current user: public




Query: gi|29345429|ref|NP_808932.1| hypothetical protein BT_0019 [Bacteroides thetaiotaomicron VPI-5482], from B.thetaiotaomicron

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MEKENTNGGSVYVTVDGHFKPVHVSMKGTGEKGFLEFMLEDVEKALKETEMPVIGMMYYNVPDMGIVPHLWEGNNDDYLQRLEKAMDGHGIKLHRYLRLSEVVYCLLast
1 -7.150[C] COG3052 Citrate lyase, gamma subunit  ali follow..  16  1MKINQLESGDVMIRIAPDTQDIDLQINSSVEKQFGEAIRATILEVLSRYDVRG---VQLNVDDKGALDCILRARLETLLARASG...................... 88
2 -6.770[B] KOG3844 Predicted component of NuA3 histone acetyltransferase complex  ali follow..  12  580..RADDSGDSVLINDPPAWNTFNLVLRDESVLEFVKYVSWSAKSS------------RWDVKMKWDVKSCDEDGQED............................. 642
3 -6.760[E] COG2755 Lysophospholipase L1 and related esterases  ali follow..  12  17LSDQPVTNRTIYVGGDSDKHTFQVRNMASGGQIARGFRNDQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATD.. 145
4 -6.310[S] COG5447 Uncharacterized conserved protein  ali follow..  53EKKGAEAAGAIFVRQRRAERRFETRLAGVEGEEIAALLERERRF-------SDLWVVEIETDEIGTLLTLVDQPQA.............................. 145
5 -6.030[G] KOG2855 Ribokinase  ali follow..  13  77LRKNGVDDQGINFDEGARTALAFVTLRSDGEREFMFYRNPSADMLLRPDELNLELIRSAKVFHYGSISLITEPCRSAHMKAM-EVAKEAGALLSYDPNLREPLW.. 179
6 -5.780[O] KOG1752 Glutaredoxin and related proteins  ali follow..  11  72.........KLFHDMNVNYKVVELDLLEYGNQ-----FQDALYKMTGERTVPRIFV------NGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ...... 151
7 -5.440[R] COG3972 Superfamily I DNA and RNA helicases  ali follow..  609.LRLRADRNKIFAAFTRTKAWLRVSGLGDSARRVAVEIDTALR---------NFPHLKFKMPDISEIDLIQSIKAKKIRNEYIQKLKDEGFTEDEIADILSLEE.. 708
8 -5.280[U] COG4792 Type III secretory pathway, component EscU  ali follow..  10  214LKMSHDEVKREYKDSNGDPH-IKQKRRQLQHEVQSGSFATNVRRSTAVVRNPTHFAVCLIYPEETPLPIVIEKGHDEQAALIVSLAEQSGIPVVENIALARALH.. 317
9 -4.650[C] KOG3446 NADH:ubiquinone oxidoreductase NDUFA2/B8 subunit  ali follow..  20  20....................RIHLCQRSPGSQGVRDFIEKRYVELKKAN--PDLPILRYAFGQETNVP-LNNFSADQVTRALENVLSGKA................ 99
10 -4.650[J] KOG3445 Mitochondrial/chloroplast ribosomal protein 36a  ali follow..  11  32....................TLKFCKNNGSSRGMRDFIENHLLDFAKEN--PGIVVYEYLNGEREWMS-CRNSTQEEISKWIDLLKTQNG................ 111

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.