current user: public

Query: ACL93483.1, from C.crescentus

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
21 4.000e-55gi|424070924|ref|ZP_17808352.1| molybdenum co factor biosynthesis protein E [Pseudomonas syringae pv. avellanae str. ISPaVe037]  clstr ali  45  2MSVRVQAAAFDPGTEVNALHAANLGIGAVVSFVGYVRDFNEGVSGMFLEHYPGMTEKALAKIIAEAEQRWPLLRVDVLHRVGALEPGEPIVFVGVASAHRQAAFEACDFVMDYLKTRAPFWKRENTSEGTHWVEGRHSDHQAADRWK... 150
24 9.000e-55gi|330811541|ref|YP_004356003.1| molybdopterin converting factor subunit 2 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]  clstr ali  44  1MAIRVQVEPFDAGGEVNAMHAANVGVGAVVSFVGYVRDFNDGVSGMFLEHYPGMTEKALGKIATEAEQRWPLLKLEVLHRIGALEPGEPIVFVGAASAHRQAAFDACAFVMDYLKTRAPFWKKENTVDGPRWVEGRDSDHAAADRWKQ.. 150
37 3.000e-54gi|145588629|ref|YP_001155226.1| molybdopterin biosynthesis protein MoaE [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1]  clstr ali  39  6..IRIQEQDFDLSAEIVALRKGDARVGAVVSFLGTVRDLSDGVKGMTLEHYPGMTEKSLQAILDQAATRWNIFQTLVIHRVGLLLPEDQIVLVAVTSAHRGEAFSACEFIMDYLKTAAPFWKKEDTPEGSRWVDARVTDETAMARWNK.. 153
45 7.000e-54gi|329910933|ref|ZP_08275413.1| Molybdenum cofactor biosynthesis protein E; Molybdopterin converting factor subunit 2 [Oxalobacteraceae bacterium IMC  clstr ali  40  1MTIRIQQADFDMSTELANLRAGSPQVGAIVSFVGTVRDLNDGVSQMELEHYPGMTEKSIAVIVERARAHWPIADALVIHRIGPLLPTEQIVLVAVAAAHRGEAFAACEFIMDYLKTEAPFWKKEQTPEGARWVDARAVDDAALAKW.... 148
64 3.000e-53gi|260219647|emb|CBA26492.1| Molybdopterin-converting factor subunit 2 [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  40  10.RVRIQTEAFDLGLEISQLQAADPRVGAVCSFVGTVRDRNGSVQTLELEHYPGMTEKSIEAMVDAAFARFDIYGARVVHRVGVLQPTEGVVLVAVTSAHRGQSFQACEFIMDYLKTQAPFWKKETTPEGAHWVDARVSDDEALARWGITA 163
76 8.000e-53gi|422022154|ref|ZP_16368662.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Providencia sneebia DSM 19967]  clstr ali  43  5.HIAVQTNNFDVGEQYQWL-AQCDSDGAVVTFTGKVRNHNDSVAALTLEHYPGMTEKALENIIEEARRRWALQRVSVIHRVGTLQPGDEIVFVGVTSAHRGAAFEAAEFIMDYLKTKAPFWKKETLPDNERWVEAKESDEKSANRWS... 151
87 2.000e-52gi|157369567|ref|YP_001477556.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Serratia proteamaculans 568]  clstr ali  42  6.RIRVGEAPFNVGEEYQWLAQCDDD-GAVVTFTGKVRNHNDNVSALTLEHYPGMTEKALAEIVDEARSRWPLQRATVIHRVGELFPGDEIVFVGVTSAHRSMAFEASEFIMDYLKTRAPFWKREAVGQGDRWVDARDSDRQAAERWHK.. 153
145 1.000e-50gi|149926844|ref|ZP_01915103.1| probable molybdopterin mpt converting factor (subunit 2) protein [Limnobacter sp. MED105]  clstr ali  42  5.KVLVQEADFDVTEEIRWLRQGLPEIGAVATFIGTVRDINENVSAMTLEHYPGMTEKALENILQVADARFDITSAMIIHRVGPLYPEDQIVFAAATSEHRQQAFLACEFMMDYLKTEAPFWKKEDTPEGSRWVSARDSDDSAKERWEQ.. 153
180 1.000e-49gi|227113007|ref|ZP_03826663.1| molybdopterin synthase large subunit [Pectobacterium carotovorum subsp. brasiliensis PBR1692]  clstr ali  44  5.RIRVGEENFNVGDEYQWLAQCDED-GAVVTFTGKVRNHNKDVSALTLEHYPGMTEKALAEIVELARERWELPRVSVIHRVGALYPGDEIVFVGVSAAHRSAAFDAAQFIMDYLKTRAPFWKREATPEGERWVESRDSDKQAAQRW.... 150
183 2.000e-49gi|188534382|ref|YP_001908179.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Erwinia tasmaniensis Et1/99]  clstr ali  41  4.RIRVGDAPFSMGDEHRWLSASDLD-GAVVTFTGKVRNHNDDVNALTLEHYPGMTEKALAAIVAEARQRWAMQRVTIIHRIGELFPGDDIVLVGVSAVHRGAAFDAAEFIMDQLKTRAPFWKREATADGQRWVAARESDRHAAARWK... 150
199 3.000e-49gi|238920525|ref|YP_002934040.1| molybdopterin converting factor, subunit 2, putative [Edwardsiella ictaluri 93-146]  clstr ali  42  6..IVVSAAPFSVAEQYQWLAQRDED-GAVVTFSGKVRNHNDDVSALTLEHYPGMTEKALAEIVALARRRWPLGRIAVYHRVGPMFPGEEIVFVGVTSAHRGMAFEAAEFIMDYLKTRAPFWKRETSEGADRWVDARDSDRQAAERW.... 150
200 4.000e-49gi|332290526|ref|YP_004421378.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Gallibacterium anatis UMN179]  clstr ali  38  4IEISVQTEPFDQNAIYQ-WSSASAESGATVIFVGKVRDMNDNVSGLYLEHYPAMTEKALREIAEQAAQRWQLQRIYIVHRVGQLYTGDEIVAVAVSSAHRGSAYQANEFIMDFLKTKAPFWKKETTKSGDRWLDSRESDQQAAHRWE... 151
204 9.000e-49gi|145299688|ref|YP_001142529.1| molybdopterin converting factor, subunit 2 [Aeromonas salmonicida subsp. salmonicida A449]  clstr ali  39  11.RILVQREDFSLADEYASLATRADS-GAIVTFVGKVRDFNQGVKGLALEHYPGMTEKALADIVQEARRRWPLQECTLIHRIGELWLGDQIVLVAVSSAHRDAAFDACHFIMDFLKTRAPFWKKELTAEGQRWVEALDRDNAAAARWK... 158
