current user: public




Query: gi|11497095|ref|NP_051172.1| hypothetical protein (BB_P11) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MPQDTISVSLLDSRIQASRPNYYNPLLVYKTAKIKVNKDAASYKILNLTVNNYEKQIETLEKENGNGEDQFGKEKTLLKTAMSNFFNSSEESLKSADLFIYKDKPEELKNYLKVHRHTFVVLINTEGDASDDGLKIYKDDYNKFKKPSTFFVFSTKEQEIKELFKDKGNTEKERNIAVYSNNKDNLHLKFISQYLHQASIFHAVNPYGMPLAATPLVDDTVIGKLRTAKINFYSLLNETGLDGVPAFKEGVDLAGGAIDEQFTYHYIKNEAIIELIRIWNKNNRQNSKLSALQLSGARDNAYTSAIECLLKRFVDRGLIIEYKNLRLTLSPTPQLKLELSVNITYNFSINAVALVITTQDIVDYQNSLSALast
1 -139.000PF05619.9; Q9S003_BORBU/1-362; Borrelia burgdorferi protein of unknown function (DUF787 topsan)  ali follow..  95  1MPQDTISVSLLDSRIQASRPNYYNPLLVYKTAKIKVNKDAANFITLNLTVNNYEKQIETLEKDNGNGQDQFGKEKTLLKTAMSNFFNSSEESLKSAVLFIYKDKPEELKKYLKVHRHTFVVLINTEGDNSDDGLKIYKDDYDKFKTPSIFFVFSTKEQEIKELFKDKGNTEKERNIAVYSNNKDNLHLKFISQYLHQASIFHAVNPYGMPLAATPLVDDTVIGKLRTAKINFYSLLNETGLDGMPAFKESVDLAGSSIDELFTYHYIKNEAIIELIRIWNKNNRQNSKLSALQLSGARDNAYTSAIECLLKRFVDRGLIIEYKNLNLTLSPTPQLKLELSVNITYNFSINAVALVITTQDI......... 361
2 -8.450PF11863.6; Q2NSE0_SODGM/7-490; Protein of unknown function (DUF3383 topsan)  ali follow..  13  182...............................................................................TDLSALTGLSQAAGAAPVAGMDGETAAQAVATLADFSSAWYGLIVAAILSADDITAI--AAFISASSTSRIFGVTTQDTATDDIASQLKQGKSGRVFTQYSSTSPYAAASVFGRA---FTVNFGANNTTLTLKFKQELRTSQADALAAKNCNVFVRYD----NDTAILQEGVMANGDFFDERHGLDWLQNYVQNNLYNLLYTST------TKVPQTDAGGTRLLASVEQSMAQAVNNGLIAP-AAQAQADREKRQAP-PIQVACKLAGAVHFADVLIT............. 483
3 -6.190PF00531.20; TR10B_MOUSE/273-356; Death domain  ali follow..  13  4.......................................................................................................................................................................................................................................FEYCSDIVPFDSWNRLMRQLGLTDNQIQMVKAETLVTREALYQMLLKWRHQTGRSASINHL.............................................................................. 64
4 -5.340PF08014.9; Q2SF20_HAHCH/42-416; Domain of unknown function (DUF1704 topsan)  ali follow..  10......................KAPQVDIEYYQ--------KNCPLGFDPAAKKAEFYEIEREISKKLGQMNPVTQIMRRVCREY-ARGTPEFSYISQELYGSPSDAFHAGDPTLAELGEMMEMTLANLLKDSSMQESEKSLPAQYVVDELNARLSNFFVGAGIR---VMISDGIAADAAAGTDYIKIRNDALF--DVLEVHEGWVH-------------LGTTLNGGSQPYCTFLS-KGPPSATITQEGLAVDGATFNDVFEKGISEDESFTLAARVFRGSTPNLGPFA-------KDITYIKGFV-SLHDLEEQGVITAPRYVPPFFQDLKGLAAWMSFSRFIG........................ 374
5 -4.930PF12723.5; Q9RSW5_DEIRA/8-144; Protein of unknown function (DUF3809 topsan)  ali follow..  12  16..........................................................................................................................................................................................FVREPAAALAGVRFLRGLDSDGEQVWGELLVTVPLLGEV---DLPFRSEIVRTP--------QGAELRPLTLTGERAWVAVSGQATAA---AFAFQFQAHLATPEAEGWGGA--AFEKMVQAAAGRTLERVA.................................................... 136
6 -4.790PF04442.12; G4QNV2_GLANF/60-203; Cytochrome c oxidase assembly protein CtaG/Cox11  ali follow..  16  8.......................................................................................................................................................................................................FCDLTGINGKTSNEAAVYESVIIDESRTIKVEFITRTHS-----------GMPWEFRAQTAEVAVH--PGEMSEVAFYVRNPTDRDIIAQAIPSVSPGTAALFVNKTECF-----------CFKHQPLKAGEEALMPMKFYVDPQLPKDITVFTLQYTLYD.......... 144
7 -4.620PF06755.10; YPJF_ECOLI/1-108; CbtA_toxin of type IV toxin-antitoxin system  ali follow..  38  34..............................................................................................................................................................................................................YGLTLNDTPFSDETVIKEHIDAGITLADAVN..................................................................................................................................... 64
8 -4.540PF05320.10; RP19_VACCW/1-164; Poxvirus DNA-directed RNA polymerase 19 kDa subunit  ali follow..  15  5...........................................................................................................................DDIIDYESDDLTEYEDDEEEEEDGESLETSDIDPKSSYKIVESASTHIEDAHSNLKHIGNHISALK--RRYTRRISLFEIAESYNLLQRGRPLVSEFSDETMKQNMLHVIIQEIEEGSCPIVIEKNGELLSVNDFDKDGLKFHLDY-----IIKIWKLQKR...................................................................................... 163
9 -4.370PF02744.15; GAL7_KLULA/195-363; Galactose-1-phosphate uridyl transferase, C-terminal domain  ali follow..  14  1.......................................................................................................EFDHFEKYEHQHGAHLLEDYVNLELREKERIVCENDSFLVVVPYWAVWPFET-----------LSKRRIPSLNQFTDKEREDLASIIRNLTIRYDNLFETSFPYSMGLHQASLNATEGELKAAWFHMHFYPPLLRSAT--VRKFLVGFELLGQPQRD------LTAEQAADRLKALSGEVHYLAKL................................................................................. 169
10 -4.330PF11322.6; A0LQA4_SYNFM/47-169; Protein of unknown function (DUF3124 topsan)  ali follow..  13  4...................................................................................................VYVPAYSHIYHGDREVPFYLTVTLSVRNTDPEHPISITAVEY-----------HDNDGKLLTNYLKALAPMGSIHYIVKESDRSGGAGANFIVRWRSESKV------------TEPLIESVMISTATQQGISFTS........................................................................................................................................ 118

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.