current user: public




11497096
Query: gi|11497096|ref|NP_051173.1| hypothetical protein (BB_P12) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MQFYDLREVYFSIGGTQLHSGKLELTSEPTTRAVISSEDKGMPVISLRDPKTITYVFNIEVTLGSHDYILLTELSDEQFYNMDVRKEDKMLDLAFNDRIATKIISNYAIFTEEPSRSYSAEAEKVSFEIRAINCQKSKPNNSLast
1 -112.000PF07316.6; Q9S002_BORBU/8-147; Protein of unknown function (DUF1463 topsan)  ali follow..  99  1MQFYDLREVYFSIGGTQLHSGKLELTSEPTTRAVISSEDKGMPVISLRDPKTITYVFNIEVTLGSHDYILLTELSDEQFYNMDVRKEDKMLDLAFNDRIATKIISNYAIFTEEPSRSYSAEAEKVSFEIRAINCQKTKPN.. 140
2 -12.900PF11681.3; C6BBS2_RALP1/1-146; Protein of unknown function (DUF3277 topsan)  ali follow..  13  1MPAYSFKDVSVSLVGPTGTLSLGYGNAVAEEGVDVNAANDKNTMTVGADGEGMHSLITIRLLKTSPQNQKLMAMYDAQ--AISASLWGKNIITITNSAAADLHVGRECAFKKKPDMKYAKDGDIISWVFDSVKIDS...... 141
3 -7.520PF13788.1; B8G072_DESHD/206-317; Domain of unknown function (DUF4180 topsan)  ali follow..  18..............................................IQREQDAIDIISLCAEHGTNAVVLDGNTLSDDFVKLRTGLAGAVLQKFVNYNIKAAVAIKGGQNFPVRFQEMASEHSS.................. 95
4 -7.020PF09046.5; HPAB1_PSESS/418-541; AvrPtoB E3 ubiquitin ligase  ali follow..  21  8...................RAALDIAPQFSQLRTISKADAESEELGFRDANATSCLFGEELSLSNPDQQVINPTDKPQPYSQEVNK-----ALTFMDM--KKLAQYLADKPEHPLNRQRLDAKNIS................ 116
5 -6.810PF09070.6; A7SQD4_NEMVE/34-154; PFU (PLAA family ubiquitin binding)  ali follow..  25  57................................................KGKEYDYVFSVEIQEGKPPLKLPYNVTDDPWVAAHNFLEANDLSQMFLDQVVSFIQKNTA.................................. 116
6 -6.810PF03244.9; PSAH_ORYSJ/3-142; Photosystem I reaction centre subunit VI  ali follow..  15  12...........GLAGSSISGRKLAVRPSPRALCRTTRRPRAAVVAKYGEKSVYFDLEDIGNTTGQWD-----------LYGSDAPSPYNPLQSKFFETFAGPFTKRGLLLK............................... 100
7 -6.000PF11783.3; A0LEE1_SYNFM/327-501; Cytochrome c bacterial  ali follow..  14  50...................NGSLTTLTARDTIDPSGVVAVGWPNGDKNDANARIFPFKVHRGRQPYDKVNKTLVIPRLFGKEGTGAYWADYDWSAAAGMAYAGLPFSGELGFVDSTYVFPITHMVAPKDKAVQCQ....... 167
8 -5.860PF03559.9; A4X6Y2_SALTO/31-235; NDP-hexose 2,3-dehydratase  ali follow..  12  48.........FFTVEGLHVVRPDVGMEQQP----IIVQTEIGILGILAKEFDGTLHLMQAKVEPGNPNLVQLSQATRSNYTKAHGGTAVKYLEHFLDPPPGG--VLTDVLQSEHGAWFYRKRNRNMIVEI............. 166
9 -5.680PF04741.7; INVH_SALCH/1-147; InvH outer membrane lipoprotein  ali follow..  18  3.KFYSCLPVFLLIGCAQVPL--PSSVSKPVQQPGAQQEQLA--ANSIDECQSLPYV----------SDLAKNKSLSNQNADNSASKNSAISSSIFCEKYKQTKEQALTFFQEHPQYMRSKEDEEQLMT.............. 117
10 -5.530PF04440.11; DBND1_MOUSE/10-155; Dysbindin (Dystrobrevin binding protein 1)  ali follow..  22  4............VKDVKVPQAALNVSAHETTPVAEEEEEVGIPIPA-RQP--LSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDE..................................................... 91

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.