current user: public




CCNA.00016
Query: ACL93483.1, from C.crescentus

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARALELEAYPGFTDAAITEIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPFWKKEHGPEGPRWIEPTARDRTDAQRWDQEALast
1 -61.800PF02391.12; MOC2B_ARATH/10-126; MoaE protein  ali follow..  24  2..ILEEGHKVDVVKYIDYVS--APQAGAIATFSGTTRDMFEGVLELRYEAYVPMATRCLSSICTTARSTWDIHKIAVAHRLGPVPVGETSVLIAVSSVHRADGLDACKFLIDELKASV................................ 117
2 -6.430PF09239.6; TOP6B_METAC/312-475; Topoisomerase VI B subunit, transducer  ali follow..  18LEKETNVDFIATSTRKPAVYSGNPFVVEVGLAYGGNLPKEEKISIMRFANRVPLLYQQGGCVTTHAVEDIRWKQYGLNQPGGGVPIGPVLLLIHVASINVPFTSESKDAIIPVIKEEVDLAVKEVARKLKHYLSKQSNLKKRREK..... 164
3 -6.290PF07819.8; BST1B_YARLI/78-316; PGAP1-like protein  ali follow..  12  50............................SIDFNEAYSALHGRTLLDQAEYLNDAIAYILDMYKRNQQEGLQVPEIVLGHSMGGIVSRVAVTIITLASPHLIPAATFDADITKVYHLVNDYWRAA.......................... 158
4 -6.260PF09517.5; B4SH28_PELPB/40-210; Eco29kI restriction endonuclease  ali follow..  10  33...........................GYPIYVGKAVPKGWRQAR-SSDNALNQSRELIGRLREHGRS---------ISLGAQLSLEDFMCRFVIFEVEGSDMISAIEAAL--IKLNKPLWNTAVDGFGNH--PGSGRYAQAKSDWDV.. 140
5 -5.990PF13046.1; E6U1U5_BACCJ/1-65; Protein of unknown function (DUF3906 topsan)  ali follow..  12  3.............................................................................IYRFEALINRDHTANIIVVANDEEKAFQLAEIELEKSYMKIPLFEKKKVGNGAAYV................. 64
6 -5.970PF10476.4; TM201_DANRE/188-391; Protein of unknown function C-terminus (DUF2448 topsan)  ali follow..  16  58.........................SGGVVPPKRVLQNENESKTDEGSLMWDDLMGLLPEKAVENARLFWQSGS----HQMAVASVGLLTCITGVLMARRIDAVASVLWLLCYLKTDVPSW............................. 163
7 -5.950PF11951.3; Q6C9N8_YARLI/315-798; Fungal specific transcription factor domain  ali follow..  10  370..........................ALVIYFYRLVLG----WPASSLQDRVKYLMHILLEMQNFKSKVWAG----FVGACEALTEDTRQGYTKYIQDLAECGMGTYYVPRNVITE---AWRLQDKGEESNWWD................ 474
8 -5.910PF13023.1; A7JZS5_VIBSE/14-177; HD domain  ali follow..  19  13..................................VKSAEGRLENSGEHSWHVALMAILMEEHANAPVDICRVMKMLLIHDVVEIDAGDTFVYDTAASQEQAEK-RAAERLFGMLPSDQALWHEFEAAQTDDAKYAKALDR.......... 124
9 -5.790PF14067.1; B8KXR5_9GAMM/226-420; LssY C-terminus  ali follow..  11  29.............................IAIIGDSADVLNSLSRVGWSFTHRITPGTVLKVVGASISDKSYPVSPVSSLDTFGRKQDFALQRARAGISQRNHMR--------------LWMAPFTYRGQHWVGQISRDI.......... 126
10 -5.740PF09522.5; Q9ZLX1_HELPJ/122-251; R.Pab1 restriction endonuclease  ali follow..  26........DFELSRISYPLLIHSFDDNELSEIVIKEQQYGSKTQAMLYFCFSILELKTATPLLNRTAMPKEHALLIIHETNALVFLEMLKIFGLLSQVHHNDVLKILEKILQ...................................... 129

FFAS is supported by the NIH grant R01-GM087218-01
5 9 8 1 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98.