glaciecola polaris LMG 21857]  clstr ali  37  4.IIDVQTDDFDQNALYNALRQDSASQGAIVTFSGLVRDFNQGIGGLFLEHYPAMTMHSLTNIVGQARQRWTLGKIIVIHRVGHLAQGDQIVFVGVTSAHRKDAFDGAQFIMDHLKTEAPFWKKETTECGPRWVEANPNDEKARAKWGND. 153
221 3.000e-48gi|126666615|ref|ZP_01737593.1| Molybdopterin converting factor, large subunit [Marinobacter sp. ELB17]  clstr ali  36  15..VSIQNADFDAAQEYAQLRDSGAGTGAIATFTGLVRDSGDGVTGLFLEHYPGMTEQVISDLIAQAGQRWDVRKARVIHRIGRLPLQSQIVFVGVCSAHRGDAFAACEFIMDALKTSAPFWKKELTDAGEHWVEQKASDVARAEGW.... 160
222 3.000e-48JCVI_PEP_1096684705035 /source_dna_id=JCVI_ORF_1096684705034 /offset=0 /translation_table=11 /length=161 /full_length=161  ali  38  1MSVRVQTEDFDVGVESRALQA--DSVGGIALFVGTVRGSDNGVTAMTLEHYPGMTEGELERIEADAMDRWPLERVTIIHRVGRLLAGEQIVLVATASAHRQAAFDAAQFIMDFLKTDAPFWKAEERDGKTSWVEARDSDTAARDKWHDDS 150
223 3.000e-48gi|389693994|ref|ZP_10182088.1| molybdopterin converting factor, large subunit [Microvirga sp. WSM3557]  clstr ali  45  3VTVRIQAEPFDTAGETAVLTGGRADIGAVVAFTGLCRDEGGRLAALELEHYPGMAEAEIGRIAGVAQTRWPILGLTIIHRFGRIGPGEEIVLVLAASAHRQAAFEAASFLMDYLKTHAPFWKREHLKDGTAWVEAKEIDDRALERW.... 150
224 3.000e-48gi|294637134|ref|ZP_06715443.1| molybdopterin converting factor, subunit 2 [Edwardsiella tarda ATCC 23685]  clstr ali  40  5.RIVVNTAHFAVADEYSWLAQCDED-GAVVTFTGKVRNHNDDVSALTLEHYPGMTEKALAQIVEQARARWPLGRVSVYHRIGPMQPGEEIVFVGVTSAHRGMAFQAAEFIMDYLKTRAPFWKREASNGHERWVDARDSDRQAAERW.... 150
225 3.000e-48gi|90419509|ref|ZP_01227419.1| molybdopterin converting factor subunit MoaE [Aurantimonas manganoxydans SI85-9A1]  clstr ali  41  1.MVRIQAENIDIAAEIAAMTGGA-AVGGLVTFSGYCRDEGGRLAALELEHYPGMAEREIARIARETLARWPLFGCRAIHRYGRVAPGEEIVFVACSSAHRQAAFEAASYLMDFLKTQAPFWKREHLVDGSTWVEAKDTDDAATDRWHR.. 148
226 3.000e-48gi|294678554|ref|YP_003579169.1| molybdopterin converting factor subunit 2 [Rhodobacter capsulatus SB 1003]  clstr ali  46  1MQVRVQDASFDFGAELSAFSENRENVGAVVGFLGLVRDDTGNLEALEIEHYPGMCESAIAAMVEEARRRWDLADALVIHRHGRLAVGAQIMMVATAARHRVAAFEAAEFLMDYLKSRAPFWKKEVSRDGTAWVAAKDIDEDALSRWQ... 147
227 3.000e-48gi|254462097|ref|ZP_05075513.1| molybdopterin converting factor, subunit 2 [Rhodobacterales bacterium HTCC2083]  clstr ali  39  1MKILVQDAAFDAGAELNDFTKAQSNMGAVVSFTGIVRDLDAGLKQMDIEHYPGMTERALEKIASDAMGRWNLGDVLVIHRFGALKPEDVIMMVATASKHRKDAFEAADFLMDFLKSRAPFWKKEQTGAAQDWVNSKQEDEDALTRWE... 147
228 3.000e-48gi|152979332|ref|YP_001344961.1| molybdopterin biosynthesis MoaE protein [Actinobacillus succinogenes 130Z]  clstr ali  34  4IRIAVQEAEFDQNAEYRWLSENH-SIGATTIFVGKVREMNDEVASLYLEHYPAMTEKALREIVEEAKQRWDIQRISVIHRVGLLQTGDPIVLVGVSSAHRGDAYAANEFIMDYLKTRAPFWKKEQTAQGERWLESRDSDHQAVGKWSRE. 153
229 4.000e-48gi|323136265|ref|ZP_08071347.1| molybdopterin biosynthesis MoaE protein [Methylocystis sp. ATCC 49242]  clstr ali  43  6..VRVQREDFDVAREEGLLTEGRRDIGAVVAFTGLCRDENGSLTALELEHYPGMAEEEIGRVANEALSRWPLAGLTVIHRYGVIRPGERIVLVVSAGRHRSEAFAAAEFMMDYLKTRAPFWKKERRVDGADWVEARTEDDAAAARWEK.. 153
230 5.000e-48gi|90422423|ref|YP_530793.1| molybdopterin biosynthesis MoaE [Rhodopseudomonas palustris BisB18]  clstr ali  39  5VTIRIQHADFDLAQEITALTASRTDIGAVVSFSGICRG-DGGLAAMTLEHYPGMAEAEIERHAHEACARWPLTGVTVIHRVGRLTPGDNIMMVLTASAHRQAAFQAAEFLMDYLKAHAPFWKREEKADGSDWVAAQQHDDAAAARWDKT. 152
231 5.000e-48gi|257094823|ref|YP_003168464.1| molybdopterin biosynthesis MoaE protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]  clstr ali  43  1MVVRVQEADFDVGAELAALRGKDPQIGALASFVGLVRELNDGVSELTLEHYPGMTERALQAIVSEACRRWAIIDALVIHRVGRLLPTDQIVLVAVAGAHRGDAFAACQFIMDYLKTRAPFWKRELTPEGARWVAAHAADDEAAERWQ... 149
232 6.000e-48gi|89094505|ref|ZP_01167444.1| molybdopterin converting factor, subunit 2 [Neptuniibacter caesariensis]  clstr ali  41  6..VLVQTEDFNIGELSERVRAEDATSGAIVTFTGIVRNTDASLDALYLEHYPGMTEKALEKIADQARQRWELGNIVIAHRVGTLPLNENIVFVGVGSAHRVNAFEAAQFVMDYLKRDAPFWKKEISSQGESWVEQKQSDLDAAEDW.... 152
233 6.000e-48gi|365858162|ref|ZP_09398117.1| molybdopterin converting factor, subunit 2 [Acetobacteraceae bacterium AT-5844]  clstr ali  42  4..IRVQEAPFDQAAETAALTAGRVDVGGVASFLGLCRA-DDGLAALVLEHYPGMTEKALGDIAAEAESRWPLTGCTVIHRYGRILPSEPIVLVLAASRHRTAALEACAFLIDWLKTGAPFWKREEFADGSRWVEARESDDAAAAKWG... 148
234 7.000e-48gi|300023526|ref|YP_003756137.1| molybdopterin biosynthesis MoaE protein [Hyphomicrobium denitrificans ATCC 51888]  clstr ali  39  1MAVRVSTSDFDISAEMARLTNGDTGVGGVALFVGKVRDHKDGLTELVLEHYPGMTEAELERIEAEAQRRFDLSASLVVHRVGSLKPGDNIVLVIACASHRQNAFAAAEFLMDYLKTRAPFWKKEVLASGEHWVDARESDDEAAAAWQ... 150
235 7.000e-48gi|197284510|ref|YP_002150382.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Proteus mirabilis HI4320]  clstr ali  39  6.RISVQNEHFNVGDEYQWL-SECESDGAVVTFTGKVRNHNDEVNTLTLEHYPGMTEKALNDIVEQARARWPLQRVSVIHRVGQLNIGEEIVFVGVTSAHRHSAFESAEFIMDFLKTRAPFWKKEGLANQDRWVDARQSDYDSAKRWE... 153
236 7.000e-48gi|85716036|ref|ZP_01047013.1| molybdopterin biosynthesis MoaE [Nitrobacter sp. Nb-311A]  clstr ali  44  5VTIRLQKEDFDVAREVAALSRGRTDIGAVVSFSGICRGEGDAIAALVLEHYPGMAEEEIARHAEEAVSRWPITGLTVIHRFGRIAPGDNIVLVVTASAHREAAFHAAEFLMDYLKTRAPFWKREEGSSGSSWVDAHDRDDTAAARWAK.. 157
237 9.000e-48gi|192289769|ref|YP_001990374.1| molybdopterin biosynthesis MoaE protein [Rhodopseudomonas palustris TIE-1]  clstr ali  39  5VTIRIQEADFDVAAETAAMTRGRNDIGAVVSFMGLCRGVDDTVAALTLEHYPGMAEEEIQRHADEAIKRWPITALTIIHRVGRLVPGDNIVLVLAASAHRQAAFAAAEFLMDYLKANAPFWKREERSDGSRWVEAHSRDDAALARWSKD. 155
238 9.000e-48gi|357385199|ref|YP_004899923.1| molybdenum cofactor biosynthesis protein MoaE, molybdopterin converting factor subunit 2 [Pelagibacterium halotolera  clstr ali  43  1MSVTLQSEPFDPGTLFNAFLETHHDAGAAVTFTGLVRSTNDPVISMTLEHYPALAQRQLEDLRASAMTRFALRDAEIIHRFGKLYPGEPIVQVMTLAPHRQAAFDGANFIMDILKTTAPFWKKEEGPDGAKWVEAKEGDDKATARWS... 148
239 1.000e-47gi|312883737|ref|ZP_07743457.1| molybdenum cofactor biosynthesis protein E [Vibrio caribbenthicus ATCC BAA-2122]  clstr ali  40  3IKVSVQVEDFSVSYEHQCLSEGS-HSGAVVTFCGNVRDMNLGIKGLTLEHYPGMTEKIINHICSEAISRWSIEKIRVVHRVGELNVGEQIVFVGVASGHRREAFSACEFIMDNLKTRAPFWKKERTTDSTRWIDARSSDSDAVLRWDK.. 151
240 1.000e-47gi|118591892|ref|ZP_01549287.1| molybdopterin converting factor, subunit 2 [Stappia aggregata IAM 12614]  clstr ali  49  6.LVRVQAEDFDLQAESLRLTEGRKDVGALVTFTGLCRDEAGTLAALELEHYPGMAEAELTRIAGEAAARWPLTGLTVIHRFGKIAPGHNIVLVIAASSHRRAAFEAADFLMDYLKTRAPFWKKEHPAEGGSWVEAKTEDDTDAARW.... 152
241 1.000e-47gi|254785164|ref|YP_003072592.1| molybdopterin converting factor, subunit 2 [Teredinibacter turnerae T7901]  clstr ali  36  1.MIRVQQADFDVAGEYRNL-QQHGLAGAIVTFSGLVRDFAGDTERFFLQHYPGMTESVLNKIVSQAQSRWPLLAVTVIHRVGHLQAGDQIVFVGVSSAHRKSAFAACEYIIDLLKTEAPFWKKE----GRQWVDAKQSDQAAADRW.... 141
242 1.000e-47METAHIT unmapped GL0076672 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold25635_1:3:440:-  ali  41  5.KVIVRHEDFDVSREMEELPKGSGSAGAMVAFTGVVRNRNQGDDALTLEHYPGMTESAITAIADKARARWELDDIVVIHRVGRLEVGDQIVLCLVTSAHRGEAFEACEYIMDWLKTEAPFWKKEETPSGSRWVDARESDEK......... 146
243 1.000e-47gi|343519607|ref|ZP_08756586.1| molybdopterin converting factor, subunit 2 [Haemophilus pittmaniae HK 85]  clstr ali  36  4IQIAVQSQTFDQNAVYQWLSESH-SIGASVIFVGKVRDLNDNVSSLFLEHYPAMTEKALREIVEEACSRWQLERVSVIHRVGLLHTGDEIVLVGTASAHRGDAYAANEFIMDFLKSKAPFWKKEQTDQGERWIEARDSDKQALTKW.... 150
244 1.000e-47JCVI_PEP_1096676121441 /source_dna_id=JCVI_ORF_1096676121440 /offset=0 /translation_table=11 /length=153 /full_length=153  ali  35  2..IRVQAEDFDIGNEISIITNQNQNIGGICSFTGLVREFNSKIQAMTLEHYPGMTEKQLSKIENEAHERWDLSDSLIIHRFGCLKPKDRIVLVITASAHRKAAFESCQFLMDWLKTQAPFWKMEETATGSHWVVAKSSDNLEVEKWSAK. 150
245 1.000e-47gi|405379994|ref|ZP_11033839.1| molybdopterin converting factor, large subunit [Rhizobium sp. CF142]  clstr ali  43  7..IRVQREDFDLQTEVDRLSKGKPGIGAIVTFSGLCRDEGGTLSALELEHYPGMAEAEMTRIGELAIERFGLSGLTAIHRFGKIAAGENIVLVVAAAPHRQAAFDGASFVMDFLKTSAPFWKKEHGKDGGTWIAAKDADDTARDRWK... 153
246 1.000e-47gi|338739816|ref|YP_004676778.1| molybdenum cofactor biosynthesis protein E [Hyphomicrobium sp. MC1]  clstr ali  38  1MTVRVSTDDFDISEEMAKLSDGDTAIGGVALFVGKVRGDVKGLVSMTLEHYPGMTEAELARIETEACARFKLSASLIIHRVGELKPGDNIVLVIACAPHRQDAFAGAEYLMDYLKTRAPFWKKETLGDGSQWVDARESDEDAAAAWALTS 153
247 1.000e-47gi|83941420|ref|ZP_00953882.1| molybdopterin converting factor, subunit 2 [Sulfitobacter sp. EE-36]  clstr ali  45  1MKISVQEAGFDLGQESQDFAAGHRDMGAIVTFTGIVRDPDDPLQAMEIEHYPGMTESALTEMAETAIVRFSLGDALVIHRFGRLLPGEMIMMVATAARHRKDAFEAAEFLMDYLKSRAPFWKREITAKGADWVASKAEDEDALARW.... 147
248 2.000e-47gi|159045643|ref|YP_001534437.1| molybdopterin-converting factor subunit 2 [Dinoroseobacter shibae DFL 12]  clstr ali  44  1MTVRVQQAPFALGAELDSFAAGRTDMGAIVSFTGVVRDVTGDLDVMEIEHYPGMTERAIGKIVDEAKARWSLGDALVIHRYGRMGPGDRIMMVATAAPHRVDAFAAAEFLMDYLKSRAPFWKKEISGAGASWVAATDEDEAALTRW.... 147
249 3.000e-47JCVI_PEP_1096693949963 /source_dna_id=JCVI_ORF_1096693949962 /offset=0 /translation_table=11 /length=163 /full_length=163  ali  37  1...KVQEEDFDVGEEFSRMTTGKTAIGGLASFVGLVRDYDGDITSMTLEHYPGMTEKELKRLEADARRRWELEDVLIIHRYGKLSPGDRIVLVVTASPHRGAALESCQFLIDWLKTKAPFWKLEDRTSGKKWVAARDEDSVTANRW.... 145
250 3.000e-47gi|359790115|ref|ZP_09293029.1| molybdopterin converting factor, subunit 2 [Mesorhizobium alhagi CCNWXJ12-2]  clstr ali  48  8.IVRIQAEDFDIAAEIGRLTEGRADVGAVVTFSGLCRDEAGTLAALELEHYPGMXXXXXXXXXXXXLGRWPLTGLTAIHRFGKIAPGENIVLVVAASAHRQAAFEAASFLMDYLKSRAPFWKKEHRVDGSEWVDAKEADDQAAARWKS.. 156
251 3.000e-47JCVI_PEP_1096665705785 /source_dna_id=JCVI_ORF_1096665705784 /offset=0 /translation_table=11 /length=158 /full_length=158  ali  45  11MDVKIQEAAFDVGAEINAFSQRHTKMGAITTFTGIVRDNDDELQAMEIEHYPGMAEKAISEIMQTAVKRWSLGDALVIHRYGTLAPGEIIMMVATAAIHRTDAFQAAEFLMDYLKSRAPFWKKEITKEAVTWVPSRQNDEDALDRW.... 157
252 3.000e-47gi|251792591|ref|YP_003007317.1| molybdopterin converting factor subunit 2 [Aggregatibacter aphrophilus NJ8700]  clstr ali  38  4IQISVQEQTFDQNAVYRWLSEEN-SVGASVIFVGKVRDLNDKVSSLYLEHYPAMTHKALLDIAQQAKVRWDLQKISIIHRVGQLNTGDEIVLVGTSSAHRGDAYHANEFIMDYLKTQAPFWKKEQTTKGERWIEGRDSDYVAAEKWK... 151
253 3.000e-47Oral.Meta HOMD hduc_c_1_2878 Haemophilus ducreyi 35000HP [1137782 - 1137318] molybdopterin converting factor subunit 2  ali  35  10..IEVQQAPFDQHAIYQWL-SEPHSVGATTIFVGKVREMNDNVSGLYLEHYPAMTKKALQEIVNQARQRWELQRIAVIHRIGQLHTGDEIVLVGVSSAHRGDAYLANEFIMDYLKTKAPFWKRETTAEGERWIESRESDEQQLEKW.... 154
254 3.000e-47gi|400753147|ref|YP_006561515.1| molybdopterin-converting factor subunit 2 [Phaeobacter gallaeciensis 2.10]  clstr ali  44  1MRIAVQKDAFDLGEESQRFASDVANAGALVTFTGVVRGSEKGMVAMEIEHYPGMTERAIKTITQEAQQRWSLADALVIHRHGRLVPGEQIMMVATAARHRSDAFEAAEYLMDYLKSRAPFWKKEMTQDGTNWVEAKDSDEEALTRWD... 153
255 3.000e-47gi|388257746|ref|ZP_10134925.1| molybdenum cofactor biosynthesis protein E [Cellvibrio sp. BR]  clstr ali  35  5..IAVQTNDFNVGDEYAQLVENDKDAGAVVFFVGRVREMNQSVSGLSLEYYPSMTERVLDQIMDVARQRWDLISVRIVHRVGQLYLSDQIVFVGVTSQHREHAFQAAEFLMDFLKTQAPFWKKEITAHGEMWVEAKESDQQRAIMWE... 151
256 4.000e-47gi|237653188|ref|YP_002889502.1| molybdopterin biosynthesis MoaE protein [Thauera sp. MZ1T]  clstr ali  43  12..VSVQHEDFDVGGEIARLGEGRRDVGAVASFVGLVRDANDGVRAMTLEHYPGMTERALEEIVEQAKARWSLLSVRVIHRYGRLEPADRIVFVGVTSAHRGEAFAACEFIMDYLKTRAPFWKCEETPQGARWVDARESDDS......... 152
257 4.000e-47JCVI_PEP_1096666341427 /source_dna_id=JCVI_ORF_1096666341426 /offset=0 /translation_table=11 /length=153 /full_length=153  ali  33  3.KIIVQSEDFDITTEVALAKASNSNIGAIVSFVGTVRDESKNLNTMTLEHYPGMTEKSLKSIVDKAKDKWELQSVTIIHRIGKLDVNDQIVLVISASRHRQEAFDSCNFIMDFLKTDAPFWKKESTTKSENWVKSRSQDEEKKKHWKNE. 151