205 9.000e-49gi|386390434|ref|ZP_10075223.1| molybdopterin converting factor, subunit 2 [Haemophilus paraphrohaemolyticus HK411]  clstr ali  35  5.LVKVQTEPFDQNEVYHWLSEHH-SVGATTIFVGKVREMNDDVSGLYLEHYPAMTEKSLHEIVEEARSRWELQRIAVIHRIGQLYTGDEIVLVGVSSAHRGNAYAANEFIMDYLKTKAPFWKRETTNHGERWIEGRDSDQQAAVKW.... 150
210 2.000e-48gi|297183999|gb|ADI20119.1| molybdopterin converting factor, large subunit [uncultured alpha proteobacterium EB080_L06A09]  clstr ali  45  1MAVLIQEEDFNLSDELKLLKAGKGDAGAIISFIGSVRG-DKSLRALELEHYPNMTLSSLEEIQDKAISRWKLIDVRIIHRFGYLSLGEQIMMVAVASQHRREAFEAADYIMDFLKSRAPFWKKEHSDTGSTWVDANPEDEKSLARW.... 145
214 2.000e-48gi|163759151|ref|ZP_02166237.1| probable molybdopterin mpt converting factor, subunit 2 protein [Hoeflea phototrophica DFL-43]  clstr ali  45  20VTVRIQAEDFDIASEIAALAEGRADIGAVATFTGLCRDEGGRLSSLELEHYPGMAERAIRTIANEAAKRFALTGITAIHRYGKIAPGCNIVLVVATAPHRQAAFDGASFLMDYLKTEAPFWKKEHRKGGGEWVSAKDSDDRAKARWDK.. 169
231 5.000e-48gi|257094823|ref|YP_003168464.1| molybdopterin biosynthesis MoaE protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]  clstr ali  43  1MVVRVQEADFDVGAELAALRGKDPQIGALASFVGLVRELNDGVSELTLEHYPGMTERALQAIVSEACRRWAIIDALVIHRVGRLLPTDQIVLVAVAGAHRGDAFAACQFIMDYLKTRAPFWKRELTPEGARWVAAHAADDEAAERWQ... 149
235 7.000e-48gi|197284510|ref|YP_002150382.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Proteus mirabilis HI4320]  clstr ali  39  6.RISVQNEHFNVGDEYQWL-SECESDGAVVTFTGKVRNHNDEVNTLTLEHYPGMTEKALNDIVEQARARWPLQRVSVIHRVGQLNIGEEIVFVGVTSAHRHSAFESAEFIMDFLKTRAPFWKKEGLANQDRWVDARQSDYDSAKRWE... 153
238 9.000e-48gi|357385199|ref|YP_004899923.1| molybdenum cofactor biosynthesis protein MoaE, molybdopterin converting factor subunit 2 [Pelagibacterium halotolera  clstr ali  43  1MSVTLQSEPFDPGTLFNAFLETHHDAGAAVTFTGLVRSTNDPVISMTLEHYPALAQRQLEDLRASAMTRFALRDAEIIHRFGKLYPGEPIVQVMTLAPHRQAAFDGANFIMDILKTTAPFWKKEEGPDGAKWVEAKEGDDKATARWS... 148
241 1.000e-47gi|254785164|ref|YP_003072592.1| molybdopterin converting factor, subunit 2 [Teredinibacter turnerae T7901]  clstr ali  36  1.MIRVQQADFDVAGEYRNL-QQHGLAGAIVTFSGLVRDFAGDTERFFLQHYPGMTESVLNKIVSQAQSRWPLLAVTVIHRVGHLQAGDQIVFVGVSSAHRKSAFAACEYIIDLLKTEAPFWKKE----GRQWVDAKQSDQAAADRW.... 141
262 6.000e-47gi|339053212|ref|ZP_08647968.1| Molybdenum cofactor biosynthesis protein MoaE Molybdopterin converting factor subunit 2 [gamma proteobacterium IMCC20  clstr ali  40  1MAVTVQTEDFDVPALYQALKADAPQIGAIVTFTGLVREFNEEVEALHLEHYPGMTEQVLEGLIDEATKRWPIINAVIVHRVGELRPADQIVFVGVNSAHRDAAFAAAEYLMDILKTKAPFWKREQRPDGDKWLDAKVSDDERATRWH... 149
265 7.000e-47gi|237808511|ref|YP_002892951.1| molybdopterin biosynthesis MoaE protein [Tolumonas auensis DSM 9187]  clstr ali  34  4.KILVQQEDFDVAAEYARL-SDNPETGAIVSFIGKVRNFNQDVTGLHLEHYPAMTQLSLEKLVAEAHARWPIQSCTLIHRVGDLTINDQIVLILVASVHRKAAFAACEFLIDELKTSAPFWKKERLTDGSRWVSP............... 139
274 1.000e-46gi|417356630|ref|ZP_12132132.1| Molybdenum cofactor biosynthesis protein MoaE [Salmonella enterica subsp. enterica serovar Give str. S5-487]  clstr ali  45  5.RIVVGPAPFSVGEEYSWLAARDED-GAVVTFTGKVRNHNDSVKALTLEHYPGMTEKALAEIVAKARSRWPLGRVTVIHRVGELWPGDEIVFVGVTSAHRSSAFDAGQFIMDYLKTRAPFWKREATPEGARWVEARDSDQQSAKRW.... 164
287 3.000e-46gi|359408769|ref|ZP_09201237.1| molybdopterin converting factor, large subunit [SAR116 cluster alpha proteobacterium HIMB100]  clstr ali  42  4..ITITTDNFNAGDEIEALRLA--GVGAIVTFTGIVRDEHPDLTAMTLEHFPGMTEQEIQAIIDEARTRWPLQGVRVIHRVGRLLPQENIVFVGTASAHRQAAFDSASFIMDYLKTKAPFWKKEETPAGASWVEARDCDDKALEKWQ... 148
319 3.000e-45gi|292490652|ref|YP_003526091.1| molybdopterin biosynthesis MoaE protein [Nitrosococcus halophilus Nc4]  clstr ali  39  1MTVHIINAPFDPWQEVAAYLKRAGRFGATACFIGTMRDFNEGVQAMELEHYPGMTEKYLGKLTEEARRQWPILDSLIIHRYGHLQPNEPIVLVVVWSAHRAAAFKACYYLVEELKANAPFWKKETLATGTRWVESNTS............ 144
327 5.000e-45gi|331006450|ref|ZP_08329753.1| molybdenum cofactor biosynthesis protein E [gamma proteobacterium IMCC1989]  clstr ali  35  1...........MGDEHTALQQDAPSIGAIVTFTGLVREFTKGDTQLFLEHYPAMTEKVLNNIVKQATQRWGIISTRIIHRIGHLSLGEQIVFIGVNSPHRADAFAAATFIMDFLKTDAPFWKKEITPKGEAWVDAKDSDASARKHW.... 136
330 9.000e-45gi|260772443|ref|ZP_05881359.1| molybdenum cofactor biosynthesis protein E [Vibrio metschnikovii CIP 69.14]  clstr ali  44  6.................AVLAQDSAAGAVVTFVGKVRDLNDDVIGLRLEHYPGMTEKALSHLCDQAQQRWPLQQVRIIHRVGDLDVGAQIVFVGVASAHRGASFAACEFIMDSLKTQAPFWKKERTTHSERWIESRESDHQAAKRW.... 136
