current user: public

Query: gi|29345429|ref|NP_808932.1| hypothetical protein BT_0019 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
1 -6.690g2vt1.1 d.367.1.1 (A:237-257,B:258-338) Surface presentation of antigens protein SpaS {Shigella flexneri [TaxId: 623]}  ali 3D-neighbors follow..  16  23...................................................PTHIAIGIYFPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKLY.. 76
2 -6.160g3bzy.1 d.367.1.1 (A:246-262,B:263-345) Type III secretion proteins EscU {Escherichia coli [TaxId: 562]}  ali 3D-neighbors follow..  13  19...................................................PTHIAICLYYLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLD.. 72
3 -6.140d1n6za_ d.263.1.1 (A:) Hypothetical protein Yml108w {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  1MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELIDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN................ 105
4 -6.100d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]}  ali model 3D-neighbors follow..  12VEDSDEDFSTFQRLLQREGVVNPIYRCITGDQALDFLYQTGSYCNPDIAPRPAVILLDLNLPGTDGREVLQEIKQDEVLKKIPVVIMTTSSNPKDIEICYSY.... 113
5 -5.650d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]}  ali model 3D-neighbors follow..  10  69IKECQRMGVKVFLALGGPKGTYSACSADYA-KDLAEYLHTYFLSERREGPLGKVALDGIHFD-------IQKPVDELNWDNLLEELYQIKDVYQSTFLLSAAPGC. 165
6 -5.590d1r5sa_ f.50.1.1 (A:) Gap junction alpha-1 protein, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  14  29..SPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQ........................................ 92
7 -5.580d1mg4a_ d.15.11.1 (A:) Doublecortin-like kinase Dclk {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  1...KKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESY........................... 76
8 -5.500d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  81..VPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYG------------TKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCI 173
9 -5.480d3nula_ d.110.1.1 (A:) Profilin (actin-binding protein) {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  1................................SWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQE-IDGIKKDFEEPGFLAPTGLFLGGEKYMV 73
10 -5.310d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  11  36DDKESKVYLNFFSKENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGDLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDC. 146

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.