258 4.000e-47JCVI_PEP_1096679717643 /source_dna_id=JCVI_ORF_1096679717642 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  41  3..VKVQSEDFDIGGELAALTDGNMDIGGMVSFVGLVRDLDDALKAMTLEHYPGMTEKMLREIEAEANERWDLEASLIVHRYGRLEPGDRIVLVATASAHRQEAFDACAFLIDWLKTKAPFWKLEESDQGAQWVESKETDDRAAERWERD. 152
259 4.000e-47gi|86139073|ref|ZP_01057644.1| molybdopterin converting factor, subunit 2 [Roseobacter sp. MED193]  clstr ali  46  1MQVRVQEEGFDLGAESDGFAAGVSGAGAIVTFTGVVRDDGGGLEAMEIEHYPAMTQTALEAIATEAKTRWELADALVIHRYGRLLPGERIMMVATAARHRKHAFEAAEYLMDYLKSRAPFWKKEILCDGSDWVSAKADDEAALERW.... 148
260 6.000e-47METAHIT MH0068 GL0004978 [Complete] locus=scaffold10735_12:6632:7087:+  ali  39  6..IRVGEADFSVSDELAKL-NDQADCGAVVSFLGVVRNEGEAVYAMTLEHYSAMTEKALAGIVERARARWQLGDITVIHRVGRLLPGDQIVLVAVAASHRGEAFQACEFIMDWLKTEAPFWKKEETPDGARWVDARVSDDEAKRRWE... 151
261 6.000e-47JCVI_PEP_1096682844481 /source_dna_id=JCVI_ORF_1096682844480 /offset=0 /translation_table=11 /length=180 /full_length=180  ali  39  32..ILIQADDFSLDRALTELKAQSGLAGGLCFFTGAVRNSDDAVGGLYLEHYPGMTERQLDQIVDEAARRWQLHGAIVVHRIGHLKPGDNIVLVAVSASHRGEAFEACEMIMDYLKTNATFWKKESIPDGHRWVEARSSDQAKATAWD... 178
262 6.000e-47gi|339053212|ref|ZP_08647968.1| Molybdenum cofactor biosynthesis protein MoaE Molybdopterin converting factor subunit 2 [gamma proteobacterium IMCC20  clstr ali  40  1MAVTVQTEDFDVPALYQALKADAPQIGAIVTFTGLVREFNEEVEALHLEHYPGMTEQVLEGLIDEATKRWPIINAVIVHRVGELRPADQIVFVGVNSAHRDAAFAAAEYLMDILKTKAPFWKREQRPDGDKWLDAKVSDDERATRWH... 149
263 6.000e-47gi|338971795|ref|ZP_08627176.1| molybdopterin converting factor subunit 2 [Bradyrhizobiaceae bacterium SG-6C]  clstr ali  37  5VTIRIQSADFDIAAEIAALTRGNTDIGAVVTFSGICRGGEGEIAAMTLEHYPGMAEAEIGRHVAEAVARWPLDGVTVIHRYGRVVPGDNIVLVLAASKHREAAFQAAEFLMDYLKTNAPFWKSEERAGDTQWVDAQAHDDNAAARWNK.. 154
264 6.000e-47gi|90022255|ref|YP_528082.1| GntR family transcriptional regulator [Saccharophagus degradans 2-40]  clstr ali  35  1.MIRVQTEDFHLQTEYEQLQK-HGHSGAIVTFVGSVRD-FGGEGSFRLDHYPGMTEKVLEKIEQQANQRWDLISTTIIHRVGNLAAGDQIVFVGVSSRHRKNAFAACEYMIDILKTQAPFWKKE----GDTWVDAKESDSEAADKWLSHS 143
265 7.000e-47gi|237808511|ref|YP_002892951.1| molybdopterin biosynthesis MoaE protein [Tolumonas auensis DSM 9187]  clstr ali  34  4.KILVQQEDFDVAAEYARL-SDNPETGAIVSFIGKVRNFNQDVTGLHLEHYPAMTQLSLEKLVAEAHARWPIQSCTLIHRVGDLTINDQIVLILVASVHRKAAFAACEFLIDELKTSAPFWKKERLTDGSRWVSP............... 139
266 8.000e-47gi|144899724|emb|CAM76588.1| molybdopterin-converting factor large subunit [Magnetospirillum gryphiswaldense MSR-1]  clstr ali  40  1.MIRVQAEDFDPGAELAAFSAGNGKVGGICMFLGLVRDYGAGVSAMTLEHYPGMTERQLAAIEAEARDRWPLHEVLIIHRHGRLEPGERIVLVATASSHREAAFQSCHFLMDWLKTKAPFWKIEHTDQGDQWVAAKDEDDDAARRWTR.. 154
267 8.000e-47gi|420238138|ref|ZP_14742565.1| molybdopterin converting factor, large subunit [Rhizobium sp. CF080]  clstr ali  44  8..IRVQATDFDLQAEITALTAGRKNIGAVVTFTGLCRDEQGALSALELEHYPGMAEAEMLRIGELAIERFSLLGLTAIHRYGKILPGGNIVLVIAAAPHRQAAFDGANFVMDFLKTSAPFWKKEHAADGRQWIAAKDTDDTARDKW.... 153
268 8.000e-47JCVI_PEP_1096681323017 /source_dna_id=JCVI_ORF_1096681323016 /offset=0 /translation_table=11 /length=156 /full_length=156  ali  42  1MSARVQEAAFDFAAEVTAFQSTLTRSGAVVSFTGVVRDDTGSLDHMFIEHYPGMTHAALQKFADQAVEKFGLEKALVIHRYGRLQPGEAIMMVATAAAHRKDAFAGADYLMDYLKSRAPFWKKELSKGSATWVAAKDQDEAALAAWSSES 150
269 9.000e-47gi|114800184|ref|YP_759788.1| molybdopterin converting factor subunit 2 [Hyphomonas neptunium ATCC 15444]  clstr ali  50  1.MIRLTDTPFDPGDELTRFTATAAGSGAIVSFTGLVRGQSKGVQSLFLQAYSPLTERGIAQAAEEARTRWALTGLSILHRTGKMAPEDAIVFVATAAPHRRSAFEAADFLMDYLKTQAVFWKKEVTEAGDQWIEPRPEDYTDAARW.... 147
270 1.000e-46JCVI_PEP_1096683196451 /source_dna_id=JCVI_ORF_1096683196450 /offset=0 /translation_table=11 /length=153 /full_length=153  ali  38  1.MIKLQVEDFDVSRELSVMLSGHKQVGGVCTFVGLVREYDEPLNSLTLEHYPEMTKKELIKIEKQAKEKWTLKDSLIIHRYGRLVPSDQIVFVATASAHRRDAFNSCEYIVDYLKTRAPFWKKEEYKSRVKWVEARSSDEDAVNKWEEVA 151
271 1.000e-46METAHIT unmapped GL0392955 unmapped_[Lack_5`-end]_[mRNA]_locus=scaffold689919_2:2:430:+  ali  40  1........DFDLSEELKRLRDGRQDIGAVVSFLGTVRDIHDDILSMELEHYPGMTELVLGEIVDEARRRWDIVDLTVIHRVGKLKLSDQIVLVAVASRHRRDAFMACEYLIDMLKARAPFWKKEETASGMRWVKAKSSDQDVLDRWKK.. 142
272 1.000e-46JCVI_PEP_1096672812411 /source_dna_id=JCVI_ORF_1096672812410 /offset=0 /translation_table=11 /length=152 /full_length=152  ali  32  6.MIKVQKDDFDINKEIKKITSVNKNIGGTGLFIGNVREKNSELKSMTLEHYPIMTERQLEKINNEAKARWNLIDSLIIHRYGKLYPGDQIVLVATFSRHRTDALNACEFLIDWLKTKAPFWKLEESNQGSTWVKERHSDLDAANKW.... 151
273 1.000e-46gi|113461171|ref|YP_719240.1| molybdopterin synthase subunit MoaE [Haemophilus somnus 129PT]  clstr ali  37  4IKISVQEQNFDQNAIYQWLTEPH-SVGAAVIFIGKVREMNDSVSGLYLEHYPAMTGKALQEIVVEAKKRWQLYRVAVVHRVGLLNTGDEIVLVGVSTAHRGDAYQANEFIMDYLKSKAPFWKKEQTCQGTRWIEHRESDQQALEKW.... 150
274 1.000e-46gi|417356630|ref|ZP_12132132.1| Molybdenum cofactor biosynthesis protein MoaE [Salmonella enterica subsp. enterica serovar Give str. S5-487]  clstr ali  45  5.RIVVGPAPFSVGEEYSWLAARDED-GAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGARWVEARDSDQQSAKRW.... 164
275 1.000e-46gi|332185132|ref|ZP_08386881.1| moaE family protein [Sphingomonas sp. S17]  clstr ali  47  2IRVRVSVDPIDVAAEMAL--AERPEAGAVASFCGLVRA-DDGVDKLELEHYPGATEAALERIAAHAVTRWSLQAATIVHRVGPMHPGERIVFVAAAAPHRGDALDACAYLIDRLKTDAPFWKRETRAGQSSWVEARESDAAAAERWQED. 147
276 1.000e-46gi|118594773|ref|ZP_01552120.1| Molybdopterin biosynthesis MoaE [Methylophilales bacterium HTCC2181]  clstr ali  36  1.MVKIQKEDFSIEKMTTEIKALGSHIGAIVSFIGYVRDENKILLDMHLEHYPGMTEKVLNDIEKKAFSRWDLSAVTIVHRVGVLKSNDPIVAVIVASPHRNNAFDACRFIIDFLKTEAPFWKKESTDSGDYWVDDKKSDLKQKQSWDNQS 153
277 2.000e-46gi|255263118|ref|ZP_05342460.1| molybdopterin converting factor, subunit 2 [Thalassiobium sp. R2A62]  clstr ali  41  1MVVRVQSEAFDAGAELNQFTQTAVGAGAVVSFTGIVRDTADDMRHMKIEHYPAMTQSAIEALCDDARSRWDLAEVLVIHRFGRLAPDEQIMMVATASRHRRAAFESADFLMDYLKSRAPFWKKEVTASGAEWVAAKDQDEDDLARWTQD. 150
278 2.000e-46gi|149203069|ref|ZP_01880040.1| molybdopterin converting factor, subunit 2 [Roseovarius sp. TM1035]  clstr ali  43  1MDIRVQEAAFDLGAEANAFVARQSGMGAVVTFTGIVRDLDGALRAMQIEHYPGMTQKALEKIAEEARERWSLGDVLVIHRYGTLQADAVIMMVATAARHRADAFHAAEFLMDFLKSRAPFWKKEVTEAGADWVAAKDADEDALTRW.... 147
279 2.000e-46gi|398831433|ref|ZP_10589611.1| molybdopterin converting factor, large subunit [Phyllobacterium sp. YR531]  clstr ali  41  7.RIVVQQSDFNIAAEMEHITANCRNIGAVVTFSGLCRDEAGTLAALEIEHYPGMAEAEIARVATDVLERWTLTGLTIIHRFGLIKPGENIVLVLAASIHREAAFNAASFLMDYLKNTAPFWKKEHLITGEEWVEAKSKDQEAFKRWHS.. 155
280 2.000e-46gi|167855766|ref|ZP_02478520.1| hypothetical protein HPS_06125 [Haemophilus parasuis 29755]  clstr ali  34  5.LIQVQQDPFDQNAIYKWLSEQH-SVGATTLFVGKVREMNDSVSGLYLEHYPAMTEKALRAIVDEAKSRWELQRVAVIHRIGQLYTGDEIVLVGVSSAHRGNAYHANEFIMDYLKTKAPFWKRETTDHCDRWIEGRESDQEAADKW.... 150
281 2.000e-46gi|388259657|ref|ZP_10136829.1| molybdopterin biosynthesis MoaE [Cellvibrio sp. BR]  clstr ali  36  5..IRVQTEDFDLKTEYDSLRAISAPCGAVVLFTGLVRDFPQQLVDLTLEHYPVMTEHALHKLVEQARRRWLLLGVTIIHRTGRLMPGDQIVMIGVSSAHRASAFDAVQFLMDKLKTIAPFWKKERYPNESYWVSAKDSDEQLAQRW.... 156
282 2.000e-46gi|254510469|ref|ZP_05122536.1| molybdopterin converting factor, subunit 2 [Rhodobacteraceae bacterium KLH11]  clstr ali  46  5MRIAVQEEEFDLGAEANAFAAGDAANGAIVTFTGVVRDLTGDLDVMEIEHYPGMTERALTKIAQDAKERWSLGDVLVIHRHGRLAPGDRIMMVATASPHRKDAFEAAEYLMDYLKSRAPFWKKEITTSGADWVAAKDEDEDALTRW.... 151
283 2.000e-46gi|149912755|ref|ZP_01901289.1| molybdopterin converting factor, subunit 2 [Roseobacter sp. AzwK-3b]  clstr ali  40  1MDIRVQEATFDLGDEARAFAERQRGMGAVVTFTGIVRDLDGGDDVMEIEHYPGMTEAAIEKIGQEALSRWNLGDILVIHRYGRLRPDDLIMMVATSARHRVDAFQGAEFLMDFLKSRAPFWKKEVTGQEAAWVAARDEDEDALSRW.... 147
284 2.000e-46gi|114705929|ref|ZP_01438832.1| molybdopterin converting factor, subunit 2 [Fulvimarina pelagi HTCC2506]  clstr ali  42  51.KVTVSAERIDIAAETMAL-SGEPGAGALVTFSGFCRDEDGRLSALELEHYPGMAEQEIGKIAEEAAQRWPLIAVRAAHRYGKIAPGEEIVFVACSSRHRGAAFEAASFIMDFMKTKAPFWKREHLKDGSVWVESKATDEAAEDRWHR.. 198
285 3.000e-46gi|163794452|ref|ZP_02188423.1| Molybdopterin converting factor, large subunit [alpha proteobacterium BAL199]  clstr ali  37  1MSVRVQEEDIDIGAELAEMTVGNHAIGGLGVFVGLVRDIAGEVAGMTLEHYPGMTERQLEAIEAEACARWPLQASRIVHRVGRLEPGDNIVLVACASAHRQAALDATAFLIDWLKTKAPFWKLEETRAGAHWVDARESDDAAAARWSR.. 150
286 3.000e-46gi|395786041|ref|ZP_10465769.1| hypothetical protein ME5_01087 [Bartonella tamiae Th239]  clstr ali  34  5..IRVQSEDFNMAEEVKKLQHFNTNIGAIVTFSGYCRDEDNTLIALEIEHYPEMAKKQLHNIIMKAKEQWPLIDATLIHRFGTIPIGEQIVMVSVASSHRKAAFEAASFIMDFLKTDAPFWKKEHYSNQKKWVRAKKDDEIEKYKWS... 151
287 3.000e-46gi|359408769|ref|ZP_09201237.1| molybdopterin converting factor, large subunit [SAR116 cluster alpha proteobacterium HIMB100]  clstr ali  42  4..ITITTDNFNAGDEIEALRLA--GVGAIVTFTGIVRDEHPDLTAMTLEHFPGMTEQEIQAIIDEARTRWPLQGVRVIHRVGRLLPQENIVFVGTASAHRQAAFDSASFIMDYLKTKAPFWKKEETPAGASWVEARDCDDKALEKWQ... 148
288 3.000e-46gi|117924793|ref|YP_865410.1| molybdopterin synthase subunit MoaE [Magnetococcus marinus MC-1]  clstr ali  37  16..IRIQTEDFSAQDEVDALLKANPKIGGVVTFLGTVRDFSDAVTALELEHYPGMTERELERIVAAAHAQFPVEAIRVIHRVGYLEVGQNIVLVIAAGRHRAESFEACRYVIDHLKVRATLWKKEISPSGSRWVESCPGCEAAASQWAD.. 163
289 4.000e-46gi|410613800|ref|ZP_11324854.1| molybdopterin synthase catalytic subunit [Glaciecola psychrophila 170]  clstr ali  33  7..ISVQTQDFDFAYQYQKLRDSNNSDGALVTFVGLVRDMNQSVSGLFLEHYPAMTEKVLNDIVETARVKWHLGSVSVIHRVGQLKVSDQIVFVGVTSQHRQSAYHANEFIMDYLKTQAPFWKKETTTQGDKWIEAKISDIQKSKDWS... 153
290 4.000e-46gi|384920647|ref|ZP_10020653.1| molybdopterin converting factor, subunit 2 [Citreicella sp. 357]  clstr ali  42  3IRILVQEAPFDFAAEADGFAAGRTDLGAVVTFSGVVRDLSGSLDGMAIEHYPGMTEKALDAIAREAEARWSLGEVLVIHRYGEMAAGERIMMVATASAHRKDAFESAQFLMDYLKSRAPFWKKETAAGARSWVAARDEDEAALKRW.... 148
291 4.000e-46gi|222085471|ref|YP_002544001.1| molybdopterin converting factor subunit 2 protein [Agrobacterium radiobacter K84]  clstr ali  41  5.LVKVQREDFDLQTEIDRLTNGRHDIGAVVTFSGLCRDEGGILGALELEHYPGMAEAEIARIATLAIERFNLRGLTAIHRYGKISPGENIVLVIAAASHRQAAFDGANFVMDFLKTSAPFWKKEHAKDGTEWVSAKDADDAAREKWAGD. 154
292 5.000e-46gi|332306473|ref|YP_004434324.1| molybdopterin biosynthesis MoaE protein [Glaciecola sp. 4H-3-7+YE-5]  clstr ali  38  5..IEVQTEDFNQGALYDALRQDSLANGAIVTFSGLVRDFNQGVGDLFLEHYPAMTKASLLNIVTAARARWHFGKIIIIHRVGRLAQGEQIVFVGLTSAHRKDAFDGVQFIMDYLKTEAPFWKKESTSEGDKWVAANVSDTEARLRWDKQ. 153
293 5.000e-46gi|99078604|ref|YP_611862.1| molybdopterin synthase subunit MoaE [Ruegeria sp. TM1040]  clstr ali  47  1MRVVVQEAPFDFAAEAEAFAQGAKGAGAVVTFTGVVREADGGMAVMEIEHYPGMTEKALANIASDAATRWELTDALVIHRHGRLAPGDQIMMVATAARHRVAAFEAAEYLMDYLKSRAPFWKKEILEDGSDWVEAKNSDESALSRW.... 148
294 6.000e-46gi|381157597|ref|ZP_09866831.1| molybdopterin converting factor, large subunit [Thiorhodovibrio sp. 970]  clstr ali  38  5..VRVQLQTFDPEQEQRALREALPGIGAMVSFVGILRDLNHGVHEMVLEHYPGMTEKVLHQLLEEARARWSLAGGRIIHRVGALHPTDAIVLVVTASTHRSDAFRACEFLIDALKTQAPFWKRELTPAGPRWVQTREQDALSAARWKS.. 152
295 6.000e-46gi|349686672|ref|ZP_08897814.1| molybdopterin converting factor large subunit [Gluconacetobacter oboediens 174Bp2]  clstr ali  39  4VTVRVQAEAFDVTHETALLLRGREDVGGVGAFTGIVRG-GGGLVALELEHYPGMTESMMRQIAESACTRFGLTGCTVIHRVGRLEVGMPIVLVLCAAAHRKAALDGTEFMMDWLKTSAPFWKREEFSNGSEWVQPRAQDDAATARWG... 150
296 6.000e-46JCVI_PEP_1096673101969 /source_dna_id=JCVI_ORF_1096673101968 /offset=0 /translation_table=11 /length=198 /full_length=198  ali  45  53..VRVQEAAFDPGQELNAFSATVQGAGAVVSFSGITRDLAEGLDVMEIEHYPGMTEKALQSIREEALTRFSLAGAMILHRYGRLAAGDPIMMVATAARHRADAFAGAEFLMDYLKSRAPFWKKEVTPEGARWVAARAEDEEALTRW.... 197