331 1.000e-44gi|428210351|ref|YP_007094704.1| molybdopterin synthase subunit MoaE [Chroococcidiopsis thermalis PCC 7203]  clstr ali  31  23..FAITFAPLSLDAFYAL--ADDPGNGAIVVMSGMVRNQTDGVVSLEYQAYEPMAMQIFKQIAAEIRQQWDVNRVAIHHRIGKLKIGEISVLVGVGCPHRSEAFEACRYAIDTLKHNAPIWKKEHWQDGSSWVSIGACETQ......... 163
332 1.000e-44gi|347820795|ref|ZP_08874229.1| molybdopterin biosynthesis MoaE [Verminephrobacter aporrectodeae subsp. tuberculatae At4]  clstr ali  39  5.RVSIQTEDFDLSTEIAALRRANPGVGAVCGFVGTVRGQDTGVESMTLEHYPGMTEKSIEAMLDAALQRFDILGARVIHRVGRLLPCEQIVLVAVASAHREQSFRACEFLMDYLKTQAPFWKKEQTP....................... 132
341 2.000e-44gi|350571411|ref|ZP_08939738.1| molybdenum cofactor biosynthesis protein large subunit [Neisseria wadsworthii 9715]  clstr ali  39  5..VRVQEADFNLQNEYDALLKDAENTGAVAAFVGRVRDRDTDTPHLFLEHYPEVTEHEIERIAHEAETRWPLTACTVIHRVGLLEADDQIVLVLTASEHRKAAFSAAEFLMDYLKTQAPFWKQERFSDGEHWVEAKQSDAEAADKW.... 151
347 3.000e-44gi|392957988|ref|ZP_10323507.1| molybdopterin converting factor subunit 2 [Bacillus macauensis ZFHKF-1]  clstr ali  30  4..FAITTLPLNVEALISYV--SSPQAGAINTFIGTVRELTGEKKTLKYEAYVPMAEKQLKKIGTEVQEKWPGTRIAIHHRIGSLAISDIAVVIAVSTPHRAASFEACRYAIERIKEIVPIWKKEHWEDGTFWVGN............... 136
350 4.000e-44gi|428270712|gb|AFZ36653.1| molybdopterin biosynthesis MoaE protein [Stanieria cyanosphaera PCC 7437]  clstr ali  33  20..FAITFAPLSLEEVYRL--ADDPANGAVVVMSGTVRNQTGGVLSLEYQAYEPMAIAVFRSIAAQIRQQWQDTRIVIHHRVGHLEIGDLSVLVAVGCPHRSEAFEACRYAIDTLKHNAPIWKKEYFADGTQWVNCC.............. 159
352 4.000e-44gi|163850936|ref|YP_001638979.1| molybdopterin biosynthesis MoaE protein [Methylobacterium extorquens PA1]  clstr ali  45  4MTVSIQSEPFDTAAEIARIEAEAGRAGAVVTFSGLCRDEAGRLAALELEHYPGMAEAEIARVVEEARARWPVQALRVIHRHGLVRPGEGIVLVITASPHRKAAFAAADFLMDYLKTRAPFWKREHLADGTTWV................. 139
370 2.000e-43gi|124005081|ref|ZP_01689923.1| molybdopterin converting factor, subunit 2 [Microscilla marina ATCC 23134]  clstr ali  33  1MEFKITDQPINEQEVIDLVRS--PHCGGLSVFVGTVRNQTKGVISLEFEAYEAMAMNKMREIAEQAQKRWKTDKIAIYHRVGKLSVEETAVVIAVSTPHRKESFQACEYLIDTLKQVVPIWKKEIYEDGEIWVAAH.............. 136
371 2.000e-43gi|334116878|ref|ZP_08490970.1| molybdopterin biosynthesis MoaE protein [Microcoleus vaginatus FGP-2]  clstr ali  32  21..FAITLAPLSVEEIYALV--DDPANGAVVMMSGTVRNQTDGVVSLEYQAYEPMAVRVFQQIATEIRRQWGVNRVAIHHRVGHLQVGEISVLVAVGCPHRGEAFAACQYAIDTLKHNVPIWKKEHWADGSSWVSIGACE........... 159
374 2.000e-43gi|374852092|dbj|BAL55033.1| molybdopterin synthase subunit MoaD / molybdopterin synthase subunit MoaE [uncultured Acidobacteria bacterium]  clstr ali  38  87.IFALVREPIEARALVQRLLRG--AAGAVVTFDGVVREQTGGVRYLEYEAYEAMALRMLREIGREIRARWPIDRIGIVHRLGRLEIGESSVIIVVTSAHRRPAFEACQYAIDRLKKIVPIWKREYFEDGSVWVDG............... 220
375 2.000e-43gi|56962671|ref|YP_174397.1| molybdopterin converting factor subunit 2 MoaE [Bacillus clausii KSM-K16]  clstr ali  33  1.MFQLTNKPIDVQQVINQVT--DRNCGAIATFIGTVREFTNGKKRLEYIAYESMAEKMLKRIGAEINERWPGTNVAIVHRLGVLDISEAAVVIAVSSPHRQAAYEANAYAMERIKAMVPIWKKEIWEDGSSWI................. 132
377 2.000e-43gi|239826836|ref|YP_002949460.1| molybdopterin biosynthesis MoaE protein [Geobacillus sp. WCH70]  clstr ali  31  5.LFMITDKPISIENVVKKVM--RPEAGAVTTFMGTVREWTNGKRTLFYEAYVSMAEKMLEQIGAEIREKWPETKVAITHRIGRLDIGDIAVAIAVSSPHRNDAYEANRYAIERIKQIVPIWKKEHWEDGTEWVGN............... 138
379 2.000e-43gi|428308618|ref|YP_007119595.1| molybdopterin converting factor, large subunit [Microcoleus sp. PCC 7113]  clstr ali  34  15..FSITFAPLSLAEIYAL--ADDPANGAVVVMSGTVRNQTDGVVALEYQAYEPMAVRVFEAIADDIRNRWDVNRVVIHHRTGRLQIGEISVIVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEHWADGSSWVSIGACEQ.......... 154
380 2.000e-43gi|156742874|ref|YP_001433003.1| molybdopterin converting factor subunit 1 [Roseiflexus castenholzii DSM 13941]  clstr ali  39  90..FVVTPDPLDPAPLVALVQA--PDMGAIVTFAGVARDNFGGRKTLEYEAYPGMAEAVLAQIAAEARARWQTGAIAVHHRIGRLEIGETAVLVVVAAPHRREAFAAAEWIMDRIKEVAPIWKKEHWADGAEWVDEKERKQKAPQR..... 234
