current user: public

Query: gi|29345429|ref|NP_808932.1| hypothetical protein BT_0019 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
1 -6.450g2vt1.1 d.367.1.1 (A:237-257,B:258-338) Surface presentation of antigens protein SpaS {Shigella flexneri [TaxId: 623]}  ali 3D-neighbors follow..  16  23...................................................PTHIAIGIYFPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKLY.. 76
2 -6.380d3ljsa1 c.72.1.0 (A:12-338) automated matches {Xylella fastidiosa [TaxId: 183190]}  ali model 3D-neighbors follow..  69FAEAGVVTDGIVRTSTAKTALAFVALDAHGERSFSFYRPPAADLLFRVEHFQDASFSDALIFHACSNSMTDADIAEVTFEGM-RRAQAAGAIVSFDLNFRPMLW.. 171
3 -6.360d3iq0a_ c.72.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]}  ali model 3D-neighbors follow..  70LAADGVDIRGISVLPLEATGSAFVTYHNSGDRDFIFNIKNAACGKLSAQHVDENILKDCTHFHIMGSSLFSFHMVDAVKKAV-TIVKANGGVISFDPNIRKEML.. 172
4 -6.300d2jlia_ d.367.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}  ali model 3D-neighbors follow..  16  11.....................................MRENVKRSSVVVANPTHIAIGILYRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALY.. 78
5 -6.250d2o14a2 c.23.10.8 (A:160-367) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  11  37.................DKHTFQVRNMASGGQIARGFRNDQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATD.. 124
6 -6.060d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  11  36DDKESKVYLNFFSKENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGDLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDC. 146
7 -6.030d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  12FNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQVFMAIDANSGTELPISLFVTVKDTIEMERLFNGLKD...................... 95
8 -5.990d3heba1 c.23.1.0 (A:8-147) automated matches {Rhodospirillum rubrum [TaxId: 269796]}  ali model 3D-neighbors follow..  6IEDDLGHARLIEKNIRRAGVNNEIIAFTDGTSAL-NYLFGDDKSGRVSAGRAQLVLLDLNLPDMTGIDILKLVKENPHTRRSPVVILTTTDDQREIQRCYDL.... 106
9 -5.820d3t7ya_ d.367.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]}  ali model 3D-neighbors follow..  13  15...................................................PKDIAVAIGYPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRNVPLAHQLL.. 68
10 -5.810g3bzy.1 d.367.1.1 (A:246-262,B:263-345) Type III secretion proteins EscU {Escherichia coli [TaxId: 562]}  ali 3D-neighbors follow..  10  2..................................GSLANNIKKSTVIVKNXPTHIAICLYYLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLD.. 72

FFAS is supported by the NIH grant R01-GM087218-01
8 7 2 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.