297 6.000e-46gi|402851665|ref|ZP_10899809.1| Molybdenum cofactor biosynthesis protein MoaE [Rhodovulum sp. PH10]  clstr ali  43  1MTVRIQREPFDTAAEVAALTRGRTDIGAVVTFTGLCRGADDGVAAMTLEHYPGMAEAEIGRWVAEAEARWPLMGVTVIHRYGRLEPGDLIVLVVTTSSHRAAAFEAAEFLMDFLKTEAPFWKKEEGLDGTSWVEAKDHDDTAAARWKAPA 154
298 6.000e-46gi|16124272|ref|NP_418836.1| molybdopterin converting factor subunit 2 [Caulobacter crescentus CB15]  clstr ali  100  1MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARALELEAYPGFTDAAITEIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPFWKKEHGPEGPRWIEPTARDRTDAQRWDQEA 150
299 6.000e-46JCVI_PEP_1096670997415 /source_dna_id=JCVI_ORF_1096670997414 /offset=0 /translation_table=11 /length=150 /full_length=150  ali  33  2..IKVQEEDFSLTDEITFLKKRCNNIGALSTFIGIVRDEDEKLVSMTLEHYPGMTEKMLNKINTEALSRWDLLDTTIIHRYGKLLPGEQIVLVITASKHRKEAIESCHFIIDWLKTKGPFWKYEKTVDKGYWVDAKSQDLDEELKWNN.. 149
300 9.000e-46gi|345872692|ref|ZP_08824622.1| molybdopterin biosynthesis MoaE protein [Thiorhodococcus drewsii AZ1]  clstr ali  41  4..IRVQSAPFDSAAEQAALVGDNARIGALVSFVGLMRDLNAGVSRMRLEHYPGMTEKALAAIADEAAERWELEGIRIVHRVGILEPRDPIVFVGVVSQHRGDAFRACEFLIDYLKTRAPFWKKEVTDAGERWVEARTRDQESADRW.... 149
301 9.000e-46gi|295687509|ref|YP_003591202.1| molybdopterin biosynthesis MoaE protein [Caulobacter segnis ATCC 21756]  clstr ali  82  1MKIVLTDRPFEPGALVTAFCADRAETGAVATFVGLARAEQGQAAALELEAYPGFTEAAIGEIAAQAVARFHLQDVQVVHRVGRIAPGEAIVFVATAAGHRREAFEACDFLMDYLKSRAPFWKKEHGPDGARWIEPTDRDRTDAQRWD... 147
302 9.000e-46gi|152996103|ref|YP_001340938.1| molybdopterin biosynthesis MoaE protein [Marinomonas sp. MWYL1]  clstr ali  42  1.MILVQEEDFNVGALYQSLLKAN-QTGAVAMFVGLVRQFSDEVCSFELEHYPGMTERNLQVIVDEANARWPLLDVCVVHRVGFLSVDDQIVFVGVSASHRAEAFQACDFIMDYLKSRAAFWKKESEGSESRWVEANTNDEKSLERWSK.. 149
303 1.000e-45gi|407777029|ref|ZP_11124300.1| molybdopterin synthase subunit MoaE [Nitratireductor pacificus pht-3B]  clstr ali  50  6.LVHVQAGDFSLAEEVRRLTGGRRDVGAVVTFTGLCRDEGGRLDALELEHYPGMAEAEIGRIAAEAAGRWPLTGLTVIHRFGRIAPGENIVLVVAAASHRRAAFEAADFLMDFLKSRAPFWKKEHAAGEAVWVEATEKDRDDMKRWQR.. 153
304 1.000e-45gi|167587142|ref|ZP_02379530.1| Molybdopterin biosynthesis MoaE [Burkholderia ubonensis Bu]  clstr ali  37  40IEVRVQYEPIDVDAEITPIVR-NPRVGAVVNFLGVVR-QSGDVVALDIEHYPGMTERSLWSIVEEASARWPLEAVRIVHRIGRIALGHPVVLMVVAAPHRAAAFDACEFMMDFLKTHAPFWKKEIRHDGAEWVEAKTHDDHAMKRWG... 185
305 1.000e-45gi|339019979|ref|ZP_08645097.1| molybdopterin converting factor large subunit MoeE [Acetobacter tropicalis NBRC 101654]  clstr ali  36  2IRVLVQTDAFDLGGEMARLSHISDSVGGISVFMGQVRGQGDGLESLTLEHYPGMTEKVLIGLAEEATARFSLLGCTVIHRVGTMRVGEPIVFVGTASGHRAEALQATAFLIDRLKTGAPFWKCERFTDGTTWVEAREADDDAAALWD... 149
306 1.000e-45gi|304391995|ref|ZP_07373937.1| molybdopterin converting factor, subunit 2 [Ahrensia sp. R2A130]  clstr ali  45  5..VRVQAEDFDPAAEQNALTAGRTDVGAVATFTGLCRSEGESLSALELEHYPGMAESQIEAAANRAAERFTVDALLVIHRYGKIAPGERIVFVCATSRHRDAAFDACRYVMDYLKTDAPFWKKEHRVDGGEWVDAKDADNSAKARWES.. 152
307 1.000e-45gi|182678688|ref|YP_001832834.1| molybdopterin biosynthesis MoaE protein [Beijerinckia indica subsp. indica ATCC 9039]  clstr ali  42  6.IVKIQKEIFDPVQECLPLTQDRKDLGALVTFTGLCRDEGGVLQSLEIEHYPGMAEEEIGRIITEARRRWPIEDVVVIHRFGMITPGEPIVLVAATGLHRAEAFEATNFLMDFLKTEAPFWKKQHLVDGAGWVSAKQEDEAAAQKWLQT. 155
308 1.000e-45gi|387769483|ref|ZP_10125746.1| molybdopterin converting factor, subunit 2 [Pasteurella bettyae CCUG 2042]  clstr ali  36  4VKIAVHEAEFDQNAEY-RWLSEPNSVGAAVVFVGKVRDLNDEVSSLYLEHYPVMTEKALREIVDEAIQRWQLQRVSVIHRVGLLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKSKAPFWKKEQTDKGERWIEARHSDKEALEKW.... 150
309 2.000e-45Oral.Meta HOMD belk_c_485_34 Bradyrhizobium elkanii 587 [2247 - 1783] (REVERSE SENSE) ORF  ali  43  7..IRIQQADFDVAQEIAALSKGRTDVGAVVSFSGICRGSEQGIAALTLEHYPEMAEAEIGRHAEEALSRWPLQGLTIIHRFGRIAPGENIVLVVTASAHRQAAFEAAEFLMDYLKTNAPFWKREESARGTSWIEAQDHDDAAAARWTK.. 154
310 2.000e-45METAHIT MH0012 GL0115330 [Complete] locus=scaffold17165_2:2301:2753:-  ali  39  3VKVEVRTEDFSAEKESEAVKAASPGAGALVSFIGIVRG--AGIRSMELEHYPAMTENAVRGIVHDARSRWPIEAVTVIHRVGKLLPGDNIVLVIVSAAHRREAFEAAEFIMDWLKTEAPFWKKETLTDGTRWVDARESDDAARDRWKK.. 150
311 2.000e-45gi|90407695|ref|ZP_01215874.1| molybdenum cofactor biosynthesis protein E [Psychromonas sp. CNPT3]  clstr ali  36  1.MIKVQTQDFNQQVEYEHLRAAS-QTGAIVTFTGLVRDVNQGISLLTLEHYPLMTEKVLNEIVAQASLRWSILNVRVIHRVGELQLLDQIVFVGIASLHRGDAFAACEYIMDHLKAAVPFWKKERNNAGSYWVDARESDQNALKKWQ... 148
312 2.000e-45gi|381395137|ref|ZP_09920843.1| molybdopterin synthase catalytic subunit [Glaciecola punicea DSM 14233 = ACAM 611]  clstr ali  34  1.MITVQQEDFDHGREYEALRELANRDGAIVTFTGLVRDFNSQVSNVVIEHYSGMTEKYLMQICSDAKKRWNLGQVRIIHRIGTLEAFEQIVFVGVSSKHRQNAFEAAQFIMDILKTTAPFWKQETTAKGTQWVKRKDSDEAAAAKWS... 148
313 2.000e-45gi|196000897|ref|XP_002110316.1| hypothetical protein TRIADDRAFT_23075 [Trichoplax adhaerens]  clstr ali  27  10.IIEICHEPLDIAKLSSLV--STPSAGAISTFTGITRDNFEGVLRLEYDAYIPMAMSELKTICATIRNKWAVKKIAIFHRIGLVPVEEASVIIAISSAHRADSLAAVQFCIDTLKAKVPIWKKEIYEDGSTWKENRECSWSQSK...... 152
314 2.000e-45JCVI_PEP_1096683218557 /source_dna_id=JCVI_ORF_1096683218556 /offset=0 /translation_table=11 /length=152 /full_length=152  ali  36  3MAVHVQEGLFDLQIITQKLKKLH-NSGASVTFEGYVRDFDDKLDMLELEHYPGMTEKALLDIELLASQRWNLDDIYIVHRYGKLKVGEPIVGIIVFSKHRKEAFEACHFIIDFLKTDAPFWKKEITNQKSYWVEAKKLDDEEKNKWN... 151
315 2.000e-45gi|209965183|ref|YP_002298098.1| molybdopterin converting factor subunit 2 [Rhodospirillum centenum SW]  clstr ali  44  1MTVRVQAEDFDVGAELAALTRGNPRIGGLACFVGLVRDLHPGAADLTLEHYPGMTERQIGAIAAEAKARWPLESVLVIHRHGRLEPGDRIVLVACASAHRDAAFAACQFLMDWLKTRAPFWKREETVEGGRWVEARAEDEAAARKW.... 152
316 2.000e-45gi|399074285|ref|ZP_10750927.1| molybdopterin converting factor, large subunit [Caulobacter sp. AP07]  clstr ali  80  6.RITLTDQAFEPGALLTAFCAGRDETGAVASFTGLARAEKGAAVALELEAYPGFTDTAIAAFADDAQARFGLQDYAIVHRVGRIAPGEAIVFVATAAVHRRAAFEACDFLMDYLKSRAPFWKKEHGPDGGRWIEPTAQDRTDAQRWD... 151
317 2.000e-45gi|15888463|ref|NP_354144.1| molybdopterin converting factor, large subunit [Agrobacterium fabrum str. C58]  clstr ali  43  9..VRVQAEDFDAADETRLLTQGDRSIGAVVAFTGLCRDDGGTLTALELEHYPGMAEAEITRIAKLAMERFGLLGLTAIHRHGKIATGENIVLVIAASSHRQAAFDGASFVMDYLKTSAPFWKKEHGRDGTTWVAAKATDDTARDKW.... 154
318 2.000e-45gi|332285346|ref|YP_004417257.1| molybdopterin converting factor [Pusillimonas sp. T7-7]  clstr ali  35  1.MVIVQEADFDIAQLMAGLRQSAGKAGAVVTFTGYVRDYDHDTQSLFLEHYPGMCEREIEALCTSAQSRWDIHECLVVHRVGELQNSDQIVFVAASSAHRGDAFKACEFIIDALKTRAPFWKRETLANGERWVQQHEADASKTSQWDD.. 151
319 3.000e-45gi|292490652|ref|YP_003526091.1| molybdopterin biosynthesis MoaE protein [Nitrosococcus halophilus Nc4]  clstr ali  39  1MTVHIINAPFDPWQEVAAYLKRAGRFGATACFIGTMRDFNEGVQAMELEHYPGMTEKYLGKLTEEARRQWPILDSLIIHRYGHLQPNEPIVLVVVWSAHRAAAFKACYYLVEELKANAPFWKKETLATGTRWVESNTS............ 144
320 3.000e-45gi|330994647|ref|ZP_08318570.1| Molybdopterin synthase catalytic subunit [Gluconacetobacter sp. SXCC-1]  clstr ali  40  4VTIRVQAEAFDSAHETTALLAGQTEVGGVGAFTGFVRG-GGGLVALELEHYPGMTETMMRQIAESACTRFGLVGCTIIHRVGRLAVGMPIVLVLCASAHRGGALGATEFMMDWLKTHAPFWKREEFADGSTWVAPRACDDAATARWG... 150
321 3.000e-45gi|148244782|ref|YP_001219476.1| molybdenum cofactor biosynthesis protein E [Candidatus Vesicomyosocius okutanii HA]  clstr ali  33  3.KIIIQQQDFDLSTEVALIKNTRSDIGAIVSFVGFVREKDNQIQKMTLEYYPGMTEKTLKYIVNKANKLWHISNTTIIHRVGDLNIKDQIVLVITSSKHRQTAFESCEFIMDFLKTQAPFWKKEHTQNKSTWVEAKSSDKNQKKRWE... 149
322 3.000e-45gi|408379383|ref|ZP_11176977.1| Molybdopterin converting factor, large subunit [Agrobacterium albertimagni AOL15]  clstr ali  40  8..IRVQRDDFDAAAESRGLTADRKDIGAIVSFVGLCRDEAGTLSALELEHYPGMAETEMTRIAELAIDRFSLLGLTAIHRFGRIEAGEQIVLVIAAAPHRQAAFDGANFVMDFLKTSAPFWKKEHSQDGSSWVAAKDADDTARDRWSR.. 155
323 4.000e-45gi|89056407|ref|YP_511858.1| molybdopterin synthase subunit MoaE [Jannaschia sp. CCS1]  clstr ali  42  1MSVQVRAEPFDQGAALNAFSESARGVGAIVSFTGVTRDVAEGDIAMEIEHYPGMTERALTEIRSDAMERFSLSNAMIIHRYGRLAPGDVIMMVATASRHRADAFQGAEFLMDYLKSRAPFWKREVTQRGSDWVAAKDADEEALERW.... 147
324 4.000e-45gi|83952488|ref|ZP_00961219.1| Molybdopterin converting factor subunit 2 [Roseovarius nubinhibens ISM]  clstr ali  47  1MDIRVQESPXXXXXXXXXXXXRQRGMGAVVTFTGIVRDLPGGMAHMEIEHYPGMTEAALRKIAEEAQARWDLGDALIIHRHGRLGPDEMIMMVATAARHRVAAFEAAEFLMDFLKSRAPFWKKEHLSEGAQWVAAKEEDEAALDRW.... 146
325 4.000e-45gi|270264620|ref|ZP_06192885.1| molybdopterin-converting factor subunit 2 [Serratia odorifera 4Rx13]  clstr ali  37  4.KIIVDTESFDIAREHQWLSASETE-GAVVTFVGKVRNNNLGVNALTLEHYPGMTEKLLAQIVDEARFRWQLGRVVVFHRIGELRAGDGIVLVGVSSAHRADAFLAAEFIMDYLKTKAPFWKKESTPQGELWVAARDKDCVAVERW.... 149
326 5.000e-45gi|406924273|gb|EKD61115.1| Molybdopterin converting factor, subunit 2 [uncultured bacterium]  clstr ali  45  1MRVCVQAEPFDLGAESNAFXXXXXXXXXXXTFTGLVRDNGGALAAMEIEHYPGMTEKAIAAMVEQAMARWSLADALVIHRYGRLAGRDPIMMVATASRHRADAFAAAEFLMDYLKSRAPFWKKELSAEGAEWVAARDEDEAALKRW.... 146
327 5.000e-45gi|331006450|ref|ZP_08329753.1| molybdenum cofactor biosynthesis protein E [gamma proteobacterium IMCC1989]  clstr ali  35  1...........MGDEHTALQQDAPSIGAIVTFTGLVREFTKGDTQLFLEHYPAMTEKVLNNIVKQATQRWGIISTRIIHRIGHLSLGEQIVFIGVNSPHRADAFAAATFIMDFLKTDAPFWKKEITPKGEAWVDAKDSDASARKHW.... 136
328 9.000e-45gi|255021018|ref|ZP_05293071.1| Molybdopterin converting factor, large subunit [Acidithiobacillus caldus ATCC 51756]  clstr ali  40  1MLVRVQETDFDPAEILTA--ELPNACGAVVSFVGTVRDYSEDILALEIEHYPGMTERELQRLQQEAARRFAILDSAIVHRFGRLGPSERIVLVAVWSSHRAAAFDACRFLIDVLKTSAPFWKKEITPTGARWVTDCPGCR-AGTRHGH.. 147
329 9.000e-45JCVI_PEP_1096688168281 /source_dna_id=JCVI_ORF_1096688168280 /offset=0 /translation_table=11 /length=156 /full_length=156  ali  33  3LKVLIQAEAIDLDKEHRLLQDSEGSVGAIATFYGTVRDENRRVQSIFIEHYSGMTETKLKNIINEAKERWKISAATIIHRIGKLEVGEGIVFVGTASSHRKDAFQSCDFIMDYLKTNAPLWKKERHDRGEDWVSSKESDQIFARSWKK.. 152
330 9.000e-45gi|260772443|ref|ZP_05881359.1| molybdenum cofactor biosynthesis protein E [Vibrio metschnikovii CIP 69.14]  clstr ali  44  6.................AVLAQDSAAGAVVTFVGKVRDLNDDVIGLRLEHYPGMTEKALSHLCDQAQQRWPLQQVRIIHRVGDLDVGAQIVFVGVASAHRGASFAACEFIMDSLKTQAPFWKKERTTHSERWIESRESDHQAAKRW.... 136
331 1.000e-44gi|428210351|ref|YP_007094704.1| molybdopterin synthase subunit MoaE [Chroococcidiopsis thermalis PCC 7203]  clstr ali  31  23..FAITFAPLSLDAFYAL--ADDPGNGAIVVMSGMVRNQTDGVVSLEYQAYEPMAMQIFKQIAAEIRQQWDVNRVAIHHRIGKLKIGEISVLVGVGCPHRSEAFEACRYAIDTLKHNAPIWKKEHWQDGSSWVSIGACETQ......... 163
332 1.000e-44gi|347820795|ref|ZP_08874229.1| molybdopterin biosynthesis MoaE [Verminephrobacter aporrectodeae subsp. tuberculatae At4]  clstr ali  39  5.RVSIQTEDFDLSTEIAALRRANPGVGAVCGFVGTVRGQDTGVESMTLEHYPGMTEKSIEAMLDAALQRFDILGARVIHRVGRLLPCEQIVLVAVASAHREQSFRACEFLMDYLKTQAPFWKKEQTP....................... 132
333 1.000e-44Oral.Meta HOMD axyl_c_1_18559 Achromobacter xylosoxidans A8 [5555091 - 5555741] molybdopterin-converting factor subunit 2  ali  37  63.MISVQEADFDGAALTAALRESAPGVGGIVTFVGYVRDYDTPTDTLFLEHYPGMCERELEEIAATARARWHLDGTVIVHRVGALHRNAQIVFVAAASAHRGDAFRGCEYIIDALKTRAPFWKRETLAGGSFWVEQRQSDQDRTQSWDED. 214
334 1.000e-44gi|384085376|ref|ZP_09996551.1| molybdopterin converting factor, subunit 2 [Acidithiobacillus thiooxidans ATCC 19377]  clstr ali  34  1MIVKVQKEDFELSAACAEMATVN-GAGALVTFVGTVRDYSDDILSLEIEHYPGMTEKELERVSMQAANAYDILDSLIIHRYGLLQPQDNIVLVAVWSRHRAAAFDACRFLIDVLKTSAPFWKKEITPQGSRWVTDCPGCRAGSREGHSHS 151