381 3.000e-43gi|296534418|ref|ZP_06896863.1| molybdenum cofactor biosynthesis protein large subunit [Roseomonas cervicalis ATCC 49957]  clstr ali  43  3.RILVQEAPFDTAAEMAALSAGRTDVGGVASFVGICRA-DDGLRALVLEHYPGMTEKALSGIAGEAERRWPLTGCTVIHRVGRILPGEPIVLVLAASAHRAAALEACAFLIDWLKTGAPFWKREEMADGERWVEAKESDDAAAEKWK... 148
387 4.000e-43gi|150396003|ref|YP_001326470.1| molybdopterin biosynthesis protein MoaE [Sinorhizobium medicae WSM419]  clstr ali  46  6VNIRVQRDDFDIAVEIAALCRDRTDIGAVVTFSGLCRDEAGALSALELEHYPGMAEAEIERICQDAVERFGLQAATAIHRFGGMEPGANIVLVIAAAPHRQAAFDGANFIMDFLKTSAPFWKKEHRTDGSDWISAK.............. 143
390 4.000e-43JCVI_PEP_1096678044877 /source_dna_id=JCVI_ORF_1096678044876 /offset=0 /translation_table=11 /length=169 /full_length=169  ali  37  25MNVLVSTESLDPLNEIAEFEAQHGEVGAAVHFVGTMRDFNEGVSEMELEYYPGMTERVLEELVSQAKDEWPILECMIRHRAGSLQPGDPIVLVAVWSAHRGAAFDACRFLIEELKHRAPFWKRELTDKGSRWVA................ 163
391 4.000e-43gi|218295834|ref|ZP_03496614.1| molybdopterin converting factor, subunit 1 [Thermus aquaticus Y51MC23]  clstr ali  39  83..FGLTHEPLDLKALVDW--ATAPEYGAVVSFLGTTRSPNRGVAYLEYEAYPGMAEKVMAEIIGEMRARWPLGRVALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKQVLPVWKKEHRQDGSFWVEG............... 215
393 5.000e-43gi|339007459|ref|ZP_08640034.1| molybdopterin synthase catalytic subunit [Brevibacillus laterosporus LMG 15441]  clstr ali  29  104.RFAITEAPLSVEPLIKLV--SHRNCGAILTFIGTVREMTQGQRTLSYEAYIPMAIEKLKQVEAEIHERWENIRVAIHHRIGDLQIEEIAVVIAVSSPHRNDSFEAGRYAIERLKQIVPIWKKEIWEDGNEWK................. 235
397 6.000e-43gi|51894315|ref|YP_077006.1| molybdopterin converting factor-like protein [Symbiobacterium thermophilum IAM 14863]  clstr ali  34  84.LFAITTEPLSADEIAARVT--NPHSGATLVFVGTVREWTRGRRTLEYEAYPEMAVAQMEQIGREIAERWPGARTAIVHRVGRLEIGEASVVIAVATPHRADAFEACRHAIERLKQIVPIWKKEVWEDGEAWV................. 215
401 6.000e-43gi|242239854|ref|YP_002988035.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Dickeya dadantii Ech703]  clstr ali  42  4.RIRVGEAGFSVGDEYQWLSA-CESDGAVVTFTGKVRNHNDSVQALTLEHYPGMTEKALEEIVAEARQRWPLQRVSLIHRIGALYPGDEIVFVGVSGAHRHAAFAAAEFIMDYLKTRAPFWKQEATTTGDRWVDARDSDRQAAERW.... 149
402 6.000e-43gi|220936112|ref|YP_002515011.1| molybdopterin biosynthesis MoaE protein [Thioalkalivibrio sulfidophilus HL-EbGr7]  clstr ali  46  1MGVSLHPEPFDPWARLAAHQAQLPSFGATAVFVGTMRDFNEGVRGMTLEHYPGMTEKHLEGIVAEARSRWPLDDCLIAHRVGPIEPGEPIVLTAVWSAHRKAAFEACRYLMEELKHRAPFWKRETLKDGQRWVE................ 139
404 7.000e-43gi|373475560|ref|ZP_09566398.1| molybdopterin biosynthesis MoaE protein [Singulisphaera acidiphila DSM 18658]  clstr ali  35  1.MIEITEATIDHAALTERVRSNQ--AGAVCSFLGTVREMTGDRTSLDYEAYPEMALKKMGELEAEARQRWPILDLALVHRVGHLGLGEISVVVAVSCPHRNQAFEACRWLIDTLKEVVPIWKKEVWADGEEWVHP............... 135
408 8.000e-43gi|392964714|ref|ZP_10330134.1| Molybdopterin-converting factor subunit 2 AltName: Full=Molybdopterin synthase subunit 2 [Fibrisoma limi BUZ 3]  clstr ali  29  1.MIAITTDPIDVASALKLLQA--DEAGAIDLFLGVVRDKTQEVDHLEYEAYDRMAISEMRKIVDEANRRWKLLRCVVIHRKGTLRIGEIAVLIGVATPHRADAFDATRYVIDTIKQTVPIWKKEIFSDGEVWVNA............... 134
409 9.000e-43gi|428214069|ref|YP_007087213.1| molybdopterin converting factor, large subunit [Oscillatoria acuminata PCC 6304]  clstr ali  36  21.RFALTFAPLSLEEVYAL--ADDPGNGAVVVMSGMVRNQTDGVVALEYQAYAPMAVAVFEQIAASIRSSWPIKRVVIFHRTGRLQIGEISVLVAVGSPHRREAFEACQYAIDTLKHNAPIWKKEHWADGSSWVSIGACETQD........ 163
410 9.000e-43gi|226313778|ref|YP_002773672.1| molybdopterin converting factor MoaDE [Brevibacillus brevis NBRC 100599]  clstr ali  31  86.RFAITEEPISADKLVRLV--SNPHAGAILTFVGTVREFTHGQRTLSYEAYAPMAVEKMKQVAAEIEERWPGAQVAMHHRIGHLTVEEIAVVCAVATAHRNESFEAGRYAIERLKQIVPIWKKEMWEDGSEWK................. 217
412 1.000e-42gi|384070153|emb|CCH03363.1| Molybdopterin-converting factor subunit 2 Molybdopterin synthase subunit 2 [Fibrella aestuarina BUZ 2]  clstr ali  31  1.MIALTADPIDFSSAYHYL--QTDEAGAIDFFFGVVRNNTRDVQQLDYEAYGPMAVREMQKIADEACRRWNVLRYVIIHRTGVLRIGEMAVLIGVATPHRDAAFEATRYIIDTIKQTVPIWKKERFTDGEVWVNA............... 134
416 1.000e-42gi|209524230|ref|ZP_03272780.1| molybdopterin biosynthesis MoaE protein [Arthrospira maxima CS-328]  clstr ali  32  12..FAISLGQLSLEDVYNLV--DDPANGAIVVMSGMVRNQTDGVKSLEYQAYQPMALRVFQEIAEQIKTQWPVTRVVIQHRIGHLQIGDISVLVAVGCPHRREAFEACQYAIDTLKHNAPIWKKEHWVDGSSWV................. 144
