current user: public




Query: gi|29345429|ref|NP_808932.1| hypothetical protein BT_0019 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MEKENTNGGSVYVTVDGHFKPVHVSMKGTGEKGFLEFMLEDVEKALKETEMPVIGMMYYNVPDMGIVPHLWEGNNDDYLQRLEKAMDGHGIKLHRYLRLSEVVYCLLast
1 -7.330d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]}  ali model 3D-neighbors follow..  10  69IKECQRMGVKVFLALGGPKGTYSACSADYAKD-LAEYLHTYFLSERREGPLGKVALDGIHF-------DIQKPVDELNWDNLLEELYQIKDVYQSTFLLSAAPGCL 166
2 -6.740d2o14a2 c.23.10.8 (A:160-367) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  11  37.................DKHTFQVRNMASGGQIARGFRNDQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATD.. 124
3 -6.310d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  11  36DDKESKVYLNFFSKENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDC. 146
4 -6.220d1e5pa_ b.60.1.1 (A:) Aphrodisin, a sex pheromone {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}  ali model 3D-neighbors follow..  11  37YKNCSEMEITFYVITNNQCSKTTVIGYLKGNGTYETQFEGNNIFQPLYITSDKIFFTNKNMDRAGQVAGKGNALTPEENEILVQFAHEKKIPVENILNILATDTC. 147
5 -5.960g2vt1.1 d.367.1.1 (A:237-257,B:258-338) Surface presentation of antigens protein SpaS {Shigella flexneri [TaxId: 623]}  ali 3D-neighbors follow..  16  23...................................................PTHIAIGIYFPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKLY.. 76
6 -5.930d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  81..VPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLY-----------GRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCI 173
7 -5.770d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  17  66..TEGDGPAKFQVTRLSGKKEVVVE-----ATDYLTYAIIDITSLVAGAVHRTMKLY-----------SRSLDDNGEALYNFRKITSDHGFSETDLYILKHDLTCV 153
8 -5.690d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  12FNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQVFMAIDANSGTELPISLFVTVKDTIEMERLFNGLKD...................... 95
9 -5.650d1znda1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  72...DKTEKAGEYSVTYDGFNTFTIP-----KTDYDNFLMAHLINEKDGETFQLMGLY-----------GREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRC. 157
10 -5.630d1lr0a_ d.212.1.1 (A:) TolA {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  17  45.SARNGMSVEVLIEMLPDGTITNASVRSSGDKPFDSSAVAAVRNVGRIPEMQQ..................................................... 97

FFAS is supported by the NIH grant R01-GM087218-01
6 5 1 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.