335 1.000e-44gi|410626880|ref|ZP_11337630.1| molybdopterin synthase catalytic subunit [Glaciecola mesophila KMM 241]  clstr ali  36  1.MISIQHEDFDLNHEYLQLRDCNDGDGAIVTFSGLVRDYDGSVSGLFLEHYPGMTEKSLMDICVQARAKWPLGQIRIIHRIGQLNANEQIVFVGVTSAHRAAAFSAAEFIMDYLKTQAPIWKQEHSAKGPKWVEAKDSDVTAANKW.... 147
336 2.000e-44gi|87121810|ref|ZP_01077696.1| molybdenum cofactor biosynthesis protein E [Marinomonas sp. MED121]  clstr ali  42  1.MIKVQQDDFSVDQLYQALCDNN-QTGAVAMFVGRVRDFNENDEALELEHYPGMTEHNLQQIVDEAHKRWDLHDVQVVHRVGQIKVLDQIVFVGVSSSHRAEAFLACDFVMDYLKSRAAFWKKEIQSGKGEWVCAKESDEQSLERWS... 151
337 2.000e-44gi|254502086|ref|ZP_05114237.1| molybdopterin converting factor, subunit 2 [Labrenzia alexandrii DFL-11]  clstr ali  48  7..VRVQAEDFSAQSEMDTLTAGRQDVGALVSFTGLCRNEAGTLAALELEHYPGMAEAELERIASDALKRWPLTGLTVVHRYGKIQPGEQIVLVVAASAHRRAAFEAADFLMDFLKTRAPFWKKEHFVSGETWVAAKADDDADAERW.... 152
338 2.000e-44JCVI_PEP_1096687703135 /source_dna_id=JCVI_ORF_1096687703134 /offset=0 /translation_table=11 /length=149 /full_length=149  ali  35  1.MAIVQQETFSIEDLIKPLRANNPSIGAAVTFTGYVREFDKKLSKLHIEHYPEMTIKALIKIEQYAKKNWNITAVQIIHRYGLLEPNEPIVGVIVLSEHRDEAFDACRFVIDYLKTEAPFWKKELTSKGEYWVERKVGDES......... 145
339 2.000e-44gi|296445661|ref|ZP_06887616.1| molybdopterin biosynthesis MoaE protein [Methylosinus trichosporium OB3b]  clstr ali  47  6...RIQSTPFDPAHEAALIENGRRDIGAIVSFTGLCRDEDATLAALELEHYAGMAEAEMARVAEEALTRWPLQALTIIHRHGRILPGERIVLVIAAARHRGEAFAAAEFLMDYLKTRAPFWKKEHRADGSVWVEAKAKDDAAAERWG... 151
340 2.000e-44JCVI_PEP_1096700806499 /source_dna_id=JCVI_ORF_1096700806498 /offset=0 /translation_table=11 /length=324 /full_length=324  ali  42  177..VRVQYAPIDAGAELAPIVR-NPNVGAVVNFLGVVRNEGDDVIALEVEHYPTMTEQALWSIVEEASARWQLETIRIVHRVGRIPLGQAVVLVVVAAAHRGSAFDACEFLMDFLKTHAPFWKKEIRHDGSGWVEAKAHDDQAMRRWG... 323
341 2.000e-44gi|350571411|ref|ZP_08939738.1| molybdenum cofactor biosynthesis protein large subunit [Neisseria wadsworthii 9715]  clstr ali  39  5..VRVQEADFNLQNEYDALLKDAENTGAVAAFVGRVRDRDTDTPHLFLEHYPEVTEHEIERIAHEAETRWPLTACTVIHRVGLLEADDQIVLVLTASEHRKAAFSAAEFLMDYLKTQAPFWKQERFSDGEHWVEAKQSDAEAADKW.... 151
342 2.000e-44gi|332528191|ref|ZP_08404219.1| molybdopterin biosynthesis MoaE protein [Rubrivivax benzoatilyticus JA2]  clstr ali  50  3.RVAIQGEDFDVGALFQALHAADAGTGAVVGFVGTVRGRDGDVQALELEHYPGMTEQAIEAMIDAAVGRFGLRAARVVHRVGRLAAGENIVFVGVAAPHRRAAFEGCEFLMDYLKTQAPFWKKETTPEGSRWVXXXXXXXXXXXXWGLDS 153
343 2.000e-44JCVI_PEP_1096698967009 /source_dna_id=JCVI_ORF_1096698967008 /offset=0 /translation_table=11 /length=177 /full_length=177  ali  42  29..VSVQNEVFDFSKEIEQFSKKLNNVGALVTFTGVVRGKSETLDFMFIEHYPGMTENQITSMINNAVKRWNINDALIIHRYGKLEPGEPIMMVATAAEHRREAFEAAEYLMDYLKSRAPFWKKEVINGKEKWVDATVDDELALDRWNK.. 175
344 3.000e-44JCVI_PEP_1096679889521 /source_dna_id=JCVI_ORF_1096679889520 /offset=0 /translation_table=11 /length=149 /full_length=149  ali  37  1VRISVQLNDFDIGKELQLFNNVDTNIGAVVSFQGIVRNNSEKLLHMDIEQYPEMTQKAISKYVDIAVERWSLYDALVIHRHGKLLLGDRIMMVATAAKHRRDAFQSAEFLMDYLKSRAPFWKKEVTKDGYQWVKSVLDDESALERW.... 147
345 3.000e-44gi|304313065|ref|YP_003812663.1| molybdenum cofactor biosynthesis protein E [gamma proteobacterium HdN1]  clstr ali  43  9..ITVAEQDFDAALLTRELLGGQGDAGALTTFIGLVRSGDAPLRAMQLEHYPGMTEKSLRKIAVQAIERWGLLGVSIYHRVGRLVVGDQIVFVGVAGRHRREAFDACAFIMDYLKTEAPFWKKELLGEQGHWVDAKESDQQARERWNEKA 172
346 3.000e-44gi|300715928|ref|YP_003740731.1| molybdopterin-converting factor subunit 2 [Erwinia billingiae Eb661]  clstr ali  42  4.RIRVGQAPFDMGEEYRWLAACDED-GAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALAGIVAEARERWPMQRVTVIHRIGELFPGDEIVMVGVSGAHRAGAFAAAEFIMDYLKTKAPFWKREATPEGDRWVESRDSDRQSAARWK... 150
347 3.000e-44gi|392957988|ref|ZP_10323507.1| molybdopterin converting factor subunit 2 [Bacillus macauensis ZFHKF-1]  clstr ali  30  4..FAITTLPLNVEALISYV--SSPQAGAINTFIGTVRELTGEKKTLKYEAYVPMAEKQLKKIGTEVQEKWPGTRIAIHHRIGSLAISDIAVVIAVSTPHRAASFEACRYAIERIKEIVPIWKKEHWEDGTFWVGN............... 136
348 3.000e-44JCVI_PEP_1096676577141 /source_dna_id=JCVI_ORF_1096676577140 /offset=0 /translation_table=11 /length=162 /full_length=162  ali  36  10.MISVQHEDFNIGVEYENLRISSQSPGAIVTFTGLVRQIGDSVQSLYLEHYPGMTEQKLIEIEEQAHSKWELLGSTIIHRVGELSPDDQIVFVGVASSHREDAFLAAQYIMDFLKNEAPFWKKQKTQHGDGWISSRKSDLAAINKWK... 161
349 4.000e-44gi|302839687|ref|XP_002951400.1| hypothetical protein VOLCADRAFT_61348 [Volvox carteri f. nagariensis]  clstr ali  30  8VFVEITENDLDICKCMELV--ADPGAGAISTFNGVTRNNFQGVIKLDYEAYVPMALKKLQELAHEVGRRWNVCKVAVAHRKGIVLVGEPSVIIAVSSAHRRESLEAVQWAIDELKAVVPIWKKEFFEDGSIWKENEESRR.......... 147
350 4.000e-44gi|428270712|gb|AFZ36653.1| molybdopterin biosynthesis MoaE protein [Stanieria cyanosphaera PCC 7437]  clstr ali  33  20..FAITFAPLSLEEVYRL--ADDPANGAVVVMSGTVRNQTGGVLSLEYQAYEPMAIAVFRSIAAQIRQQWQDTRIVIHHRVGHLEIGDLSVLVAVGCPHRSEAFEACRYAIDTLKHNAPIWKKEYFADGTQWVNCC.............. 159
351 4.000e-44gi|389871372|ref|YP_006378791.1| molybdopterin converting factor [Advenella kashmirensis WT001]  clstr ali  37  1.MIAVQHDDFDAGQLIRELHESQGQAGAVASFVGYVRDYSQPTQELFLEHYPGMCEQELADIAQQAMQRWDIVQSTIVHRVGALSRQQQIVFVGIASAHRGDAFAACEYIMDALKTRAPFWKRETLADGAFWVQARNSDQQRLEKWS... 150
352 4.000e-44gi|163850936|ref|YP_001638979.1| molybdopterin biosynthesis MoaE protein [Methylobacterium extorquens PA1]  clstr ali  45  4MTVSIQSEPFDTAAEIARIEAEAGRAGAVVTFSGLCRDEAGRLAALELEHYPGMAEAEIARVVEEARARWPVQALRVIHRHGLVRPGEGIVLVITASPHRKAAFAAADFLMDYLKTRAPFWKREHLADGTTWV................. 139
353 5.000e-44gi|258542185|ref|YP_003187618.1| molybdopterin converting factor large subunit MoeE [Acetobacter pasteurianus IFO 3283-01]  clstr ali  36  3VRVLVQQVAFDTGAETARLSSLSEQVGGMGLFIGQVRG-GDGLLSLTLEHYPGMTETILHQLAQEAMQRFNLLGCTLIHRVGRLEVGAPIVLVGTAAAHRGAALSATSFLIDRLKTGAPFWKKEEFANGTAWVDAREEDEHAAAAWMHTA 152
354 5.000e-44NEWGM STRPU GLEAN3_21854|Strongylocentrotus purpuratus|Baylor  ali  29  106..VKLTTDILSVERAVQTVT--DPSCGAVSMFLGTTRDNFDGVVRLEYEAYESMAEKQLNKLCIEMRQKWDLHNILIHHRLGHVPVTESSVMIVVSSAHRKESLEAVQYCIDQLKATVPIWKKEIYDEGDGWKANKEC............ 242
355 5.000e-44JCVI_PEP_1096669525925 /source_dna_id=JCVI_ORF_1096669525924 /offset=0 /translation_table=11 /length=161 /full_length=161  ali  42  13..VRIRTADFDAGVEIDKLRRA--GVGAIATFSGIVRAETPGLIAMTLEHFPGMTEQEIQNIIDQARRRWPLTAVKVIHRVGRLLPQENIVFVGTASAHRQAAFDSASFIMDYLKTRAPFWKKEETSSGAQWVEARETDDIALQKW.... 156
356 5.000e-44gi|221633681|ref|YP_002522907.1| molybdenum cofactor biosynthesis protein D/E [Thermomicrobium roseum DSM 5159]  clstr ali  34  85..FSIGPEPLDPRRIEQLV--ADPRAGAVVLFIGTVRDHARGKRVLEYEAYAEAALETFAQIAEEIRQRWDVLGIAIAHRTGRVDIGEASVVIAVSSAHRAEAFEACRYAIERLKQVAPIWKKEVYEDGEIWIGSEALYQELFAR..... 227
357 6.000e-44gi|159486042|ref|XP_001701053.1| hypothetical protein CHLREDRAFT_98436 [Chlamydomonas reinhardtii]  clstr ali  31  4IFCEVTSDPLDISRYVELV--ADPGAGAISTFTGVTRNNFQGVIKLDYEAYTPMALKKLQELAHQVTNKWSVCKVAIAHRVGTVLVGEPSVIIAVSSAHRRESLEAVHWAIDELKASVPIWKKEFFEDGSVWKENEE............. 140
358 6.000e-44gi|90416704|ref|ZP_01224634.1| Molybdenum cofactor biosynthesis protein E [gamma proteobacterium HTCC2207]  clstr ali  38  4.RIRIQQQDFDLAEEYELLRQTDSAVGAVVTFSGLVRDFEKSIDSLSLQHYPGMTEKLLEAIVEQANTRWNLIATTVIHRVGDLAPREQIVLVGVASQHRAEAFEAAQFLMDYLKTQATFWKSIRRDNQQQWIHSKASDKQAAERWSR.. 164
359 6.000e-44gi|239831530|ref|ZP_04679859.1| molybdopterin biosynthesis MoaE protein [Ochrobactrum intermedium LMG 3301]  clstr ali  44  11..VGIRSEDFDTAAELRKLEQGRTDIGAIVTFTGLCRDESGTLSALELEYYPGMAEAEITRIARQAIARWPITALTIIHRYGLIRPGENIVLVAAASSHRHAAFEAASFLMDYMKTDAPFWKREHLADGSVWVSSKEEDEKIRERWKQ.. 158
360 7.000e-44gi|209886322|ref|YP_002290179.1| molybdopterin converting factor subunit 2 [Oligotropha carboxidovorans OM5]  clstr ali  37  5ITVRVQHDDFDVALETRMLTANRPDIGAVVSFVGICREDDLAISEMTLEHYPGMAETEIRRHAEEARRRWPLAGVTVIHRFGTLTPGDNIVLVLTASSHREAAFQAAEFLMDYLKTNAPFWKSELTGEGGVWVEACGKDDDATSRWERK. 157
361 8.000e-44gi|162147606|ref|YP_001602067.1| molybdopterin-converting factor subunit 2 [Gluconacetobacter diazotrophicus PAl 5]  clstr ali  37  3VDVRVQADPFSLDVETARLTRDGHDIGGMGMFLGVVRG-GDGLAALTLEHYPGMTESMIARIVHEAGARFGLLACTVIHRVGRLEVGAPIVLVLCAAAHRGAALEATSFVIDWLKTRAPFWKREDRADGSSWVEARESDEAAATRWG... 149
362 8.000e-44gi|254480507|ref|ZP_05093754.1| molybdopterin converting factor, subunit 2 [marine gamma proteobacterium HTCC2148]  clstr ali  41  7..VRVQAEDFDITLLQEQLLQGEAAEGAVATFTGYVRNNNENRHSLELEHYPGMTERSIQQILAQSAQRWPVMAAAVVHRVGKLKPGEQIVWVGVSSSHREAAFAACEFIMDYLKTRAPFWKKELSPEGEQWLDARTSDGERASRWEHD. 155
363 9.000e-44gi|88703396|ref|ZP_01101112.1| Molybdopterin converting factor subunit 2 [Congregibacter litoralis KT71]  clstr ali  42  4..VDITASPIDVTGLTRDFPRSPNGTGAVASFTGFVRGE--GITALALEHYPGMTERSIMETIESAARRWPVQAVQVVHRVGELKPGEPIVWLAVGSGHRAAAFSACEFVMDYLKVSAPLWKRERDTKGSHWVKAKSADDDRAKRWSRGA 150
364 1.000e-43gi|365156925|ref|ZP_09353210.1| hypothetical protein HMPREF1015_00620 [Bacillus smithii 7_3_47FAA]  clstr ali  31  1.MFKITKQPIKMEEVVQQVI--RPEAGAVVTFLGTVRELTNGKKTLYYEAYESMAEKKLRQIGEEIEKRWPGAKTAIVHRIGRLDISDIAVAIAVSTPHRKDAYEANRYAIERIKEMVPIWKKEHWEDGEEWIGN............... 134
365 1.000e-43gi|217977616|ref|YP_002361763.1| molybdopterin biosynthesis MoaE protein [Methylocella silvestris BL2]  clstr ali  44  14..VRVEAAAFDVGREMALLTQGRTDVGAVVAFTGLCRDEGGALAALEIEHYPGMAEDEIGRVVAKALERWPLQGALVIHRYGRIAPGEPIVLVITLSRHRSAAFAAAEFLMDYLKTAAPFWKKQHLPDGG-WVAAKAEDDSATARW.... 160
366 1.000e-43gi|428202505|ref|YP_007081094.1| molybdopterin converting factor, large subunit [Pleurocapsa sp. PCC 7327]  clstr ali  32  17.RFRISFAPLSLDEVYNL--ANDPANGAIVVMSGTVRQQTDGVLYLEYQVYEPMALAIFRQIAAEIRQRWDTNRVIIHHRIGKLEIGEISVLVAVGCPHRAEAFEACRYAIDTLKHNAPIWKKEYWADGSSWVSIGACEQTNAN...... 161
367 1.000e-43gi|34495640|ref|NP_899855.1| molybdopterin converting factor subunit 2 [Chromobacterium violaceum ATCC 12472]  clstr ali  41  5.HIRVQTEGFDVGAEVRRW-SVNPACGAVVSFTGLVRDYGDDVVALELEHYPGMTEKALADIVRQARARWSLKGVTLIHRVGRLALGDDIVLVVVASGHRRDAFEAAAFLMDYLKRQAPFWKCEILADGSRWVDAKASDEAAAARWNAQG 155
368 1.000e-43gi|291233479|ref|XP_002736681.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii]  clstr ali  28  7..VAITPDKLNVEEITEMVK--CPQAGAVTVFLGTTRDEDKKVIKLEYEAYVPMAEAEMRKLCHQIREKWNVEKIAIIHRIGIVPVMDASVIIAVSSVHRKESVEAVHYCIDSLKSSVPIWKKEVYGDGSNWKENKECDWAARN...... 149
369 2.000e-43gi|354566798|ref|ZP_08985969.1| molybdopterin biosynthesis MoaE protein [Fischerella sp. JSC-11]  clstr ali  32  28..FVITFAPLLVEEIYRL--ANDPANGAVVVMSGTVRNQTDGVVSLEYQAYEPMALQVFYQIATDIRQKWDVNRVVIHHRIGHLQIGEISVLVAVGCPHRSEAFAACRYAIDTLKHNAPIWKKEHWQDGSSWVSIGACEQS......... 168
370 2.000e-43gi|124005081|ref|ZP_01689923.1| molybdopterin converting factor, subunit 2 [Microscilla marina ATCC 23134]  clstr ali  33  1MEFKITDQPINEQEVIDLVRS--PHCGGLSVFVGTVRNQTKGVISLEFEAYEAMAMNKMREIAEQAQKRWKTDKIAIYHRVGKLSVEETAVVIAVSTPHRKESFQACEYLIDTLKQVVPIWKKEIYEDGEIWVAAH.............. 136
371 2.000e-43gi|334116878|ref|ZP_08490970.1| molybdopterin biosynthesis MoaE protein [Microcoleus vaginatus FGP-2]  clstr ali  32  21..FAITLAPLSVEEIYALV--DDPANGAVVMMSGTVRNQTDGVVSLEYQAYEPMAVRVFQQIATEIRRQWGVNRVAIHHRVGHLQVGEISVLVAVGCPHRGEAFAACQYAIDTLKHNVPIWKKEHWADGSSWVSIGACE........... 159
372 2.000e-43gi|198283218|ref|YP_002219539.1| molybdopterin biosynthesis MoaE protein [Acidithiobacillus ferrooxidans ATCC 53993]  clstr ali  38  1MLVKVQREDFDPMAEMAAFPADAAGAGSSVTFIGTVRDYSEDILAMEIEHYPGMTERELERISAEAAQRYDILDSLIMHRYGRLAPQDNIVMVAVWSRHRAAAFDACRFLIDVLKTSAPFWKKEITPEGVRWVTDCPGCRAGSREGHTHA 153
