current user: public




11497095
Query: gi|11497095|ref|NP_051172.1| hypothetical protein (BB_P11) [Borrelia burgdorferi B31], from B.burgdorferi

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MPQDTISVSLLDSRIQASRPNYYNPLLVYKTAKIKVNKDAASYKILNLTVNNYEKQIETLEKENGNGEDQFGKEKTLLKTAMSNFFNSSEESLKSADLFIYKDKPEELKNYLKVHRHTFVVLINTEGDASDDGLKIYKDDYNKFKKPSTFFVFSTKEQEIKELFKDKGNTEKERNIAVYSNNKDNLHLKFISQYLHQASIFHAVNPYGMPLAATPLVDDTVIGKLRTAKINFYSLLNETGLDGVPAFKEGVDLAGGAIDEQFTYHYIKNEAIIELIRIWNKNNRQNSKLSALQLSGARDNAYTSAIECLLKRFVDRGLIIEYKNLRLTLSPTPQLKLELSVNITYNFSINAVALVITTQDIVDYQNSLSALast
1 -145.000PF05619.6; Q9S003_BORBU/1-362; Borrelia burgdorferi protein of unknown function (DUF787 topsan)  ali follow..  95  1MPQDTISVSLLDSRIQASRPNYYNPLLVYKTAKIKVNKDAANFITLNLTVNNYEKQIETLEKDNGNGQDQFGKEKTLLKTAMSNFFNSSEESLKSAVLFIYKDKPEELKKYLKVHRHTFVVLINTEGDNSDDGLKIYKDDYDKFKTPSIFFVFSTKEQEIKELFKDKGNTEKERNIAVYSNNKDNLHLKFISQYLHQASIFHAVNPYGMPLAATPLVDDTVIGKLRTAKINFYSLLNETGLDGMPAFKESVDLAGSSIDELFTYHYIKNEAIIELIRIWNKNNRQNSKLSALQLSGARDNAYTSAIECLLKRFVDRGLIIEYKNLNLTLSPTPQLKLELSVNITYNFSINAVALVITTQDI......... 361
2 -6.770PF11863.3; Q46YM1_CUPPJ/6-490; Protein of unknown function (DUF3383 topsan)  ali follow..  11  181...............................................................................TDISAMLGMTSGLASVPVDGIVAEAPDACVNIFLDRFANKFLGVKFADTSVTNDQHVAVADLIEADQRHLYGATTQEPQALTDLLSRFKAKGYKYSFAQYSSTSAYAAASLFGRL---LTTDFNANNTTITLMYKQELSSSQADVLEDKRGNVFVEYD----NDTAVVQYGVTPSGIFIDSVYNSIWFRNRIQTDVYNLLYQSP------TKIPQTDAGNALIATGIEAACQAGVNNGYLTLAKGYYVYAPPIALQSQAFQVAAKEAGAIHTVDILVNVN........... 485
3 -5.710PF02744.12; GAL7_KLULA/195-363; Galactose-1-phosphate uridyl transferase, C-terminal domain  ali follow..  14  1.......................................................................................................EFDHFEKYEHQHGAHLLEDYVNLELREKERI-VCEND--------SFLVVVPYWAVWPFETMVLSKRRIPSLNQFTDKEREDLASIIRNLTIRYDNLFETSFPYSMGLHQASLNATEGELKAAWFHMHFYPPLLRS--ATVRKFLVGFELLGQPQRD------LTAEQAADRLKALSGEVHYLAKL................................................................................. 169
4 -5.400PF13442.1; A6W1H2_MARMS/29-105; Cytochrome C oxidase, cbb3-type, subunit III  ali follow..  13  8...............................................................................................................................................................................................TLYNSYCIACHMNGVAGAPKFGNKADWQPRVEKGIDTLLKDAT----NGFKAMPPKGLCFDCSEDELRGAIQY.......................................................................................................... 76
5 -4.920PF04442.9; A6FI93_9GAMM/27-171; Cytochrome c oxidase assembly protein CtaG/Cox11  ali follow..  16  16...............................................................................................................................................................................................................GKDYSRAEAVPMSIIDESRTVKVEFVTYLNKKLPWQFKPEVRSVELH-------------PGERYQVSFVAINQSDQDTFGRAVPSITPGYGAQYLVKTECFC-----------FQEQMLAANEEAMMPLIFYIDPNIPADISTLTLAYT............. 141
6 -4.890PF00531.17; TR10B_MOUSE/273-356; Death domain  ali follow..  13  4.......................................................................................................................................................................................................................................FEYCSDIVPFDSWNRLMRQLGLTDNQIQMVKAETLVTREALYQMLLKWRHQTGRSASINHL.............................................................................. 64
7 -4.280PF03689.10; POL2_CNSV/688-778; Nepovirus coat protein, N-terminal domain  ali follow..  13  11........................................................................................................................................................................................................................................................................................AASTKGNVLAGVDILANARTTMSG----FYMRWLQKGYIDTNLKLICHLPRAPFAGMSFFVLIGTGYLAKDAPTSLNEEEILSY...... 91
8 -4.230PF08032.7; RLMB_HAEIN/4-80; RNA 2`-O ribose methyltransferase substrate binding  ali follow..  4..................................................................................................................................................................................................................................................GIHAVNSILTHSPERLIEVFVLKGREDKRLQPLLNELYSLGIGVQFVNRQTLDKKADGEVHQGVIARVQAA......................................................... 74
9 -4.160PF01698.11; Q6XPU5_IDASC/1-385; Floricaula / Leafy protein  ali follow..  23  225................................................................................................................RQREHPFIVT-GEVARGKKNGLDYLFHLYEQCRE------FLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSG-------ASYINKPKMRHYVHCYAL------CLDENASNALRRS---FKERGENVGSWRQACYKPLVDVAGGDIDAVFNAH--------PRLSIW-------TKLRQL.............................................................................. 375
10 -4.120PF12703.2; B4EEA0_BURCJ/1-74; Toxin of toxin-antitoxin type 1 system  ali follow..  21  4..................................................................................................................................................................................................MHDTEAREVIHHTAMRLAALEFIDRHALSQMAEAVANLFVVV-ETGRATRSDFREAMTAVRQALQ............................................................................................................... 74

FFAS is supported by the NIH grant R01-GM087218-01
5 9 7 8 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.