current user: public




60683425.1-99
Query: gi|60683425|ref|YP_213569.1| 30S ribosomal protein S14 (BF3990) [Bacteroides fragilis NCTC 9343] (Range: 1-99), from B.fragilis

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MAKESMKAREIKRAKLVAKYAEKRAALKQIVRTGDPAEAFEAAQKLQELPKNSNPIRMHNRCKLTGRPKGYIRQFGVSRIQFREMASNGLIPGVKKASWLast
1 -42.700PF00253.16; Q6FQ77_CANGA/59-113; Ribosomal protein S14p/S29e  ali follow..  35  1...........................................LQLSSMPNYTRLTQVKNRCIESGHARAVLSDFRLCRYQFRERALKGELPGVKKG.. 54
2 -6.700PF12536.3; B9JGV2_AGRRK/262-369; Patatin phospholipase  ali follow..  5.......SRTRLNTDLFLERHRLRRTISELYARLPEEAKADPAIQKLKAQCSDYGVTIIHLIYRNKQFRSHSKDYEFSALSMHEHWETGL--ALLAEDW 99
3 -6.420PF10011.4; A3WAG0_9SPHN/12-390; Predicted membrane protein (DUF2254 topsan)  ali follow..  14  210.ALGTGYVQMIDFEDLEEIARGCDCTFSLCVRTGDFVHRDIPLMEIKGCKPDEIEEKVRA-CFTLGSVRTPTQDPQFLIDELVEIGLRALSPGINDPF. 305
4 -6.220PF12103.3; A6EP27_9BACT/37-215; Surface lipoprotein of Spirochaetales order  ali follow..  14  84LERSTIFKKED-----ISVDAAKNATWTQLASNDDSSEKQPSGSSYNSLLRYKSEIGSPTKALTAGLYRIGFTTYKTGEVKGTFLAEVAKLPGVV.... 178
5 -6.050PF08989.5; A6L259_BACV8/6-148; Domain of unknown function (DUF1896 topsan)  ali follow..  14  1...............................KNTATGELSYFETTLLLYLKESHPHIAGDKELVRTRTDEAAAGYGLSVMQALQLVEAVLYQDLRFSRF 74
6 -5.900PF05572.8; A6GYE5_FLAPJ/150-302; Pregnancy-associated plasma protein-A  ali follow..  4.........NPAIYNYMWYGSNSKYYLDVVIVDEPNTGQGASGSGHAFLPVQNVVPHVTFNYRYIGSTCGSSSSVTFAKVFSHEL---GHYFGLRHT.. 88
7 -5.690PF00967.12; HEVL_ARATH/73-191; Barwin family  ali follow..  14  73...................................................AAVTVRIVDQCSNGG--------LDLDVAMFNQIDTFGYQQGHLIVDY 114
8 -5.680PF02365.10; Q8LRL7_PETHY/23-151; No apical meristem (NAM) protein  ali follow..  16  67..............................................KKYGNGSRLNRATGQ-KATGKDRHVRHKSQDIGMKKTLVFHSGRAPDGKRTNW 121
9 -5.580PF08690.5; GET2_CANAW/10-296; GET complex subunit GET2  ali follow..  19  5.EEKKRLLRERRQAKMSKGKATAR--LNDILSQGSSVKTSGVKSVLDQEKEATP............................................. 55
10 -5.550PF03678.9; A5X574_9ADEN/594-820; Hexon, adenovirus major coat protein, C-terminal domain  ali follow..  17  4...............................NDQSFIDYLSSANMLYPIPAKATNIPIT----IPSRNWAAFRGWSFTRIKQKEFTYSGTIPYLDGTFY 78

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.