373 2.000e-43gi|91975758|ref|YP_568417.1| molybdopterin biosynthesis MoaE [Rhodopseudomonas palustris BisB5]  clstr ali  44  5VTIRIQEADFDIAAEIAAMTAGRTDIGAVVSFSGICREGDDAVAALTLEHYPGMAEDEIGRHAAAAVTRWPVTALTIVHRVGRMRPGDNIVLVLAASAHRQAAFSAAEFLMDYLKANAPFWKREERAGGTRWVE................ 140
374 2.000e-43gi|374852092|dbj|BAL55033.1| molybdopterin synthase subunit MoaD / molybdopterin synthase subunit MoaE [uncultured Acidobacteria bacterium]  clstr ali  38  87.IFALVREPIEARALVQRLLRG--AAGAVVTFDGVVREQTGGVRYLEYEAYEAMALRMLREIGREIRARWPIDRIGIVHRLGRLEIGESSVIIVVTSAHRRPAFEACQYAIDRLKKIVPIWKREYFEDGSVWVDG............... 220
375 2.000e-43gi|56962671|ref|YP_174397.1| molybdopterin converting factor subunit 2 MoaE [Bacillus clausii KSM-K16]  clstr ali  33  1.MFQLTNKPIDVQQVINQVT--DRNCGAIATFIGTVREFTNGKKRLEYIAYESMAEKMLKRIGAEINERWPGTNVAIVHRLGVLDISEAAVVIAVSSPHRQAAYEANAYAMERIKAMVPIWKKEIWEDGSSWI................. 132
376 2.000e-43gi|149408420|ref|XP_001507668.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Ornithorhynchus anatinus]  clstr ali  27  11.LIRFTNEKLSVDEVSQSVIS--PSCGAVSLFVGTTRNNFEGVISLEYEAYLPMAEAEIRKICDDIRQKWAVGHIAVYHRLGLVPVTEPSVIIAVSSAHRAESLEAVKYGIDTLKATVPVWKKEIYEDESSWKGNKECFWTTAD...... 153
377 2.000e-43gi|239826836|ref|YP_002949460.1| molybdopterin biosynthesis MoaE protein [Geobacillus sp. WCH70]  clstr ali  31  5.LFMITDKPISIENVVKKVM--RPEAGAVTTFMGTVREWTNGKRTLFYEAYVSMAEKMLEQIGAEIREKWPETKVAITHRIGRLDIGDIAVAIAVSSPHRNDAYEANRYAIERIKQIVPIWKKEHWEDGTEWVGN............... 138
378 2.000e-43gi|148657301|ref|YP_001277506.1| molybdopterin converting factor subunit 1 [Roseiflexus sp. RS-1]  clstr ali  39  90..FVVTHEPLDPAPLVALV--QSPDMGAVVTFAGVVRNHFGGRKTLEYEAYTGMAEAVLEQIAGEARTRWNTGGIAVHHRIGRLEIGETAVLVVVAAPHRREAFEAAAWIMDRVKEIAPIWKKEYWADGAEWVG----DEKERKR..... 229
379 2.000e-43gi|428308618|ref|YP_007119595.1| molybdopterin converting factor, large subunit [Microcoleus sp. PCC 7113]  clstr ali  34  15..FSITFAPLSLAEIYAL--ADDPANGAVVVMSGTVRNQTDGVVALEYQAYEPMAVRVFEAIADDIRNRWDVNRVVIHHRTGRLQIGEISVIVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEHWADGSSWVSIGACEQ.......... 154
380 2.000e-43gi|156742874|ref|YP_001433003.1| molybdopterin converting factor subunit 1 [Roseiflexus castenholzii DSM 13941]  clstr ali  39  90..FVVTPDPLDPAPLVALVQA--PDMGAIVTFAGVARDNFGGRKTLEYEAYPGMAEAVLAQIAAEARARWQTGAIAVHHRIGRLEIGETAVLVVVAAPHRREAFAAAEWIMDRIKEVAPIWKKEHWADGAEWVDEKERKQKAPQR..... 234
381 3.000e-43gi|296534418|ref|ZP_06896863.1| molybdenum cofactor biosynthesis protein large subunit [Roseomonas cervicalis ATCC 49957]  clstr ali  43  3.RILVQEAPFDTAAEMAALSAGRTDVGGVASFVGICRA-DDGLRALVLEHYPGMTEKALSGIAGEAERRWPLTGCTVIHRVGRILPGEPIVLVLAASAHRAAALEACAFLIDWLKTGAPFWKREEMADGERWVEAKESDDAAAEKWK... 148
382 3.000e-43gi|227821490|ref|YP_002825460.1| molybdopterin converting factor subunit [Sinorhizobium fredii NGR234]  clstr ali  45  5VTVRVQREDFDLAAEVSAFGRGRADIGAVVTFSGLCRDEAGALGALELEHYPGMAEAEISRICHEAVQRFGLQGATAIHRFGRIEPGQNIVLVVTASPHRQAAFDGANFIMDFLKTSAPFWKKEHRIDGSEWVSAKDADDAARDRWNR.. 154
383 3.000e-43gi|375110511|ref|ZP_09756733.1| molybdenum cofactor biosynthesis protein E [Alishewanella jeotgali KCTC 22429]  clstr ali  40  3LRIQVQQQDFSVASEYELLRQEA-RCGAVVTFSGLVRELTEQLLRMTLEHYPGMTEQALIQIATEAQQRWQLGTVTIIHRVGTLLPNEQIVFVGVASAHRAAGFAAAEFIMDYLKNRAPFWKKEHTSNGEYWVAAKVSDHVALQRWE... 149
384 3.000e-43gi|384246184|gb|EIE19675.1| Molybdopterin biosynthesis MoaE [Coccomyxa subellipsoidea C-169]  clstr ali  31  1MFVEVLPDPLELNKYVGFV--EDNGSGAIATFMGVTRDNFDGVLSLSYEAYVPMAEKEMQVICRKAHDKWDLKKMAVAHRIGHVGVGEPSVIIAVSSAHRREALEACHWAIDELKATVPIWKKELYEGGEVWKENSESRNAQRS...... 144
385 3.000e-43gi|158336227|ref|YP_001517401.1| molybdopterin converting factor 2 [Acaryochloris marina MBIC11017]  clstr ali  32  11.HFLITFAPLSVEEVYHQ--ADHPHNGAVVVMSGTVRDQTDGVLSLEYQAYEPMALKVFQSIAQDIRQRWPVNRIAIHHRTGHLKISEISVLVAVGCPHRAEAFTACQYAIDTLKHNAPIWKKEHWADGSSWVNIGACEQENA....... 154
386 3.000e-43JCVI_PEP_1096692361697 /source_dna_id=JCVI_ORF_1096692361696 /offset=0 /translation_table=11 /length=165 /full_length=165  ali  29  16VKIKIQEADFDTNYENNNLIVN--NTGALVNFVGTVRGNSEKILSMTLEHYPGMTENEILNIVNKAIKKWKIEGVTVIHRVGRLLPGDKIVYVGVSSRHRQNAFDACNFIIDWLKTNAPFWKSEELEGIKNWVQARDEDTLALKKWN... 163
387 4.000e-43gi|150396003|ref|YP_001326470.1| molybdopterin biosynthesis protein MoaE [Sinorhizobium medicae WSM419]  clstr ali  46  6VNIRVQRDDFDIAVEIAALCRDRTDIGAVVTFSGLCRDEAGALSALELEHYPGMAEAEIERICQDAVERFGLQAATAIHRFGGMEPGANIVLVIAAAPHRQAAFDGANFIMDFLKTSAPFWKKEHRTDGSDWISAK.............. 143
388 4.000e-43gi|119487728|ref|ZP_01621237.1| Molybdopterin biosynthesis MoaE [Lyngbya sp. PCC 8106]  clstr ali  33  26.HFAITLAPLSIEEIYALV--DEPANGAVVVMSGMVRNNTEGVEALEYQAYQPMAIRVFEGIAAEIRQNWPVSQVAIHHRIGRLQVGEISVLVAVGCPHRREAFEACQYAIDTLKHNAPIWKKEHWVDGSSWVSACQTDCE......... 169
389 4.000e-43gi|254418942|ref|ZP_05032666.1| molybdopterin converting factor, subunit 2 [Brevundimonas sp. BAL3]  clstr ali  50  3LDVRLVFGALSPAAELEAFLAGRTGDGAVVTFTGLARGTSRDVAALTLDHYPGMTERSMRDIAEAAAARFQIEDLIVAHRCGEITPGETIVFVATASPHRRTAFEAADYLMDRLKTEAAFWKRETGPAGARWIEPVDEDRAALARWKDK. 154
390 4.000e-43JCVI_PEP_1096678044877 /source_dna_id=JCVI_ORF_1096678044876 /offset=0 /translation_table=11 /length=169 /full_length=169  ali  37  25MNVLVSTESLDPLNEIAEFEAQHGEVGAAVHFVGTMRDFNEGVSEMELEYYPGMTERVLEELVSQAKDEWPILECMIRHRAGSLQPGDPIVLVAVWSAHRGAAFDACRFLIEELKHRAPFWKRELTDKGSRWVA................ 163
391 4.000e-43gi|218295834|ref|ZP_03496614.1| molybdopterin converting factor, subunit 1 [Thermus aquaticus Y51MC23]  clstr ali  39  83..FGLTHEPLDLKALVDW--ATAPEYGAVVSFLGTTRSPNRGVAYLEYEAYPGMAEKVMAEIIGEMRARWPLGRVALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKQVLPVWKKEHRQDGSFWVEG............... 215
392 5.000e-43Oral.Meta HOMD bper_c_1_16797 Bordetella pertussis Tohama I ATCC BAA-589, NCTC-13251 [2875553 - 2874888] moaE gene product  ali  38  62IMVIVQEADFDSAALLAALRERGGQAGAIVTFVGYVRDFEQATETLYLDHYPGMCERELETIAATARERWDLAGTVIAHRVGALPRGAQIVFVAAASAHRGDAFRGCEYIIDALKTRAPFWKRETLAAGSFWVEQRQSDADRTQSWDD.. 213
393 5.000e-43gi|339007459|ref|ZP_08640034.1| molybdopterin synthase catalytic subunit [Brevibacillus laterosporus LMG 15441]  clstr ali  29  104.RFAITEAPLSVEPLIKLV--SHRNCGAILTFIGTVREMTQGQRTLSYEAYIPMAIEKLKQVEAEIHERWENIRVAIHHRIGDLQIEEIAVVIAVSSPHRNDSFEAGRYAIERLKQIVPIWKKEIWEDGNEWK................. 235
394 5.000e-43gi|71278313|ref|YP_271285.1| molybdopterin converting factor, subunit 2 [Colwellia psychrerythraea 34H]  clstr ali  34  6..ISIQTDDFSLADEVALLEKDNVTDGAVVTFTGRVRNNNNGVTTLTLEHYPGMTEKSLAKIIIQAKERWNIGRVKVIHRIGELSIGDQIVFVGVTSKHRQDAFAANEFIMDYLKVKAPFWKKEITDDGENWLDAKNSDSDKADLWS... 156
395 5.000e-43gi|390559277|ref|ZP_10243628.1| MoaD family protein [Nitrolancetus hollandicus Lb]  clstr ali  31  85..FRVIEEPIDLPAVTREV--ADPGAGAIATFVGTVRNTARGVLYLDYEAYPAAAEKMLARIGDEIADRWGIDRVAITHRIGRLEIGEASVAIAVSSPHRNEAFEACHYAIERIKQIVPIWKKEYYAGGDVWIGSEAAYQEEFGR..... 227
396 5.000e-43gi|294012262|ref|YP_003545722.1| molybdenum cofactor biosynthesis protein E [Sphingobium japonicum UT26S]  clstr ali  43  3.RVSIQAEDFDPAAELAALEASGG--GGVASFTGIVRG-DGGLVALELEHYPAMTTAQVDRIVAEACERWPLLGIRVIHRFGRLEPGERIVFVGTASRHRAAALEACAFLIDWLKSQAPFWKKEHFADRTIWVEARAEDDAKADSWKR.. 146
397 6.000e-43gi|51894315|ref|YP_077006.1| molybdopterin converting factor-like protein [Symbiobacterium thermophilum IAM 14863]  clstr ali  34  84.LFAITTEPLSADEIAARVT--NPHSGATLVFVGTVREWTRGRRTLEYEAYPEMAVAQMEQIGREIAERWPGARTAIVHRVGRLEIGEASVVIAVATPHRADAFEACRHAIERLKQIVPIWKKEVWEDGEAWV................. 215
398 6.000e-43NEWGM SOYBN Glyma20g08520.1|Glycine max|JGI  ali  29  9.LVEILENPIDVAKYMNFVSA--PQAGAIATFSGTTRDTFEGKTVMEYEAYVPMAIRCIKSICSSARASWNLHSIAAAHRLGTVPVGETSVFVAVSSVHRADALEACRFFIDEIKAQVPIWKKEVYSNGEVWKENSEFLERRSELGNKDA 159
399 6.000e-43gi|418941003|ref|ZP_13494345.1| molybdopterin biosynthesis MoaE protein [Rhizobium sp. PDO1-076]  clstr ali  41  11..IRVQREDFDSAAESRKLTQGRHDIGALVSFVGLCRDEAGILQALELEHYPGMAEAEMTRIGTLAIERFSLLGLTAIHRHGRIEPGEQIVLVIATATHRQAAFDGANLVMDFLKTSAPFWKKEHGKDGTDWVAAKDADDTARDRW.... 156
400 6.000e-43JCVI_PEP_1096695221767 /source_dna_id=JCVI_ORF_1096695221766 /offset=0 /translation_table=11 /length=156 /full_length=156  ali  36  2IKIRIQQEDFDVSAEIKSMSSKT--VGAIATFSGIVRDESNALISLTLEHYPGMSEDALEKIAAAAMQKGSLEAVRIIHRVGRLLPEDNIVFVGCASAHRHAAFDGCRYIMDFLKTDAPFWKSEETQEGRIWVSEREKDQNASKSWLSK. 150
401 6.000e-43gi|242239854|ref|YP_002988035.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Dickeya dadantii Ech703]  clstr ali  42  4.RIRVGEAGFSVGDEYQWLSA-CESDGAVVTFTGKVRNHNDSVQALTLEHYPGMTEKALEEIVAEARQRWPLQRVSLIHRIGALYPGDEIVFVGVSGAHRHAAFAAAEFIMDYLKTRAPFWKQEATTTGDRWVDARDSDRQAAERW.... 149
402 6.000e-43gi|220936112|ref|YP_002515011.1| molybdopterin biosynthesis MoaE protein [Thioalkalivibrio sulfidophilus HL-EbGr7]  clstr ali  46  1MGVSLHPEPFDPWARLAAHQAQLPSFGATAVFVGTMRDFNEGVRGMTLEHYPGMTEKHLEGIVAEARSRWPLDDCLIAHRVGPIEPGEPIVLTAVWSAHRKAAFEACRYLMEELKHRAPFWKRETLKDGQRWVE................ 139
403 6.000e-43gi|119713684|gb|ABL97734.1| molybdopterin-converting factor large subunit [uncultured marine bacterium EB0_41B09]  clstr ali  36  1MNIIIQENSFSISKIISDLSKKD-NVGAIVSFSGYVREFAKELKSMELEHYPGMTEKALAEIVQSAKSHWDIQEVTIVHRVGKLLPKDIIVGVIVSSRHRSNAFKACEFIIDYLKTDAPFWKKEISHEGEIWVAERQEDVVKKTSWNK.. 149
404 7.000e-43gi|373475560|ref|ZP_09566398.1| molybdopterin biosynthesis MoaE protein [Singulisphaera acidiphila DSM 18658]  clstr ali  35  1.MIEITEATIDHAALTERVRSNQ--AGAVCSFLGTVREMTGDRTSLDYEAYPEMALKKMGELEAEARQRWPILDLALVHRVGHLGLGEISVVVAVSCPHRNQAFEACRWLIDTLKEVVPIWKKEVWADGEEWVHP............... 135
405 8.000e-43gi|332708952|ref|ZP_08428923.1| molybdopterin synthase subunit MoaE [Moorea producens 3L]  clstr ali  33  16..FSITIAPLSLSELYAL--AEDPANGAVVMMSGTVRNQTDGVVALEYQAYEPMALRVFSSIAAQIRASWDVNRVVIHHRIGRLKIGEISVLVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEHWDDGSSWVSIGACEQS......... 156
406 8.000e-43gi|115522952|ref|YP_779863.1| molybdopterin biosynthesis MoaE [Rhodopseudomonas palustris BisA53]  clstr ali  40  5VTIRIQEADFDVGAEIAALTEGRRDIGAVVTFSGICRGADDGVAALTLEHYPGMAEAEIGRHVDTAVARWPLTGVTVIHRVGRMRPGDNIVLVLTASAHRQAAFAAAEFLMDFLKAHAPFWKREERADGTGWVDAQHHDDAAAARWDKD. 155
407 8.000e-43gi|312113530|ref|YP_004011126.1| molybdopterin biosynthesis MoaE protein [Rhodomicrobium vannielii ATCC 17100]  clstr ali  45  1.MIRVQTDIFDPGEEMAHL-GRAAGTGAIATFVGLVRDEGGTLSALTLEHYPGMTERALAALAEEARGRWSVRDIRIVHRVGRMLPGEVIVFVGVAARHRADAFAACEFLIDRLKTDAPFWKFEERREGGRWVDAHQTDDVRAERW.... 144
408 8.000e-43gi|392964714|ref|ZP_10330134.1| Molybdopterin-converting factor subunit 2 AltName: Full=Molybdopterin synthase subunit 2 [Fibrisoma limi BUZ 3]  clstr ali  29  1.MIAITTDPIDVASALKLLQA--DEAGAIDLFLGVVRDKTQEVDHLEYEAYDRMAISEMRKIVDEANRRWKLLRCVVIHRKGTLRIGEIAVLIGVATPHRADAFDATRYVIDTIKQTVPIWKKEIFSDGEVWVNA............... 134
409 9.000e-43gi|428214069|ref|YP_007087213.1| molybdopterin converting factor, large subunit [Oscillatoria acuminata PCC 6304]  clstr ali  36  21.RFALTFAPLSLEEVYAL--ADDPGNGAVVVMSGMVRNQTDGVVALEYQAYAPMAVAVFEQIAASIRSSWPIKRVVIFHRTGRLQIGEISVLVAVGSPHRREAFEACQYAIDTLKHNAPIWKKEHWADGSSWVSIGACETQD........ 163
410 9.000e-43gi|226313778|ref|YP_002773672.1| molybdopterin converting factor MoaDE [Brevibacillus brevis NBRC 100599]  clstr ali  31  86.RFAITEEPISADKLVRLV--SNPHAGAILTFVGTVREFTHGQRTLSYEAYAPMAVEKMKQVAAEIEERWPGAQVAMHHRIGHLTVEEIAVVCAVATAHRNESFEAGRYAIERLKQIVPIWKKEMWEDGSEWK................. 217