423 2.000e-42gi|291294514|ref|YP_003505912.1| molybdopterin converting factor subunit 1 [Meiothermus ruber DSM 1279]  clstr ali  36  110...................WASDHPYGAVVSFLGTTRSPNKGVSYLEYEAYPGMAEKVMQQIIAEMRARWVLGRVALWHRLGRVLPGEGSILIVVSAPHRPEAFEACRYAIERVKQILPVWKKEFLPDGSHWVEGHAPEEHRL....... 235
426 2.000e-42gi|150399301|ref|YP_001323068.1| molybdopterin biosynthesis MoaE protein [Methanococcus vannielii SB]  clstr ali  30  1.MIRVSNEDFNIDIETKALLEKYPNIGGIVNFVGVVRNYDKGIEKLEFECYDKMAEKKLEELKNKAIEQFGIIDATLIHRIGKLSVGENIVLIIVCAKHRKEAFLACEYLINNLKKEVPIWKKEFSKDGSYWVEQH.............. 141
428 2.000e-42gi|341582547|ref|YP_004763039.1| molybdopterin converting factor, subunit 2 [Thermococcus sp. 4557]  clstr ali  36  1MKVRLTEEPFDLNTALRYLLV--PEAGGYVFFLGKVRSESHGVRKLVYEAYPEMAQAEMERIRNEALERFPILDMLIWHRYGELEVGQDTILIIASGRHRKEAFEACEWAIDEVKKRVPVWKREVTDEGEFWIEG............... 135
429 3.000e-42gi|269925252|ref|YP_003321875.1| molybdopterin biosynthesis MoaE protein [Thermobaculum terrenum ATCC BAA-798]  clstr ali  31  1.MIAVTQDPISIDELISSV--SHPGAGAIVIFLGVVRDNNEGVRYLEYESYEPAAKASMQKICGFAKDKWPGVRISAVHRVGKLNIGDISVAVVASAPHRQEAFAAARFVIDSIKEESPIWKKEIFEGGEVWI................. 132
431 3.000e-42gi|254414835|ref|ZP_05028599.1| molybdopterin converting factor, subunit 2 [Coleofasciculus chthonoplastes PCC 7420]  clstr ali  33  15..FAITFAPLSLADVYTL--ADDPANGAVVVMSGTVRNQTEGVVSLEYQAYEPMALRVFATIAQDIRGKWDVNRVVIHHRIGRLQIGEISVLVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEHWADGSTWVSIGACEQ.......... 154
432 3.000e-42gi|240102230|ref|YP_002958538.1| moaE molybdopterin synthase, large chain (moaE) [Thermococcus gammatolerans EJ3]  clstr ali  33  102.KVKITGEPFSVDEAIKLV--ERDEAGGYVVFLGKVRNENRGVLKLIYEAYEEMALKEMEKIRKEALEKFPILDMLIWHRVGELKVGEDTILIVASAKHRSEAFDACRWAIDEVKKRVPVWKKEVTEEGTFWIEGEQTIPEDYHK..... 245
434 5.000e-42JCVI_PEP_1096699096465 /source_dna_id=JCVI_ORF_1096699096464 /offset=0 /translation_table=11 /length=140 /full_length=140  ali  30  1IMIKIQKENFQVDYEIEKIKSLSNEIGAVTNFIGYVRNNSKKVKSIYVEVYEEMAIKSLKKICENAKNKWNLIDYLVIHRFGNLSINDKIVLVSTFSKHRKESFESCNFIMDYLKKEAPFWKKENYENESKWLKN............... 137
436 5.000e-42gi|298242643|ref|ZP_06966450.1| molybdopterin biosynthesis MoaE protein [Ktedonobacter racemifer DSM 44963]  clstr ali  38  4.IIQLTHAPLERDALVAAV--SHPSAGGIVVFEGVVRDHARGVRHLEYEAYEEMARQRIQEIIAEAEQRWGVERVAVAHRFGRLEIGEASVIIVVASPHRAEAFDACRYIIDTLKASVPIWKKEVATTGEEWVEG............... 137
437 6.000e-42gi|427737978|ref|YP_007057522.1| molybdopterin converting factor, large subunit [Rivularia sp. PCC 7116]  clstr ali  31  21..FAINFAPLSLPEVYNL--ADHPANGAIVVMSGTVRNQTDGVISLEYQAYEPMALRVFYQIADDIRKKWDTNRVVIHHRTGHLQIGEISVLVAVGCPHRSEAFDACRYAIDTLKHNAPIWKKEHNRDGSSWVSACEVDE.......... 162
438 6.000e-42gi|427730476|ref|YP_007076713.1| molybdopterin converting factor, large subunit [Nostoc sp. PCC 7524]  clstr ali  32  21..FAITFAPLSLEEIYA--KADDPGNGAIVVMSGMVRNQTDGVVSLEYQAYEPMALQVFYQIAADIRVIWDVKRVVIHHRIGRLQIGEISVLVAVGCPHRSEAFEACRYAIDTLKHNAPIWKKEHWQDGSSWVSIGACEQS......... 161
442 9.000e-42gi|338213845|ref|YP_004657900.1| molybdopterin biosynthesis protein MoaE [Runella slithyformis DSM 19594]  clstr ali  33  2IDIQLLETTLSTQTCFDYVLS--DEAGGIVTFVGTVRHQTKGVLRLEFEAYAPMAIREMQKIAEEAMRRWPVLKISIHHRVGVLDIGEIPVIIAVACAHRNTAFEACQFAIDTLKETVPIWKKEFFEDGEVWVAAH.............. 137
443 9.000e-42gi|138894336|ref|YP_001124789.1| molybdopterin converting factor subunit 2 [Geobacillus thermodenitrificans NG80-2]  clstr ali  30  5.LFSITSEPISVEAVMKKVM--RPEAGAVAVFAGTVREWTNGKRTLFYEAYVSMAEKMLAQIGAEIAEKWPGTKTAITHRIGRLEIGDIAVVIAVSSPHRAEAYEANRYAIERIKQIVPIWKKEQWEDGSAWI................. 136
446 1.000e-41gi|422303289|ref|ZP_16390643.1| Molybdopterin synthase catalytic subunit [Microcystis aeruginosa PCC 9806]  clstr ali  29  6..FRVSFAPLSLQEVYQL--ADDGANGAIVLMSGTVREQTDGVIYLDYQAYEPMAIEVFRQIAGQIRQTWPDTRVVIHHRTGKLQIGEISVLVAVGCPHRGEAFAACRYAIDTLKHNAPIWKKEYWSDGSQWVSIGACELE......... 146
447 1.000e-41gi|336114691|ref|YP_004569458.1| molybdopterin biosynthesis protein MoaE [Bacillus coagulans 2-6]  clstr ali  29  1.MFEIVKEPVDVSKLIQAV--ADRNAGAIVTFIGTVREMTKGKKTLEYEAYEPMARKKLEQIGTEIRQQFPEAKTAIVHRTGRLGISDIAVAIAVSAPHRDEAYRANRYAIERIKEMVPIWKKEHWENGEMWVGN............... 134
