current user: public




Query: gi|11497096|ref|NP_051173.1| hypothetical protein (BB_P12) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MQFYDLREVYFSIGGTQLHSGKLELTSEPTTRAVISSEDKGMPVISLRDPKTITYVFNIEVTLGSHDYILLTELSDEQFYNMDVRKEDKMLDLAFNDRIATKIISNYAIFTEEPSRSYSAEAEKVSFEIRAINCQKSKPNNSLast
1 -108.000PF07316.9; Q9S050_BORBU/3-139; Protein of unknown function (DUF1463 topsan)  ali follow..  98  1..FYDLREVYFSIGGTQLHSGKLELTSEPTTRAVISSEDKGMPVISLRDPKTITYVFNIEVTLGSHDYILLTELSDEQFYNMDVRKEDKMLDLVFNDRIATKIISNYAIFTEEPSRSYSAEAEKVSFEIRAINCQKTKP... 137
2 -13.800PF11681.6; W0LBM9_9ENTR/1-144; Protein of unknown function (DUF3277 topsan)  ali follow..  13  1MATYSFADVSATLAGPSGVIDLGYGASNADEGIVVSMSGPQNTMTLGADGEVMHSLISITLLKTSPANKKLSSVYGAQ--GLSSTLWGNNIITIRNTASGDTIVARNCAFQKRPDHVNAKEGGNVTWVFDCGKVDQM..... 142
3 -6.570PF09070.9; M5BIR1_THACB/345-455; PFU (PLAA family ubiquitin binding)  ali follow..  18  50................................................NGKEYDYVFKVDIKDGAPPLSLPYNATDNPYSAAQKFLAENDLSMEYIDQVVSFIEKNAG.................................. 109
4 -6.480PF09046.8; HPAB2_PSESM/428-553; AvrPtoB E3 ubiquitin ligase  ali follow..  24  25..............................SKADAESEELGFKDAADHHTDDVTHLFGGELSLSNPDQQVINPTDTSQPYSQEGNK-----DLAFMDMK--KLAQFLAGKPEHPMTRETLNAENIA................ 118
5 -6.470PF13788.4; R7I7P1_9FIRM/8-118; Domain of unknown function (DUF4180 topsan)  ali follow..  10  2.............................DGVSIALIRSEKPLMTDVQS--ALDLMMTVRAETGCKRIALNREAIMGDFFVLSTGIAGEILQKFVNYGFKLAVYGDFAHETSAALRNFIRESNE.................. 94
6 -6.260PF13390.4; A2DXC5_TRIVA/4-146; Protein of unknown function (DUF4108 topsan)  ali follow..  15  40...FNIKPIAFAFDNKLIENAKI-WELIPNIEFITNINDKWFKRIPTTKVLCKLMIKTEEKEFNGFKYEKLQKKLNDRLSNDRIEKINKLAEVAFNNE............................................ 143
7 -6.180PF03018.12; DIR21_ARATH/44-188; Dirigent-like protein  ali follow..  17  45........................LTVGPEITSEEVGRAQGMYASADQNKLGLLMAFNLVFTKGKFSDSTVAMYGRNP---------------VLSKVREMPIIGGTGAFR---GRGYA....................... 122
8 -6.010PF16667.3; M3XYK5_MUSPF/1564-1628; Unstructured region 10 on multiple PDZ protein  ali follow..  22  32.........................SGSPEPESIPSTSRSSTPAIFASDPATCPII...................................................................................... 62
9 -5.920PF03559.12; A4X6Y2_SALTO/33-234; NDP-hexose 2,3-dehydratase  ali follow..  11  46.........FFTVEGLHVVRPDVGMEWQQPIIVQTEIGILGILAKEFDG--TLHFLMQAKVEPGNPNLVQLSPTVQATRSNYTKAHGGTAVKYLFLDPPPGGVLTD-VLQSEHGAWFYRKRNRNMIVEI............. 164
10 -5.280PF10761.7; Q2SPY2_HAHCH/5-103; Protein of unknown function (DUF2590 topsan)  ali follow..  16  6.....................................VNNDISLDAIGVPQEISGRASIDIKHMIRDSGLLVELIGERNPEKVALNLSRIETRVENDA---RITPGTAKVTRTDLETFYITAKTLKY............... 94

FFAS is supported by the NIH grant R01-GM087218-01
8 2 7 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.