411 9.000e-43gi|388494140|gb|AFK35136.1| unknown [Lotus japonicus]  clstr ali  31  15.....TPNPIDVGKYMNYVSA--PQAGAIATFSGTTRDTFEGKAVLEYEAYVPMAIRCINSVCSSARASWNLHSIAVAHRLGTVPVGETSVFIAVSSVHRADALEACKYLIDELKATVPIWKKEVYSNGEVWKENSEFLDRRSELGNKD. 158
412 1.000e-42gi|384070153|emb|CCH03363.1| Molybdopterin-converting factor subunit 2 Molybdopterin synthase subunit 2 [Fibrella aestuarina BUZ 2]  clstr ali  31  1.MIALTADPIDFSSAYHYL--QTDEAGAIDFFFGVVRNNTRDVQQLDYEAYGPMAVREMQKIADEACRRWNVLRYVIIHRTGVLRIGEMAVLIGVATPHRDAAFEATRYIIDTIKQTVPIWKKERFTDGEVWVNA............... 134
413 1.000e-42gi|254468220|ref|ZP_05081626.1| molybdopterin converting factor, subunit 2 [beta proteobacterium KB13]  clstr ali  35  1.MVRIQQDSFDINSEVKNIKRSDESVGALVTFVGYVRDFSDTLTSMEIEFYPGMTEKALLEIEEKARRAWDIFDVNIIHRFGKLNLNDEIVLVAVTSAHRTDAFRACEFIIDFLKTDAPFWKKEIGLKSESWVDANIKDYEKINKW.... 150
414 1.000e-42JCVI_PEP_1096688516181 /source_dna_id=JCVI_ORF_1096688516180 /offset=0 /translation_table=11 /length=161 /full_length=161  ali  35  9..ISIQREDFDLAKEYAKLRVKIGNVGAIVTFTGTVRNTEERTSSLRLEHYPGMTEESISNILFEASQRWDLLGQRVVHRVGDLSPGDQIVLVLVASKHRPDAFAACEFVMDYLKTRAIFWKYEGSSKSGTWVNSTESDYDRLNRWS... 160
415 1.000e-42gi|372267488|ref|ZP_09503536.1| molybdopterin biosynthesis MoaE [Alteromonas sp. S89]  clstr ali  39  5ISISVQAEGFDPGVEYNLLRSENYVDGATAMFVGNVRDFSHSVAVLELEHYPGMAEAALTDIARQAAQRWPLGRVRIIHRFGPLAAGDEIVFVGATSAHRQAALDACAFIMDFLKSRAPFWKREFGADKGDWVQARNSDEDALKKW.... 159
416 1.000e-42gi|209524230|ref|ZP_03272780.1| molybdopterin biosynthesis MoaE protein [Arthrospira maxima CS-328]  clstr ali  32  12..FAISLGQLSLEDVYNLV--DDPANGAIVVMSGMVRNQTDGVKSLEYQAYQPMALRVFQEIAEQIKTQWPVTRVVIQHRIGHLQIGDISVLVAVGCPHRREAFEACQYAIDTLKHNAPIWKKEHWVDGSSWV................. 144
417 1.000e-42gi|300867223|ref|ZP_07111886.1| molybdopterin synthase subunit MoaE [Oscillatoria sp. PCC 6506]  clstr ali  34  20..FAITFAPLSVAEIYTL--ADDAANGAVVMMSGTVRNQTDGVVALEYQAYEPMAVRVFRQIATEIRRQWPVNRVVIHHRVGRLEIGEISVLVAVGCPHRSEAFAACQYGMDTLKHNAPIWKKEFSTDGSSWVSIGACEA.......... 159
418 1.000e-42gi|428300085|ref|YP_007138391.1| molybdopterin synthase subunit MoaE [Calothrix sp. PCC 6303]  clstr ali  33  21..FAIHFAPLSMNEIYN--KADDAANGAVVVMSGTVRNQTDGVVTLEYQAYEPMALQVFYQIAANIRQQWDVNRVVIYHRVGRLQIGEISVLVAIGCPHRSEAFEACRYAIDTLKHNAPIWKKEHFHDGSSWVSIGACEQ.......... 160
419 1.000e-42gi|222837081|gb|EEE75460.1| predicted protein [Populus trichocarpa]  clstr ali  49  44........PFSVGEEY-PWLAERDEDGAVVTFTGKVRNHNDSVNALTLEHYPGMTEKALAEIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGDRW.................. 168
420 1.000e-42gi|381202934|ref|ZP_09910043.1| molybdopterin biosynthesis MoaE protein [Sphingobium yanoikuyae XLDN2-5]  clstr ali  44  3.RVAIQADDFDISAELAALEALGG--GGVASFTGIVRGE-EGLVALELEHYPAMTQRQVERIAEEAMARWPLLGLSIIHRHGRLLPGERIVFVGTASRHRAAALESCAFLIDWLKSRAPFWKKAHYADGAAWVAPRAEDEAKAQDWDR.. 147
421 2.000e-42gi|407800106|ref|ZP_11146973.1| molybdopterin converting factor subunit 2 [Oceaniovalibus guishaninsula JLT2003]  clstr ali  45  1MEIRILPDAFDPGAELARFSTDRSGTGAIVTFTGLVRDDGGALHALEIEHYPGMTEAAVTAMVAEAEGRWTLTDALVVHRHGTLRPGEPIMMVXXXXXXXXXXXXXXEFLMDYLKSRAPFWKKETTRDGTSWVAARDEDEAALDRW.... 146
422 2.000e-42METAHIT MH0011 GL0016560 [Complete] locus=scaffold40122_1:1024:1710:+  ali  39  5.KVVVQTADFDAGKESAALLAGDTADGALVTFTGLVRG--GGITAMELEHYPEMTEKSLRAIVDDARRRWPLGGVTIIHRVGKLLPGDQIVLVIVASPHRAAAFEAAEFMMDWLKTEAPFWKKEYLTDGTAWVDARETDEKAKK...... 147
423 2.000e-42gi|291294514|ref|YP_003505912.1| molybdopterin converting factor subunit 1 [Meiothermus ruber DSM 1279]  clstr ali  36  110...................WASDHPYGAVVSFLGTTRSPNKGVSYLEYEAYPGMAEKVMQQIIAEMRARWVLGRVALWHRLGRVLPGEGSILIVVSAPHRPEAFEACRYAIERVKQILPVWKKEFLPDGSHWVEGHAPEEHRL....... 235
424 2.000e-42gi|408375000|ref|ZP_11172679.1| molybdenum cofactor biosynthesis protein E [Alcanivorax hongdengensis A-11-3]  clstr ali  37  4.HIEICERPL-ASAAPASWLHDAGLSGAQVQFCGQVRDEQGQVQALHLEHYPGMTERVLRAIVAQAGEKWPLNGAWVVHRIGTITAGDDIVQVAVSASHRQDAFQACAFIMDLLKTRAPFWKKELIGGHWQWVEARECDAEAAAAWLQQA 151
425 2.000e-42gi|126316416|ref|XP_001380755.1| PREDICTED: molybdopterin synthase catalytic subunit-like [Monodelphis domestica]  clstr ali  27  46.IIKFTPEKLSVDEVSQLVIS--PVCGAVSLFVGTTRNNFEGVVSLEYEAYVPMAEAEVRKICNAVRQQWPVKHIAICHRLGLVPVTEASVVIAVSSAHRAASLEAVKYIIDTLKAKVPIWKKELYEEESSWKRNKECFWTKND...... 189
426 2.000e-42gi|150399301|ref|YP_001323068.1| molybdopterin biosynthesis MoaE protein [Methanococcus vannielii SB]  clstr ali  30  1.MIRVSNEDFNIDIETKALLEKYPNIGGIVNFVGVVRNYDKGIEKLEFECYDKMAEKKLEELKNKAIEQFGIIDATLIHRIGKLSVGENIVLIIVCAKHRKEAFLACEYLINNLKKEVPIWKKEFSKDGSYWVEQH.............. 141
427 2.000e-42JCVI_PEP_1096689751429 /source_dna_id=JCVI_ORF_1096689751428 /offset=0 /translation_table=11 /length=155 /full_length=155  ali  40  9IGIQIQREAFDVGLQTRLLRTGTDGVGAVASFIGTVRDLNEGVKVLNLEHYPGMTESAIAEIIDDARQRWPLYAVSVIHRIGPLRPADEIVWVGAASAHREAALAACAFVMDFLKSRAPFWKKEELDAGSRWVSARDADE.......... 155
428 2.000e-42gi|341582547|ref|YP_004763039.1| molybdopterin converting factor, subunit 2 [Thermococcus sp. 4557]  clstr ali  36  1MKVRLTEEPFDLNTALRYLLV--PEAGGYVFFLGKVRSESHGVRKLVYEAYPEMAQAEMERIRNEALERFPILDMLIWHRYGELEVGQDTILIIASGRHRKEAFEACEWAIDEVKKRVPVWKREVTDEGEFWIEG............... 135
429 3.000e-42gi|269925252|ref|YP_003321875.1| molybdopterin biosynthesis MoaE protein [Thermobaculum terrenum ATCC BAA-798]  clstr ali  31  1.MIAVTQDPISIDELISSV--SHPGAGAIVIFLGVVRDNNEGVRYLEYESYEPAAKASMQKICGFAKDKWPGVRISAVHRVGKLNIGDISVAVVASAPHRQEAFAAARFVIDSIKEESPIWKKEIFEGGEVWI................. 132
430 3.000e-42gi|405956636|gb|EKC23108.1| Molybdenum cofactor synthesis protein 2B [Crassostrea gigas]  clstr ali  25  4..IEITDEILDVNKISHMVT--DPSCGAISIFVGITRDNFDGVLRLEYEAYKPMAKKKMKEICDSIRKQWEIHNIAMIHRINVVPISEASIVIAISSPHRKESLQAVEYAIDTLKATVPIWKKEIYADESSWKENKECSWSK........ 144
431 3.000e-42gi|254414835|ref|ZP_05028599.1| molybdopterin converting factor, subunit 2 [Coleofasciculus chthonoplastes PCC 7420]  clstr ali  33  15..FAITFAPLSLADVYTL--ADDPANGAVVVMSGTVRNQTEGVVSLEYQAYEPMALRVFATIAQDIRGKWDVNRVVIHHRIGRLQIGEISVLVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEHWADGSTWVSIGACEQ.......... 154
432 3.000e-42gi|240102230|ref|YP_002958538.1| moaE molybdopterin synthase, large chain (moaE) [Thermococcus gammatolerans EJ3]  clstr ali  33  102.KVKITGEPFSVDEAIKLV--ERDEAGGYVVFLGKVRNENRGVLKLIYEAYEEMALKEMEKIRKEALEKFPILDMLIWHRVGELKVGEDTILIVASAKHRSEAFDACRWAIDEVKKRVPVWKKEVTEEGTFWIEGEQTIPEDYHK..... 245
433 4.000e-42gi|254284335|ref|ZP_04959303.1| molybdopterin converting factor, subunit 2 [gamma proteobacterium NOR51-B]  clstr ali  36  1MGVFVQRERFDVAAAYRDLLSAHPGA-AVVTFTGYVRDFGQGVNALELEHYPGMAERVLYELGQSASSRFGLRGWQLIHRYGKLGTGEPIVWVGTVADHRTAAFDSCNFIMDVLKTDAPFWKREHSGGQSHWVEANGDDAKRRRQW.... 147
434 5.000e-42JCVI_PEP_1096699096465 /source_dna_id=JCVI_ORF_1096699096464 /offset=0 /translation_table=11 /length=140 /full_length=140  ali  30  1IMIKIQKENFQVDYEIEKIKSLSNEIGAVTNFIGYVRNNSKKVKSIYVEVYEEMAIKSLKKICENAKNKWNLIDYLVIHRFGNLSINDKIVLVSTFSKHRKESFESCNFIMDYLKKEAPFWKKENYENESKWLKN............... 137
435 5.000e-42gi|226943259|ref|YP_002798332.1| molybdopterin converting factor large subunit [Azotobacter vinelandii DJ]  clstr ali  46  1MGIRVQVGTFEPGRELDALHAANAGVGAVVGFVGYVRDFNEGVGGMFLEHYPGMTEKALAKIADEAARRWPLLRVEVLHRIGRLEPGEPIVFVGTASAHRQAAFDACAFIMDYLKIRAPFWKKEDTGEGPRWVEGRDSDQEAARRW.... 148
436 5.000e-42gi|298242643|ref|ZP_06966450.1| molybdopterin biosynthesis MoaE protein [Ktedonobacter racemifer DSM 44963]  clstr ali  38  4.IIQLTHAPLERDALVAAV--SHPSAGGIVVFEGVVRDHARGVRHLEYEAYEEMARQRIQEIIAEAEQRWGVERVAVAHRFGRLEIGEASVIIVVASPHRAEAFDACRYIIDTLKASVPIWKKEVATTGEEWVEG............... 137
437 6.000e-42gi|427737978|ref|YP_007057522.1| molybdopterin converting factor, large subunit [Rivularia sp. PCC 7116]  clstr ali  31  21..FAINFAPLSLPEVYNL--ADHPANGAIVVMSGTVRNQTDGVISLEYQAYEPMALRVFYQIADDIRKKWDTNRVVIHHRTGHLQIGEISVLVAVGCPHRSEAFDACRYAIDTLKHNAPIWKKEHNRDGSSWVSACEVDE.......... 162
438 6.000e-42gi|427730476|ref|YP_007076713.1| molybdopterin converting factor, large subunit [Nostoc sp. PCC 7524]  clstr ali  32  21..FAITFAPLSLEEIYA--KADDPGNGAIVVMSGMVRNQTDGVVSLEYQAYEPMALQVFYQIAADIRVIWDVKRVVIHHRIGRLQIGEISVLVAVGCPHRSEAFEACRYAIDTLKHNAPIWKKEHWQDGSSWVSIGACEQS......... 161
439 7.000e-42gi|259415144|ref|ZP_05739066.1| molybdopterin converting factor, subunit 2 [Silicibacter sp. TrichCH4B]  clstr ali  46  1MRVVVQQEPFDFGSEAEAFATGAGGAGAVVTFTGVVREDSGAMAVMEIEHYPGMTEKALEKIASEAIARWDLTDALVIHRHGRLVPGDQIMMVATAARHRVAAFEAAEYLMDYLKSRAPFWKKEILQNGAEWVAAKSADEDALRRW.... 148
440 8.000e-42JCVI_PEP_1096689447367 /source_dna_id=JCVI_ORF_1096689447366 /offset=0 /translation_table=11 /length=163 /full_length=163  ali  39  9ILVKVQKEQIAVGSLIEQLSEREGEVGAITTFIGRVREETRQVNELFLEHYPVMTEKKITEIVCNASKKFSINGCIVIHRIGKLVPGELIVFVGVTSRHRKDTFEACSYVMDFLKTEAPFWKKEKCSKGEKWIKSRDTDYLARDAW.... 159
441 8.000e-42gi|357974953|ref|ZP_09138924.1| molybdopterin biosynthesis MoaE protein [Sphingomonas sp. KC8]  clstr ali  40  4..IRVQAEAFDPGAELARLEALGG--GAVASFTGLVRG-DGGLIDMTLEHYPAMTTRAMAAIAETAEARWPLIGLTLIHRYGVLVPGDRIVFVGTASSHRAAALESCAFLIDWLKTAAPFWKRERYADGGAWVEAKAADDEATARWQ... 146
442 9.000e-42gi|338213845|ref|YP_004657900.1| molybdopterin biosynthesis protein MoaE [Runella slithyformis DSM 19594]  clstr ali  33  2IDIQLLETTLSTQTCFDYVLS--DEAGGIVTFVGTVRHQTKGVLRLEFEAYAPMAIREMQKIAEEAMRRWPVLKISIHHRVGVLDIGEIPVIIAVACAHRNTAFEACQFAIDTLKETVPIWKKEFFEDGEVWVAAH.............. 137
443 9.000e-42gi|138894336|ref|YP_001124789.1| molybdopterin converting factor subunit 2 [Geobacillus thermodenitrificans NG80-2]  clstr ali  30  5.LFSITSEPISVEAVMKKVM--RPEAGAVAVFAGTVREWTNGKRTLFYEAYVSMAEKMLAQIGAEIAEKWPGTKTAITHRIGRLEIGDIAVVIAVSSPHRAEAYEANRYAIERIKQIVPIWKKEQWEDGSAWI................. 136
444 9.000e-42gi|333373314|ref|ZP_08465226.1| molybdopterin converting factor [Desmospora sp. 8437]  clstr ali  31  92....ITEEALSADRLIREV--SNPWAGAVLTFAGIVREYTHGQKALEYEAYAPMALRKMEEIVGEIQRRWPEVRVAMGHRTGKLAIGEISVLIAVASPHRGESFAAGRYAIERLKETVPIWKKEIWADGSQWKGPQTGPWDPRQK..... 232
445 1.000e-41JCVI_PEP_1096687901233 /source_dna_id=JCVI_ORF_1096687901232 /offset=0 /translation_table=11 /length=161 /full_length=161  ali  31  9IKIKIQKNDFDVSKETKQLNINQP--GAIVNFIGIVRGTNEKIYSMTLEHYPGMTETEIETIIYDASKRWKISAVTVIHRIGKLFSSDQIVFVGVASKHRQNAFNACNYIMDWLKTKAPFWKIEESSKEKKWVKFNVSDDDAIKKWTE.. 158
446 1.000e-41gi|422303289|ref|ZP_16390643.1| Molybdopterin synthase catalytic subunit [Microcystis aeruginosa PCC 9806]  clstr ali  29  6..FRVSFAPLSLQEVYQL--ADDGANGAIVLMSGTVREQTDGVIYLDYQAYEPMAIEVFRQIAGQIRQTWPDTRVVIHHRTGKLQIGEISVLVAVGCPHRGEAFAACRYAIDTLKHNAPIWKKEYWSDGSQWVSIGACELE......... 146
447 1.000e-41gi|336114691|ref|YP_004569458.1| molybdopterin biosynthesis protein MoaE [Bacillus coagulans 2-6]  clstr ali  29  1.MFEIVKEPVDVSKLIQAV--ADRNAGAIVTFIGTVREMTKGKKTLEYEAYEPMARKKLEQIGTEIRQQFPEAKTAIVHRTGRLGISDIAVAIAVSAPHRDEAYRANRYAIERIKEMVPIWKKEHWENGEMWVGN............... 134
448 1.000e-41gi|406832618|ref|ZP_11092212.1| molybdopterin biosynthesis MoaE protein [Schlesneria paludicola DSM 18645]  clstr ali  36  1.MISLTHSPIDYHALTESVRS--PQSGAVVLFLGTVREMTGQRRALNYEAYPTMAERKLGELETAARARWPIDQVGIVHRLGHLELGEISVAVAVSCPHRKQAFEAGQFLIDELKVSVPIWKQENWDDGSEWVDP............... 135