448 1.000e-41gi|406832618|ref|ZP_11092212.1| molybdopterin biosynthesis MoaE protein [Schlesneria paludicola DSM 18645]  clstr ali  36  1.MISLTHSPIDYHALTESVRS--PQSGAVVLFLGTVREMTGQRRALNYEAYPTMAERKLGELETAARARWPIDQVGIVHRLGHLELGEISVAVAVSCPHRKQAFEAGQFLIDELKVSVPIWKQENWDDGSEWVDP............... 135
452 2.000e-41gi|407978860|ref|ZP_11159686.1| molybdopterin converting factor large subunit [Bacillus sp. HYC-10]  clstr ali  30  5.LFNITKKPIDVNELIQHVT--RRKAGAITTFIGTVREWTNGKKRLTYEAYIPMAESMLRQIGQEIKKRWPDTEAAIVHRIGTLDISDIAVAIAVSSPHRKAAYEANEYAIERIKEIVPIWKKEYWEDGEAWI................. 136
453 2.000e-41gi|427724559|ref|YP_007071836.1| molybdopterin synthase subunit MoaE [Leptolyngbya sp. PCC 7376]  clstr ali  30  12..FVITIAPLSFDEMYR--RSEDPASGAVVVMSGTVRNKTDGVKYLEYQAYEPMAKVVFQQIARQIRSQWPVNRVVIHHRVGKLVIGEISVLIAVSTPHRAEAFAACKFGIDTLKHNAPIWKKEFFSDGSEWVQGC.............. 147
455 2.000e-41gi|241203965|ref|YP_002975061.1| molybdopterin biosynthesis protein MoaE [Rhizobium leguminosarum bv. trifolii WSM1325]  clstr ali  43  17..IRVQHEDFDLQAEVDLLSKGKPGIGAVVTFSGLCRDEGGTLAALELEHYPGMAEAEIRRIGDLAIQRFGLLGLTAIHRYGKIATSENIVLVVAAAPHRQAAFDGANFVMDFLKTAAPFWKKEHVRDGATWV................. 149
456 2.000e-41gi|297182926|gb|ADI19075.1| molybdopterin converting factor, large subunit [uncultured delta proteobacterium HF0070_15B21]  clstr ali  28  1MPVSITREPIDLTALRQ--RALHPQAGAVLIFCGDIRNHSDNVDKLEYESHESMALNQMDQVAEEASQKWPIHYVEIIHRLGTMEVMECSIAIAVSTSHRADAYEASRFIIDTVKRSVPIWKKEFFSGGTSWSEGCE............. 138
458 2.000e-41gi|407803330|ref|ZP_11150166.1| molybdopterin guanine dinucleotide biosynthesis protein MoaE [Alcanivorax sp. W11-5]  clstr ali  48  29............................VVLFSGLVRDEGDQVQTLTLEHYPGMSERRLRELCEQVAARWPLARVLAWHRVGVMTPAETIVLVGVAAAHRREAFEACDCLMDRVKTEVPLWKKLSGPGGDGWVEARDRDREAAARWH... 147
459 2.000e-41gi|212224771|ref|YP_002308007.1| molybdopterin converting factor subunit 2 [Thermococcus onnurineus NA1]  clstr ali  34  1MKVKITKEPFDLNEALSYLLV--PEAGGYVFFLGKVRNENHGVRKLIYEAYEEMAIEEMERIRGEALEKFPILDILIWHRYGELNVGEDTILIIASGKHRKEAFEACMWAIDEVKRRVPVWKREVTDEGIFWIEG............... 135
460 2.000e-41gi|56090313|ref|NP_001007634.1| molybdopterin synthase catalytic subunit isoform Mocs2B [Rattus norvegicus]  clstr ali  26  57.IIQFTAKKLSVGEVSQLVVS--PLCGAVSLFVGTTRNNFEGVISLEYEAYLPMAENEIRKICNDIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEIYEESSSWKRNKECFWAA........ 198
462 3.000e-41gi|255564476|ref|XP_002523234.1| molybdopterin synthase large subunit, putative [Ricinus communis]  clstr ali  30  9.LVEILEEPIDLAKYINYVSA--PQAGAIATFSGTTRDTFEGVVELRYEAYVPMAIRQLKSICSSARLSWNIHSIAVAHRLGSVPVGETSVFVAVSAVHRTDALDACKFAIDELKASVPIWKKEVYSNGEVWKENSE............. 146
463 3.000e-41gi|297564811|ref|YP_003683783.1| molybdopterin converting factor subunit 1 [Meiothermus silvanus DSM 9946]  clstr ali  35  93..FGLTSDPLNLQPYVEW--ASAPPYGAVVVFLGTTRSPNRGVTYLEYEAYPGMAEAVMRQIITEMRQRWVLGRIALWHRTGRVHPAEASILIVVSAPHRPEGFEACRYAIERVKQILPVWKKEFAPDGSHWVEGH.............. 226
465 3.000e-41gi|108757602|ref|YP_630783.1| molybdopterin converting factor, subunits 1/2 [Myxococcus xanthus DK 1622]  clstr ali  36  91.KFLVVDRPLRLEEVVEAVRG--ESYGGLVTFSGSVRNQTKGVLRLEYEAYAPMAEKKLAEIGAEAAERFPGVRVSIIHRVGTLVPGELAVVIAAASPHRKEAFGGCEYAIERLKQDVPIWKKEFFEDGEVWV................. 222
467 3.000e-41gi|300779532|ref|ZP_07089390.1| molybdenum cofactorbiosynthesis protein large subunit [Chryseobacterium gleum ATCC 35910]  clstr ali  27  2VDIKITEHILDLTDCFAL--ASDHAYGGIASFVGTVRNHTKGVTRLEYECYQSMAVKEIQKIADKAISLFSVKNIVVHHRTGVLFPGDAAVIIVVSDGHRNAVFDACSFMIENIKKTVPIWKKEIFEDGEEWVSAH.............. 137
469 3.000e-41gi|315648864|ref|ZP_07901959.1| molybdopterin converting factor, subunit 1 [Paenibacillus vortex V453]  clstr ali  29  104....ITSDKLSVEEAVAKV--HDANHGATLSFIGTTREMTGEMRTLEYEAYIPMALKEMQQICADILSQWPGTQCAISHRIGTVGIGETSVVIAVSSPHRASCYDASRYAIEQLKRSVPIWKKEIWDDGSEWKGP............... 234
470 3.000e-41gi|167465400|ref|ZP_02330489.1| molybdopterin converting factor-like protein [Paenibacillus larvae subsp. larvae BRL-230010]  clstr ali  29  102....ITYEPIQVEEVTQKVI--HPHHGAVLSFVGTTREFTNGQRTLEYEAYVPMALKTMEQIGTELAQRWPGTRCAITHRLGRVDLAEISVVIAVSSPHRAECYEASRYAIERLKQIVPIWKKEVWEDGSEWK................. 230
471 3.000e-41gi|168700070|ref|ZP_02732347.1| molybdopterin converting factor-like protein [Gemmata obscuriglobus UQM 2246]  clstr ali  35  1.MFRLTHDPIDYHALTESVR--NPHCGAVVLFLGTVRDLTGSRVTLEYEAYAPMAEKKLAEIEAAARERWPIGELAITHRLGRLEVGEVSVAVAASCPHRGDAFDACRYVIDTLKELVPIWKKENAPDGTEWVH................ 134
475 4.000e-41gi|427418101|ref|ZP_18908284.1| molybdopterin converting factor, large subunit [Leptolyngbya sp. PCC 7375]  clstr ali  33  21..FAITFAPLSLDEIYHL--ADDEANGAIVVMSGMVRNNTEGVVALEYQAYEPMAIAVFKQIAAEMRQRWDITHVVIHHRTGKLTVGEISVLVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEIWKDGSSWVSIGACEDD......... 161
476 4.000e-41gi|411009901|ref|ZP_11386230.1| molybdopterin converting factor subunit 2 [Aeromonas aquariorum AAK1]  clstr ali  40  10.RILVQREDFSLADEYARLAARQD-TGAVVSFVGKVRDFNQGVKGLALEHYPGMTEKALTDIVAEARSRWPLQECTLIHRIGELLLGDQIVLVVVSSAHREAAFEACHFIMDFLKTRAPFWKK........................... 132
478 5.000e-41gi|261408747|ref|YP_003244988.1| molybdopterin converting factor subunit 1 [Paenibacillus sp. Y412MC10]  clstr ali  26  104....ITCHRLSVEETIAKV--HDDNHGATLSFVGTTREITGQMRTLEYEAYIPMALKEMQQICMDIHGRWPGTKCAISHRIGTVGIGETSVVIAVSSPHRETCYEASRYAIEQLKRSVPIWKKEIWDDGSEWKGAQTGPWDPIAR..... 244
479 5.000e-41gi|218245639|ref|YP_002371010.1| molybdopterin biosynthesis MoaE protein [Cyanothece sp. PCC 8801]  clstr ali  33  22...KMTFAPLSLDEVYGL--ADDPANGAIVVMSGTVRQQTDGVHYLEYQAYEPMALEIFRQIAVNIRQEWSDTRVVIHHRTGKLNIGEISVLVAVGCPHRGEAFAACRYAIDTLKHNAPIWKKEHWKDGSSWV................. 153
480 5.000e-41JCVI_PEP_1096691531349 /source_dna_id=JCVI_ORF_1096691531348 /offset=0 /translation_table=11 /length=203 /full_length=203  ali  52  78MDVRVQSGAFDLGAEANGFAGRVDGAGAVVTFTGIVRNTAAGDQAMEIEHYPGMTEKAITAIAEEARTRWALADVLVIHRHGRLAPGETIMMVATAALHRKDAFEAAEYLMDYLKSRAPFWKK........................... 201
481 5.000e-41gi|145234190|ref|XP_001400466.1| molybdopterin synthase catalytic subunit [Aspergillus niger CBS 513.88]  clstr ali  31  34.HITLTYHPLDPTSALSKI--SSPNAGANVLFLGTTRNEDRPVAQLSYTAYPPLALKTLSKIAEDAVAKHELLGVVIGHRLGDVPIGESSIVIAVSAGHRGAAWRAGEEVLELCKEKAEIWKKEVFVDGQEWRANRDRDAE......... 174
482 5.000e-41gi|357008494|ref|ZP_09073493.1| molybdopterin converting factor-like protein [Paenibacillus elgii B69]  clstr ali  28  89....ITHDPILADEVTAKVL--HPDHGATLAFVGTTREFTHGKRTLEYEAYEPMALKTMRQIGDELSSRWPGTRLAITHRLGSVPVGETSVVIAVSSPHRDFVYEASRYAIERLKQIVPIWKKEIWEDGSEWK................. 217
483 6.000e-41gi|281200805|gb|EFA75022.1| molybdenum cofactor synthesis protein 2 large subunit [Polysphondylium pallidum PN500]  clstr ali  26  21..IEVSEEPIDF-KVGGYNRVEDDNAGAISTFLGTTRNNFKGVEKLEYEAYTPMAVKEIAKICSHLFTTYNILHIAVLHRIGTVPIGEASILIAISSAHRHDSLTAVQYAIDTIKATVPIWKKEYYTDGSVWKDNCESCH.......... 161
486 6.000e-41gi|392374288|ref|YP_003206121.1| molybdopterin-converting factor subunit 2 (Molybdopterin synthase subunit 2) (MPT synthase subunit 2) (Molybdenum co  clstr ali  37  1.MFEITDQPLSLEPLVTTVKRS--SSGAIATFLGVVREQTQGVRYLEYEAYREMAIPKMREIADEIRRKWEIDEVAMVHRVGRLQIGEASVAIAVSAPHRHAALTACAYAIDRLKEVVPIWKKEVWTDGEEWAGPGICDHH......... 140
487 6.000e-41gi|411119911|ref|ZP_11392287.1| molybdopterin converting factor, large subunit [Oscillatoriales cyanobacterium JSC-12]  clstr ali  31  28.HFAIRFAPLSLNEVYGL--ADDAANGAIVVMSGVVRNNTDGVVALEYQAYEPMALRVFQKIAAEIRSTWDVTHVVIHHRVGKLQIGEISVLVAVGCPHRSEAFAACKYAIDTLKHNAPIWKKEHWADGSSWVSIGACKQAAED...... 172
491 7.000e-41gi|220905988|ref|YP_002481299.1| molybdopterin biosynthesis protein MoaE [Cyanothece sp. PCC 7425]  clstr ali  32  26..FGITLAPLSLAEVYQQ--ADDPANGAIVVMSGMVRNQTEGVVALEYQAYEPMALKIFAQIADQIQEQWPVERVVIQHRIGRLIIGEISVLIAVGSPHRAEAFAACQYAIDTLKQQAPIWKKEWFADGGRWANCC.............. 161
492 7.000e-41gi|337745453|ref|YP_004639615.1| molybdopterin converting factor-like protein [Paenibacillus mucilaginosus KNP414]  clstr ali  27  89....ITRDPISVEDVTAKVI--RPHHGAALSFVGTTREFTHGQRTLEYEGYEPMALKTMEQIGGEIEARWPGTLCAITHRLGPVPIGEISVVIAVSSPHRDASYDASRYAIERLKQIVPIWKKEIWEDGSEWK................. 217
493 8.000e-41gi|115374997|ref|ZP_01462268.1| molybdopterin (MPT) converting factor, subunit 2 [Stigmatella aurantiaca DW4/3-1]  clstr ali  35  85.LFAVVDRALRLEEVVAAV--SGEAYGGLVTFSGSVRNQTRGVLRLEYEAYPPMAEKRLAAIGAEAAERFGGTRLAIMHRVGTLEPGELAVVIAAAAPHRKEAFLACEHAIERLKQDVPIWKKEFFEDGEVWV................. 216