449 1.000e-41JCVI_PEP_1096683871453 /source_dna_id=JCVI_ORF_1096683871452 /offset=0 /translation_table=11 /length=240 /full_length=240  ali  46  92IDIRVVSEPFDPWALQADLVGDAAAG-ALAAFVGLMRDFSRRVTAMTLEHYPGMTESALREIAEAAAERFDLQRVRVVHRVGCILPTQPIVLVAVTAAHRGEAFRGCEYLMDYLKTRAPFWKKEATDQGERWVEARHSDAAAAARWG... 239
450 1.000e-41gi|87198949|ref|YP_496206.1| molybdopterin synthase subunit MoaE [Novosphingobium aromaticivorans DSM 12444]  clstr ali  43  3.RVRLALDAFEPADEIAAFNALHPAAGGIVTFLGQVRE-GGGVEALELQHYAPMTLPGMEELARVAERRWPLEGLLIVHRSGVMKPRDPIVLVCAAARHRRDAFAAADYVMDHLKSESWFWKREKTAAGWHWVEPRAQDHDDLSRW.... 146
451 1.000e-41gi|428265002|gb|AFZ30948.1| molybdopterin synthase subunit MoaE [Gloeocapsa sp. PCC 7428]  clstr ali  33  20..FAITFAPLSLEEVYAL--ADDAANGAIVVMSGMVRNQTDGVVSLEYQAYEPMAMQVFRQIAAEIRKTWDVNRVVIYHRVGRLHVGEISVLVAIGCPHRSEAFEACRYAIDTLKHNAPIWKKEHSLDGSSWVSIGACETQ......... 160
452 2.000e-41gi|407978860|ref|ZP_11159686.1| molybdopterin converting factor large subunit [Bacillus sp. HYC-10]  clstr ali  30  5.LFNITKKPIDVNELIQHVT--RRKAGAITTFIGTVREWTNGKKRLTYEAYIPMAESMLRQIGQEIKKRWPDTEAAIVHRIGTLDISDIAVAIAVSSPHRKAAYEANEYAIERIKEIVPIWKKEYWEDGEAWI................. 136
453 2.000e-41gi|427724559|ref|YP_007071836.1| molybdopterin synthase subunit MoaE [Leptolyngbya sp. PCC 7376]  clstr ali  30  12..FVITIAPLSFDEMYR--RSEDPASGAVVVMSGTVRNKTDGVKYLEYQAYEPMAKVVFQQIARQIRSQWPVNRVVIHHRVGKLVIGEISVLIAVSTPHRAEAFAACKFGIDTLKHNAPIWKKEFFSDGSEWVQGC.............. 147
454 2.000e-41NEWGM MIMGU mgf001778m|Mimulus nasutus (Yellow monkey flower)|JGI  ali  28  11.LIEILEEPIDITKYINYV--QSPHCGAISTFAGTTRDTFEGKTVLEYEAYVPMAIRCIKSICTSARSSWNLSSIAVAHRLGPVPVGEISVFIATSSVHREDSLDACKFMIDEVKASVPIWKKEVYSNGEVWKENSE............. 148
455 2.000e-41gi|241203965|ref|YP_002975061.1| molybdopterin biosynthesis protein MoaE [Rhizobium leguminosarum bv. trifolii WSM1325]  clstr ali  43  17..IRVQHEDFDLQAEVDLLSKGKPGIGAVVTFSGLCRDEGGTLAALELEHYPGMAEAEIRRIGDLAIQRFGLLGLTAIHRYGKIATSENIVLVVAAAPHRQAAFDGANFVMDFLKTAAPFWKKEHVRDGATWV................. 149
456 2.000e-41gi|297182926|gb|ADI19075.1| molybdopterin converting factor, large subunit [uncultured delta proteobacterium HF0070_15B21]  clstr ali  28  1MPVSITREPIDLTALRQ--RALHPQAGAVLIFCGDIRNHSDNVDKLEYESHESMALNQMDQVAEEASQKWPIHYVEIIHRLGTMEVMECSIAIAVSTSHRADAYEASRFIIDTVKRSVPIWKKEFFSGGTSWSEGCE............. 138
457 2.000e-41gi|328542827|ref|YP_004302936.1| Molybdopterin synthase subunit MoaE [Polymorphum gilvum SL003B-26A1]  clstr ali  45  6.LVRVQVEDFDVAVESARLTEGRRDIGAVVAFTGLCRDEGGRLEALMLEHYPGMAEAEMTRIAEQACSRWPLSGLTVIHRFGEIRPGANIVLVVAASSHRRAAFEAADFLMDYLKTRAPFWKKEIAAGQSDWVXXXXXXXXXXXRWQ... 153
458 2.000e-41gi|407803330|ref|ZP_11150166.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Alcanivorax sp. W11-5]  clstr ali  48  29............................VVLFSGLVRDEGDQVQTLTLEHYPGMSERRLRELCEQVAARWPLARVLAWHRVGVMTPAETIVLVGVAAAHRREAFEACDCLMDRVKTEVPLWKKLSGPGGDGWVEARDRDREAAARWH... 147
459 2.000e-41gi|212224771|ref|YP_002308007.1| molybdopterin converting factor subunit 2 [Thermococcus onnurineus NA1]  clstr ali  34  1MKVKITKEPFDLNEALSYLLV--PEAGGYVFFLGKVRNENHGVRKLIYEAYEEMAIEEMERIRGEALEKFPILDILIWHRYGELNVGEDTILIIASGKHRKEAFEACMWAIDEVKRRVPVWKREVTDEGIFWIEG............... 135
460 2.000e-41gi|56090313|ref|NP_001007634.1| molybdopterin synthase catalytic subunit isoform Mocs2B [Rattus norvegicus]  clstr ali  26  57.IIQFTAKKLSVGEVSQLVVS--PLCGAVSLFVGTTRNNFEGVISLEYEAYLPMAENEIRKICNDIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEIYEESSSWKRNKECFWAA........ 198
461 3.000e-41gi|163857984|ref|YP_001632282.1| molybdenum cofactor biosynthesis protein E [Bordetella petrii DSM 12804]  clstr ali  38  1.MIIVQEADFDSAALLARLREQGAEAGAIVTFTGYVRDFAPGTETLYLEHYPGMCERELHDIAATAQQRWNLAGTTIAHRVGALQRNAQIVFVAAASAHRGDAFRGCEYMIDALKTRAPFWKRETLQGGSFWVEQRAADHERTQAWD... 150
462 3.000e-41gi|255564476|ref|XP_002523234.1| molybdopterin synthase large subunit, putative [Ricinus communis]  clstr ali  30  9.LVEILEEPIDLAKYINYVSA--PQAGAIATFSGTTRDTFEGVVELRYEAYVPMAIRQLKSICSSARLSWNIHSIAVAHRLGSVPVGETSVFVAVSAVHRTDALDACKFAIDELKASVPIWKKEVYSNGEVWKENSE............. 146
463 3.000e-41gi|297564811|ref|YP_003683783.1| molybdopterin converting factor subunit 1 [Meiothermus silvanus DSM 9946]  clstr ali  35  93..FGLTSDPLNLQPYVEW--ASAPPYGAVVVFLGTTRSPNRGVTYLEYEAYPGMAEAVMRQIITEMRQRWVLGRIALWHRTGRVHPAEASILIVVSAPHRPEGFEACRYAIERVKQILPVWKKEFAPDGSHWVEGH.............. 226
464 3.000e-41gi|126740603|ref|ZP_01756290.1| molybdopterin converting factor, subunit 2 [Roseobacter sp. SK209-2-6]  clstr ali  47  1MHVKVQEERFEFGREAEAFAAGCAGAGAVVTFTGVVRDADGGLVAMEIEHYPGMTQKALEKITADAMARWSLADALVIHRHGRLEPGEQIMMVATAARHRVAAFEAAEFLMDYLKSRAPFWKKEILENGSSWVEAKEIDEEALTRW.... 148
465 3.000e-41gi|108757602|ref|YP_630783.1| molybdopterin converting factor, subunits 1/2 [Myxococcus xanthus DK 1622]  clstr ali  36  91.KFLVVDRPLRLEEVVEAVRG--ESYGGLVTFSGSVRNQTKGVLRLEYEAYAPMAEKKLAEIGAEAAERFPGVRVSIIHRVGTLVPGELAVVIAAASPHRKEAFGGCEYAIERLKQDVPIWKKEFFEDGEVWV................. 222
466 3.000e-41gi|75910950|ref|YP_325246.1| molybdopterin synthase subunit MoaE [Anabaena variabilis ATCC 29413]  clstr ali  33  23..FAITFAPLSLEEIYAL--ADDSANGAVVVMSGMVRNQTDGVLALEYQAYEPMALRVFYQIAADIRSAWPVNRVVIHHRIGRLQVGQISVLVAIGCPHRSEAFEACRYAIDILKHNAPIWKKEHWQDGSSWVSIGACEQS......... 163
467 3.000e-41gi|300779532|ref|ZP_07089390.1| molybdenum cofactorbiosynthesis protein large subunit [Chryseobacterium gleum ATCC 35910]  clstr ali  27  2VDIKITEHILDLTDCFAL--ASDHAYGGIASFVGTVRNHTKGVTRLEYECYQSMAVKEIQKIADKAISLFSVKNIVVHHRTGVLFPGDAAVIIVVSDGHRNAVFDACSFMIENIKKTVPIWKKEIFEDGEEWVSAH.............. 137
468 3.000e-41gi|218439691|ref|YP_002378020.1| molybdopterin biosynthesis MoaE protein [Cyanothece sp. PCC 7424]  clstr ali  31  18..FKISFAPLSVEEVYSL--ADDGANGAIVMMSGTVRNQTDGVIYLEYQAYEPMALEIFRQIAANIRIQWPDTRVVIHHRIGKLQIGEISVLVAVGCPHRGEAFEACRYGIDTLKHNAPIWKKEFWQDGTSWVSIGACEIE......... 158
469 3.000e-41gi|315648864|ref|ZP_07901959.1| molybdopterin converting factor, subunit 1 [Paenibacillus vortex V453]  clstr ali  29  104....ITSDKLSVEEAVAKV--HDANHGATLSFIGTTREMTGEMRTLEYEAYIPMALKEMQQICADILSQWPGTQCAISHRIGTVGIGETSVVIAVSSPHRASCYDASRYAIEQLKRSVPIWKKEIWDDGSEWKGP............... 234
470 3.000e-41gi|167465400|ref|ZP_02330489.1| molybdopterin converting factor-like protein [Paenibacillus larvae subsp. larvae BRL-230010]  clstr ali  29  102....ITYEPIQVEEVTQKVI--HPHHGAVLSFVGTTREFTNGQRTLEYEAYVPMALKTMEQIGTELAQRWPGTRCAITHRLGRVDLAEISVVIAVSSPHRAECYEASRYAIERLKQIVPIWKKEVWEDGSEWK................. 230
471 3.000e-41gi|168700070|ref|ZP_02732347.1| molybdopterin converting factor-like protein [Gemmata obscuriglobus UQM 2246]  clstr ali  35  1.MFRLTHDPIDYHALTESVR--NPHCGAVVLFLGTVRDLTGSRVTLEYEAYAPMAEKKLAEIEAAARERWPIGELAITHRLGRLEVGEVSVAVAASCPHRGDAFDACRYVIDTLKELVPIWKKENAPDGTEWVH................ 134
472 3.000e-41gi|156396900|ref|XP_001637630.1| predicted protein [Nematostella vectensis]  clstr ali  30  8....ITPDVLHVEQVMAL--AQSPSAGAVSLFVGTTRDNFEGVVRLEYEAYIPMASSEMRKICKLAREKWNIMKIAIYHRIGIVPIGEASVIIAVSSAHRKESLEAVSFIIDTLKATVPIWKKEIYEQGEQWKENKECSW.......... 144
473 4.000e-41JCVI_PEP_1096684723475 /source_dna_id=JCVI_ORF_1096684723474 /offset=0 /translation_table=11 /length=150 /full_length=150  ali  35  1VQVFIQKESFDVGAHYDFLVRAFSGA-AVVTFTGYVREYQGDLTGLELEHYPAMTERRLQELGEEAAARFDLKTWRIVHRYGRLEVTDPIVWAGVVADHRGAAFDGCQFIMDTLKTDVPFWKREYLSNGKQWVEAKNNDNLRRQRW.... 148
474 4.000e-41JCVI_PEP_1096694923047 /source_dna_id=JCVI_ORF_1096694923046 /offset=0 /translation_table=11 /length=149 /full_length=149  ali  31  1MAIIIQEDSFSISKICAEL-SDKDNVGAIVSFSGHVREFSKDKKYLEIEHYPGMTEKALEDIEKKAMKNWDVADIRIVHRVGRLLPKDLIVGVIVSSMHRSNAFKACEFVIDFLKTDAPFWKKEISEDSENWVDERQEDIIKKTNWN... 148
475 4.000e-41gi|427418101|ref|ZP_18908284.1| molybdopterin converting factor, large subunit [Leptolyngbya sp. PCC 7375]  clstr ali  33  21..FAITFAPLSLDEIYHL--ADDEANGAIVVMSGMVRNNTEGVVALEYQAYEPMAIAVFKQIAAEMRQRWDITHVVIHHRTGKLTVGEISVLVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEIWKDGSSWVSIGACEDD......... 161
476 4.000e-41gi|411009901|ref|ZP_11386230.1| molybdopterin converting factor subunit 2 [Aeromonas aquariorum AAK1]  clstr ali  40  10.RILVQREDFSLADEYARLAARQD-TGAVVSFVGKVRDFNQGVKGLALEHYPGMTEKALTDIVAEARSRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMDFLKTRAPFWKK........................... 132
477 5.000e-41gi|157140219|ref|XP_001647626.1| molybdopterin synthase large subunit, putative [Aedes aegypti]  clstr ali  29  5...KLTFDKLEVGEINDLV--AHESCGAISLFVGTTRDNFDGKTVLEYEAYEAMALKTMNQICEELRARWPIKHIGIHHRLGTVPVKEASVVIAVSSPHRKSSLEAVHFAIDELKKSVPVWKKEQYAEGEEWKENKECSWSKSHR..... 150
478 5.000e-41gi|261408747|ref|YP_003244988.1| molybdopterin converting factor subunit 1 [Paenibacillus sp. Y412MC10]  clstr ali  26  104....ITCHRLSVEETIAKV--HDDNHGATLSFVGTTREITGQMRTLEYEAYIPMALKEMQQICMDIHGRWPGTKCAISHRIGTVGIGETSVVIAVSSPHRETCYEASRYAIEQLKRSVPIWKKEIWDDGSEWKGAQTGPWDPIAR..... 244
479 5.000e-41gi|218245639|ref|YP_002371010.1| molybdopterin biosynthesis MoaE protein [Cyanothece sp. PCC 8801]  clstr ali  33  22...KMTFAPLSLDEVYGL--ADDPANGAIVVMSGTVRQQTDGVHYLEYQAYEPMALEIFRQIAVNIRQEWSDTRVVIHHRTGKLNIGEISVLVAVGCPHRGEAFAACRYAIDTLKHNAPIWKKEHWKDGSSWV................. 153
480 5.000e-41JCVI_PEP_1096691531349 /source_dna_id=JCVI_ORF_1096691531348 /offset=0 /translation_table=11 /length=203 /full_length=203  ali  52  78MDVRVQSGAFDLGAEANGFAGRVDGAGAVVTFTGIVRNTAAGDQAMEIEHYPGMTEKAITAIAEEARTRWALADVLVIHRHGRLAPGETIMMVATAALHRKDAFEAAEYLMDYLKSRAPFWKK........................... 201
481 5.000e-41gi|145234190|ref|XP_001400466.1| molybdopterin synthase catalytic subunit [Aspergillus niger CBS 513.88]  clstr ali  31  34.HITLTYHPLDPTSALSKI--SSPNAGANVLFLGTTRNEDRPVAQLSYTAYPPLALKTLSKIAEDAVAKHELLGVVIGHRLGDVPIGESSIVIAVSAGHRGAAWRAGEEVLELCKEKAEIWKKEVFVDGQEWRANRDRDAE......... 174
482 5.000e-41gi|357008494|ref|ZP_09073493.1| molybdopterin converting factor-like protein [Paenibacillus elgii B69]  clstr ali  28  89....ITHDPILADEVTAKVL--HPDHGATLAFVGTTREFTHGKRTLEYEAYEPMALKTMRQIGDELSSRWPGTRLAITHRLGSVPVGETSVVIAVSSPHRDFVYEASRYAIERLKQIVPIWKKEIWEDGSEWK................. 217
483 6.000e-41gi|281200805|gb|EFA75022.1| molybdenum cofactor synthesis protein 2 large subunit [Polysphondylium pallidum PN500]  clstr ali  26  21..IEVSEEPIDF-KVGGYNRVEDDNAGAISTFLGTTRNNFKGVEKLEYEAYTPMAVKEIAKICSHLFTTYNILHIAVLHRIGTVPIGEASILIAISSAHRHDSLTAVQYAIDTIKATVPIWKKEYYTDGSVWKDNCESCH.......... 161
484 6.000e-41gi|113477773|ref|YP_723834.1| molybdopterin synthase subunit MoaE [Trichodesmium erythraeum IMS101]  clstr ali  33  20..FSITIAPLSIAEIYAL--ADNPSNGAVVVMSGMVRNITDAVIALEYQSYQPMAIKVFEQIATEIRHQWPVNTVVIHHRVGRLNVGDISVLVAIGCPHRSEAFEACRYTIDTLKHTAPIWKKEHWADGSSWVSIGACEIE......... 160
485 6.000e-41gi|170740019|ref|YP_001768674.1| molybdopterin biosynthesis protein MoaE [Methylobacterium sp. 4-46]  clstr ali  45  4.RLSIQSDPFDVAAEIAALSAADGRAGAVVSFTGLCRDEGGRLAALELEHYPGMAEEEVGRVLDEAARRWPLDGVTVIHRHGRIRPGEGIVLVLTASAHREAAFAAASFLMDYLKTRAPFWKREHLRDGTMWVEATAQDEAAAGRW.... 151
486 6.000e-41gi|392374288|ref|YP_003206121.1| molybdopterin-converting factor subunit 2 (Molybdopterin synthase subunit 2) (MPT synthase subunit 2) (Molybdenum co  clstr ali  37  1.MFEITDQPLSLEPLVTTVKRS--SSGAIATFLGVVREQTQGVRYLEYEAYREMAIPKMREIADEIRRKWEIDEVAMVHRVGRLQIGEASVAIAVSAPHRHAALTACAYAIDRLKEVVPIWKKEVWTDGEEWAGPGICDHH......... 140
487 6.000e-41gi|411119911|ref|ZP_11392287.1| molybdopterin converting factor, large subunit [Oscillatoriales cyanobacterium JSC-12]  clstr ali  31  28.HFAIRFAPLSLNEVYGL--ADDAANGAIVVMSGVVRNNTDGVVALEYQAYEPMALRVFQKIAAEIRSTWDVTHVVIHHRVGKLQIGEISVLVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEHWADGSSWVSIGACKQAAED...... 172
488 6.000e-41gi|427708221|ref|YP_007050598.1| molybdopterin synthase subunit MoaE [Nostoc sp. PCC 7107]  clstr ali  33  17..FAITFAPLSLEEIYA--KADASANGAVVVMSGMVRNNTDGVVALEYQAYEPMAMQVFYQIAAEIRTFWEINRVVIHHRIGRLQVGEISVLIAIGCPHRGEAFEACRYAIDTLKHNAPIWKKEHWQNGSSWVSIGACEQS......... 157
489 6.000e-41gi|344343329|ref|ZP_08774198.1| molybdopterin biosynthesis MoaE protein [Marichromatium purpuratum 984]  clstr ali  39  4..IRVQHEPLDPLAEQAVLNDTDGRVGAVVSFTGLMRGAEGAVDGMVLEHYPGMTEQALEALAAQAERAWPLTDLVLVHRVGRLAPGDPIVFVGVGSAHHAAAFRACEFLIDALKTRVPLWKKETSGADEHWVEARASDEAAARRWDET. 152
490 7.000e-41gi|428680194|gb|AFZ58960.1| molybdopterin synthase subunit MoaE [Anabaena cylindrica PCC 7122]  clstr ali  31  15..FGIFFAPLSLEEVYNQ--ANNPANGAVVLMSGMVRNQTDGVVALEYQAYEPMALQVFYQIAADIRCQWDVNRIVIYHRIGRLKIGEISVLVAVGCPHRGEAFAACQYAIDTLKHNAPIWKKEHWQDGSSWVSIGACEQE......... 155
491 7.000e-41gi|220905988|ref|YP_002481299.1| molybdopterin biosynthesis protein MoaE [Cyanothece sp. PCC 7425]  clstr ali  32  26..FGITLAPLSLAEVYQQ--ADDPANGAIVVMSGMVRNQTEGVVALEYQAYEPMALKIFAQIADQIQEQWPVERVVIQHRIGRLIIGEISVLIAVGSPHRAEAFAACQYAIDTLKQQAPIWKKEWFADGGRWANCC.............. 161
492 7.000e-41gi|337745453|ref|YP_004639615.1| molybdopterin converting factor-like protein [Paenibacillus mucilaginosus KNP414]  clstr ali  27  89....ITRDPISVEDVTAKVI--RPHHGAALSFVGTTREFTHGQRTLEYEGYEPMALKTMEQIGGEIEARWPGTLCAITHRLGPVPIGEISVVIAVSSPHRDASYDASRYAIERLKQIVPIWKKEIWEDGSEWK................. 217
493 8.000e-41gi|115374997|ref|ZP_01462268.1| molybdopterin (MPT) converting factor, subunit 2 [Stigmatella aurantiaca DW4/3-1]  clstr ali  35  85.LFAVVDRALRLEEVVAAV--SGEAYGGLVTFSGSVRNQTRGVLRLEYEAYPPMAEKRLAAIGAEAAERFGGTRLAIMHRVGTLEPGELAVVIAAAAPHRKEAFLACEHAIERLKQDVPIWKKEFFEDGEVWV................. 216
494 8.000e-41gi|333892759|ref|YP_004466634.1| putative molybdenum cofactor biosynthesisprotein E [Alteromonas sp. SN2]  clstr ali  40  1MFALIGDADFDQQWLYNRLRKAKGNVGAIVTFTGLVRDNDGNILGIELEHYPGMTEQALTNLVQEAITRFSLTSAGAVHRVGRLYNDEQIVWVGTAAPHRAAAFEGANFLMDMLKQSVPLWKKEFTRDDSRWVDVKSSDDKAALAWLRE. 156
495 8.000e-41gi|254514278|ref|ZP_05126339.1| molybdopterin converting factor, subunit 2 [gamma proteobacterium NOR5-3]  clstr ali  43  4..VAISKEPLDVSALTRDFPRSAAETGAVVTFTGFVRGE--GISALALEHYPGMTEQSILDSIHSAARRWPVQSVQVVHRVGELAAGEPIVWLAVGAGHRAAAFSACEFVMDYLKISAPLWKRERDLEGWHWVDAKIADRDRARRWGGGA 150
496 8.000e-41JCVI_PEP_1096693524447 /source_dna_id=JCVI_ORF_1096693524446 /offset=0 /translation_table=11 /length=149 /full_length=149  ali  31  1MDINITKDDFDLTEEIEIFNQNSSDHGAVSIFLGKVRPE-KNLESMQIDCYPEMAQKEIKNIAKIAYSKWSLDNIRIIHRYGSLKPKDNIVLVVTGSSHRSDCMSANEFIMDFLKSSAPFWKKEIYSDKEVWVKQKESDLKK........ 141
497 8.000e-41gi|57642050|ref|YP_184528.1| molybdopterin converting factor subunit 2 [Thermococcus kodakarensis KOD1]  clstr ali  37  1MKVRLTKDKFSVDEAISLLRV--PESGAYVVFLGQVRNENRKVEKLIYEAYPEMAEAEMERIREEALKKFPILDMVIWHRYGELDVGEDTILIVASAKHRKEAFRACEWAIDEVKRRVPVWKKEVTPEGAFWLEG............... 135
498 8.000e-41gi|186684204|ref|YP_001867400.1| molybdopterin biosynthesis protein MoaE [Nostoc punctiforme PCC 73102]  clstr ali  32  17..FTISFAPLSLEEIYT--KSDDPANGALVLMSGMVRNQTDGVVALEYQAYEPMALQIFYQIAADIRSTSDVNRVAIHHRIGRLQVGEISVLVAVGCPHRSEAFEACQYAIDTLKHNAPIWKKEHWEDGSRWVSIGACEQLA........ 158
499 8.000e-41gi|253577646|ref|ZP_04854955.1| molybdopterin converting factor [Paenibacillus sp. oral taxon 786 str. D14]  clstr ali  31  102....ITEEPLSVEEITAKVI--TPDHGAVLTFTGTTREWTQGQRHLEYEAYVPMALAKLRQIGAEITERWPGTRCAISHRIGRVDIAEISVVIAVSAPHRAGCYEASRYAIERLKQIVPIWKKEIWEDGSEWK................. 230
500 9.000e-41JCVI_PEP_1096666535807 /source_dna_id=JCVI_ORF_1096666535806 /offset=0 /translation_table=11 /length=159 /full_length=159  ali  28  11VKIIIQKKSFNVDQEIKFLLKN--NTGAIVNFLGTVRANNKNILSMTLEHYPIMTENEILKIAEKALKKWDINYISVIHRIGKLFPKDKIVYVGVSSKHRQNAFNACNFIMDYLKTNATFWKIEEFENENKWVIQDKKEIKALEKW.... 157
501 9.000e-41JCVI_PEP_1096683334013 /source_dna_id=JCVI_ORF_1096683334012 /offset=0 /translation_table=11 /length=172 /full_length=172  ali  31  26..IKIQEDDFDPGLIYNLVGKDRKDIGAKVAFTGLVKDFFDEVTNLYIEHYPSMAKTQLKNICQSALERWQIKEIHLVHRFGLLKPGDNIVNLVLASHNRSDVFQGGTFIMDYLKSDAPFWKKEFNRKGSAWVNQSLDDIQKMDSW.... 171
502 9.000e-41gi|307150745|ref|YP_003886129.1| molybdopterin biosynthesis MoaE protein [Cyanothece sp. PCC 7822]  clstr ali  32  21...KISFAPLSVDEVYRL--ADDAANGAIVMMSGTVRNQTDGVIYLEYQAYEPMAREIFRAIAAQIRQRWPVNRVVIHHRIGKLEIGEISVLVAVGCPHRGEAFEACRYAIDTLKHNAPIWKKEFWRDGSQWVSACEVD........... 160
503 1.000e-40gi|334140063|ref|YP_004533263.1| molybdopterin synthase subunit MoaE [Novosphingobium sp. PP1Y]  clstr ali  44  31..VRLLTSPFAPAKEIAAFAGSHPESGGVVSFIGQVRE-GDGVEALELQHYEPLTLPAMEKLAVSVHRRWDLDGVLIVHRSGVMVPGEPIVLVGAAARHRRDAFAAADYAMDHLKSESWFWKREKRGGEWHWIEPREQDFDDIARWG... 174
504 1.000e-40gi|308070033|ref|YP_003871638.1| molybdopterin converting factor subunit 2 [Paenibacillus polymyxa E681]  clstr ali  30  90.LFAITYDPIDADEVTSKVL--DPSHGASLTFNGTTREFTQGQRTLEYEAYVPMAMNTMKQIGDEIAERWPSTRTAITHRLGTVRIGETSVVIAVSAAHRDTCYEASRHAIERLKQIVPIWKKEVWEDGSEWK................. 221
505 1.000e-40gi|282898865|ref|ZP_06306852.1| Molybdopterin biosynthesis MoaE [Cylindrospermopsis raciborskii CS-505]  clstr ali  34  17..FAITIAPLLPEEIYTA--AQDLANGAVVLMSGVVRNQTDGVVALEYQAYEPMALQVFYQIATHIRNQWNVNRVVIHHRIGKLRVGEISVLVAVGSPHRGEAFAACQYAIDTLKHQAPIWKKEYWHDGSSWVLNCS............. 153
506 1.000e-40gi|225872597|ref|YP_002754052.1| molybdopterin converting factor subunit 2 [Acidobacterium capsulatum ATCC 51196]  clstr ali  35  77..VWLTRDLIDANAVLARVR--HPEDGAVASFDGIVRNQTRGRQTLVYEAYEEMALEQMRQLAGEAKQRFAIHDVVMVHRLGRLEIGESSVLIGVCSAHRAAAFDACRWLINTLKKTVPIWKKEHFVDGAVWADG............... 209
507 1.000e-40gi|427719127|ref|YP_007067121.1| molybdopterin synthase subunit MoaE [Calothrix sp. PCC 7507]  clstr ali  33  25..FAITLAPLSFEEIYA--KADDAANGAVVIMSGMVRNQTDGVVALEYQAYEPMALRVFWQIAADIRSLWPVNRVAIYHRIGRLQVGAISVVVAVGCPHRSEAFEACRYAIDTLKHNAPIWKKEHWQDGSSWVNIGACEQS......... 165
508 1.000e-40gi|172035622|ref|YP_001802123.1| molybdopterin (MPT) converting factor subunit 2 [Cyanothece sp. ATCC 51142]  clstr ali  30  25..FKISFAPLSLEEVYGL--ADDPSNGAIALMSGTVRQQTEGVKYLEYQAYEPMALVIFQEIAATIRQQWPETRVVIHHRIGKLEIGEISVLIAVGCPHRAEAFAACRYGIDTLKHNAPIWKKEFWADGSTWVSIGACEEA......... 165
509 1.000e-40gi|402770855|ref|YP_006590392.1| molybdopterin biosynthesis MoaE protein [Methylocystis sp. SC2]  clstr ali  44  9..VRVQAEDFDLGREQALLTRGRRDIGALVSFLGLCRDEDGALEALELEHYPGMAEAEIRRVADEALDRWPLQGLTVIHRFGRIRPGEQIVLVLXXXXXXXXXXXXXXXLMDFLKTRAPFWKKERRADGADWVSAKSEDEAAAERW.... 154
510 1.000e-40gi|428772378|ref|YP_007164166.1| molybdopterin synthase subunit MoaE [Cyanobacterium stanieri PCC 7202]  clstr ali  30  16...KISFAPLCVEEVYQL--ADSPENGAVVVMSGTVRNQTEGVKYLEYQAYEPMAINIFRLICDRIYDQWQDTKIVIHHRIGKLAIGDISVLVAVGCPHRGEAFEACRYAIDTLKHNAPIWKKEHFADGTSWVSIGACEEFAHKQ..... 159
511 1.000e-40gi|134045401|ref|YP_001096887.1| molybdopterin synthase subunit MoaE [Methanococcus maripaludis C5]  clstr ali  31  1.MIRVSNEDFNVDVETKALLKEHPEIGGLVNFVGVVRNYDKGVEKIEFECYEQMASKKLEELKNRAIEKFNIINATLIHRIGTLNVGENIVLIVVGAKHRKEAFLACEYLIDSLKEEVPIWKKEFSKDGSYWVEQH.............. 141
512 1.000e-40gi|299537476|ref|ZP_07050770.1| molybdopterin-converting factor subunit 2 [Lysinibacillus fusiformis ZC1]  clstr ali  31  5.LFEIIDQPIDVEEVRQKVLSR--NAGAITLFIGTVREMTNGKKHLEYQAYPAMAIKMFEQIAKEIQEEWPEAKVAITHRVGHLAISDIAVVIAVSSPHRKIAYMANEYAIDRIKQIVPIWKKEHWEDGTEWI................. 136
513 1.000e-40gi|224826741|ref|ZP_03699841.1| molybdopterin biosynthesis MoaE protein [Pseudogulbenkiania ferrooxidans 2002]  clstr ali  42  6..IRVDAATFDAGQEIARLSA-DPGVGAVVSFVGVVRRHGDGVAALELEHYPGMTEKSLAAIVAEARARWPLSAALIHHRVGRMALGEPIVLVVTASAHRAAAFAACEFLMDFLKTQAPFWKKEIDADGSRWVEAKSSDEGAAGRWQ... 152
514 1.000e-40JCVI_PEP_1096673919925 /source_dna_id=JCVI_ORF_1096673919924 /offset=0 /translation_table=11 /length=177 /full_length=177  ali  27  21VSVLITPEPLSPADAIAFVTSAQ--CGGISVFIGTTRDEGKGVQRLEYECYESMAAKHMRRLGADMRARFGVHRAALHHRTGVCPVAEASVVIAAASEHRKEALDAVAWAIDALKATVPIWKREVYTDGAVWKQNAECAFSDKARGQR.. 168
515 2.000e-40gi|86609649|ref|YP_478411.1| molybdopterin converting factor subunit 2 [Synechococcus sp. JA-2-3B`a(2-13)]  clstr ali  32  18..FQITLAPLSIDRVHQE--AYHPGNGAVVVMSGTVRDNTNGVDYLEYQAYEPMALKVFADIARQIQQRWPDNSVVIHHRIGKLRIGEISVLVAVGTPHRAEGFAACQFAIDTLKHNAPIWKKEYWRDGTSWV................. 150
516 2.000e-40gi|383457490|ref|YP_005371479.1| molybdopterin converting factor, subunits 1/2 [Corallococcus coralloides DSM 2259]  clstr ali  35  85.LFRVVGRPLQLSEVVEAV--ASEGAGGLVTFSGAVRDQTKGVLRLEYEAYAPMAEAKLTEIGDEVARTWPGTRLAIVHRVGTLVPGELAVVIAAASAHRKEAFLGCEYAIERLKQDVPIWKKEFFEDGEVWV................. 216
517 2.000e-40gi|340355833|ref|ZP_08678505.1| molybdenum cofactor biosynthesis protein large subunit [Sporosarcina newyorkensis 2681]  clstr ali  27  4..FELVDTPIDPQKYSEFVL--HPAAGAVTVFTGHVREWTHGVRTLYYEAYIPMAEKKLAEIGAEMEEKWPGVRVAMAHRIGELKISDIAVVIAVSSPHRQAAYEANEYAIERIKEVVPIWKKEIWEDGEEWIGAQKKYPEKGSR..... 146
518 2.000e-40gi|297181327|gb|ADI17518.1| molybdopterin converting factor, large subunit [uncultured bacterium HF0130_06E03]  clstr ali  37  1.MYKITNKEIQPHDLFEAVRA--PKHGAIATFAGTVRDQTEGRTHLEYEAYPAMAEKIMERIGEEAKSKWPIGKVAILHRLGRLELEEISVLIAVGAGHRREAMEACLYIIDKLKEIVPIWKKEYGSDGEYWVEG............... 134
519 2.000e-40gi|226707498|sp|B5FXU9.1|MOC2B_TAEGU RecName: Full=Molybdopterin synthase catalytic subunit; AltName: Full=Molybdenum cofactor synthesis protein 2 la  clstr ali  26  12..IKLKSEKLSVGEVSELVVS--PYCGAVSLFIGTTRNNFEGVIHLEYEAYTSMAETEMKKICRDVRQKWPVKHIAVHHRLGVVPITEASVIIAVSSPHRAESLEAVMYCINTLKASVPIWKKEIYEDEYSWKENKECFWANSEK..... 155
520 2.000e-40gi|194908945|ref|XP_001981865.1| GG12284 [Drosophila erecta]  clstr ali  27  3.HVKLVNDPIDIAHIHQLL--ADAGCGASSVFVGTTRDNFQGVVSLAYEAYDSMALKEMNKICLDLRSKWPLKHIVIYHRLGTVPVCEASVVIAASSPHRSEALESVSFAIDQLKTRVPIWKKEIYEGDSEWKENKESIRPKRSK..... 149
521 2.000e-40gi|357458805|ref|XP_003599683.1| Molybdopterin synthase catalytic subunit [Medicago truncatula]  clstr ali  27  9.LIEIVENSIDVAKYMNFVSA--PQAGAIATFSGTTRDTFDGVVELIYEAYIPMAIRCIKSVCSSARESWNLHSIAVAHRLGTVPVGGTSVFIAVSSVHRADALEACRYLIDEIKATVPIWKKEVYSNGEVWKENTEFLERRSELGKKD. 158
522 2.000e-40NEWGM LOTGI jgi|Lotgi1|189273|estExt_Genewise1.C_sca_280271|Lottia gigantea |JGI  ali  25  3.HIDIIEGKIDVNSTIDLVIS--PSCGAVSTFLGTTRDNFDGVVRLEYEAYIPMAKKKMLEICQLVREKWKVENIVMIHRIGLVPIKEASIIIAISSPHRKESLDALQFAIDTLKAIVPIWKKEVYEDESSWKENKE............. 139
523 2.000e-40gi|119510617|ref|ZP_01629747.1| Molybdopterin biosynthesis MoaE [Nodularia spumigena CCY9414]  clstr ali  34  17..FAITFAPLSLEEIYT--KANDAANGAVVVMSGMVRNQTNGVIALEYQAYEPMALRVFYQIAADIRSTWDVKRVVIYHRVGRLQVGEISVLVAVGCPHRSEAFEACRYAIDTLKHNAPIWKKEHWADGSSWVSIAACEH.......... 156
524 2.000e-40gi|335041100|ref|ZP_08534217.1| molybdopterin biosynthesis MoaE protein [Caldalkalibacillus thermarum TA2.A1]  clstr ali  29  9.HFKVVPEPISIEEVVAKVI--HPHAGAINTFIGTVREITKGRKTLEYEAYVSMAEKQLFKIGQEIAERWPEARVAISHRIGRLEISDIAVVIAVSTPHRADAYEASRYAIERIKEIVPIWKKEFWEDGEAWI................. 140