497 8.000e-41gi|57642050|ref|YP_184528.1| molybdopterin converting factor subunit 2 [Thermococcus kodakarensis KOD1]  clstr ali  37  1MKVRLTKDKFSVDEAISLLRV--PESGAYVVFLGQVRNENRKVEKLIYEAYPEMAEAEMERIREEALKKFPILDMVIWHRYGELDVGEDTILIVASAKHRKEAFRACEWAIDEVKRRVPVWKKEVTPEGAFWLEG............... 135
499 8.000e-41gi|253577646|ref|ZP_04854955.1| molybdopterin converting factor [Paenibacillus sp. oral taxon 786 str. D14]  clstr ali  31  102....ITEEPLSVEEITAKVI--TPDHGAVLTFTGTTREWTQGQRHLEYEAYVPMALAKLRQIGAEITERWPGTRCAISHRIGRVDIAEISVVIAVSAPHRAGCYEASRYAIERLKQIVPIWKKEIWEDGSEWK................. 230
502 9.000e-41gi|307150745|ref|YP_003886129.1| molybdopterin biosynthesis MoaE protein [Cyanothece sp. PCC 7822]  clstr ali  32  21...KISFAPLSVDEVYRL--ADDAANGAIVMMSGTVRNQTDGVIYLEYQAYEPMAREIFRAIAAQIRQRWPVNRVVIHHRIGKLEIGEISVLVAVGCPHRGEAFEACRYAIDTLKHNAPIWKKEFWRDGSQWVSACEVD........... 160
504 1.000e-40gi|308070033|ref|YP_003871638.1| molybdopterin converting factor subunit 2 [Paenibacillus polymyxa E681]  clstr ali  30  90.LFAITYDPIDADEVTSKVL--DPSHGASLTFNGTTREFTQGQRTLEYEAYVPMAMNTMKQIGDEIAERWPSTRTAITHRLGTVRIGETSVVIAVSAAHRDTCYEASRHAIERLKQIVPIWKKEVWEDGSEWK................. 221
505 1.000e-40gi|282898865|ref|ZP_06306852.1| Molybdopterin biosynthesis MoaE [Cylindrospermopsis raciborskii CS-505]  clstr ali  34  17..FAITIAPLLPEEIYTA--AQDLANGAVVLMSGVVRNQTDGVVALEYQAYEPMALQVFYQIATHIRNQWNVNRVVIHHRIGKLRVGEISVLVAVGSPHRGEAFAACQYAIDTLKHQAPIWKKEYWHDGSSWVLNCS............. 153
506 1.000e-40gi|225872597|ref|YP_002754052.1| molybdopterin converting factor subunit 2 [Acidobacterium capsulatum ATCC 51196]  clstr ali  35  77..VWLTRDLIDANAVLARVR--HPEDGAVASFDGIVRNQTRGRQTLVYEAYEEMALEQMRQLAGEAKQRFAIHDVVMVHRLGRLEIGESSVLIGVCSAHRAAAFDACRWLINTLKKTVPIWKKEHFVDGAVWADG............... 209
508 1.000e-40gi|172035622|ref|YP_001802123.1| molybdopterin (MPT) converting factor subunit 2 [Cyanothece sp. ATCC 51142]  clstr ali  30  25..FKISFAPLSLEEVYGL--ADDPSNGAIALMSGTVRQQTEGVKYLEYQAYEPMALVIFQEIAATIRQQWPETRVVIHHRIGKLEIGEISVLIAVGCPHRAEAFAACRYGIDTLKHNAPIWKKEFWADGSTWVSIGACEEA......... 165
511 1.000e-40gi|134045401|ref|YP_001096887.1| molybdopterin synthase subunit MoaE [Methanococcus maripaludis C5]  clstr ali  31  1.MIRVSNEDFNVDVETKALLKEHPEIGGLVNFVGVVRNYDKGVEKIEFECYEQMASKKLEELKNRAIEKFNIINATLIHRIGTLNVGENIVLIVVGAKHRKEAFLACEYLIDSLKEEVPIWKKEFSKDGSYWVEQH.............. 141
512 1.000e-40gi|299537476|ref|ZP_07050770.1| molybdopterin-converting factor subunit 2 [Lysinibacillus fusiformis ZC1]  clstr ali  31  5.LFEIIDQPIDVEEVRQKVLSR--NAGAITLFIGTVREMTNGKKHLEYQAYPAMAIKMFEQIAKEIQEEWPEAKVAITHRVGHLAISDIAVVIAVSSPHRKIAYMANEYAIDRIKQIVPIWKKEHWEDGTEWI................. 136
515 2.000e-40gi|86609649|ref|YP_478411.1| molybdopterin converting factor subunit 2 [Synechococcus sp. JA-2-3B`a(2-13)]  clstr ali  32  18..FQITLAPLSIDRVHQE--AYHPGNGAVVVMSGTVRDNTNGVDYLEYQAYEPMALKVFADIARQIQQRWPDNSVVIHHRIGKLRIGEISVLVAVGTPHRAEGFAACQFAIDTLKHNAPIWKKEYWRDGTSWV................. 150
516 2.000e-40gi|383457490|ref|YP_005371479.1| molybdopterin converting factor, subunits 1/2 [Corallococcus coralloides DSM 2259]  clstr ali  35  85.LFRVVGRPLQLSEVVEAV--ASEGAGGLVTFSGAVRDQTKGVLRLEYEAYAPMAEAKLTEIGDEVARTWPGTRLAIVHRVGTLVPGELAVVIAAASAHRKEAFLGCEYAIERLKQDVPIWKKEFFEDGEVWV................. 216
517 2.000e-40gi|340355833|ref|ZP_08678505.1| molybdenum cofactor biosynthesis protein large subunit [Sporosarcina newyorkensis 2681]  clstr ali  27  4..FELVDTPIDPQKYSEFVL--HPAAGAVTVFTGHVREWTHGVRTLYYEAYIPMAEKKLAEIGAEMEEKWPGVRVAMAHRIGELKISDIAVVIAVSSPHRQAAYEANEYAIERIKEVVPIWKKEIWEDGEEWIGAQKKYPEKGSR..... 146
518 2.000e-40gi|297181327|gb|ADI17518.1| molybdopterin converting factor, large subunit [uncultured bacterium HF0130_06E03]  clstr ali  37  1.MYKITNKEIQPHDLFEAVRA--PKHGAIATFAGTVRDQTEGRTHLEYEAYPAMAEKIMERIGEEAKSKWPIGKVAILHRLGRLELEEISVLIAVGAGHRREAMEACLYIIDKLKEIVPIWKKEYGSDGEYWVEG............... 134
519 2.000e-40gi|226707498|sp|B5FXU9.1|MOC2B_TAEGU RecName: Full=Molybdopterin synthase catalytic subunit; AltName: Full=Molybdenum cofactor synthesis protein 2 la  clstr ali  26  12..IKLKSEKLSVGEVSELVVS--PYCGAVSLFIGTTRNNFEGVIHLEYEAYTSMAETEMKKICRDVRQKWPVKHIAVHHRLGVVPITEASVIIAVSSPHRAESLEAVMYCINTLKASVPIWKKEIYEDEYSWKENKECFWANSEK..... 155