current user: public




Query: gi|30260199|ref|NP_842576.1| recombination protein F (BA_0004) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYVLAMAKSHRTSNDRELIRWDEDFGQIKGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKLSQYIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQIAPVYLYELSQYQKVLTQRNHLLKKMQGNSKNEETMLDVFTLQLIEHGTKILRKRFEFLHLLQEWAAPIHRGISRGLEELEIVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQVFGSQGQQRTTALSLKLAEIELIYSEVKEYPILLLDDVLSELDDYRQSHLLNTIQGKVQTFVTTTSVDGIEHETLKEAKTIHVTNGTVDCEIDRALast
1 -26.400g1f2t.1 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}  ali 3D-neighbors follow..  19  1MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIH--------------------------------AMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES-------------XAREAALSKIGELASEIFAEFTEGK-------------------------YSEVVVRAEENKVRLFVVWEGKERPLTFL-----------SGGERIALGLAFRLA---MSLYLAGEISLLILDEPTPYLDEERRRKLITIMEKKIPQVILVSHDEELKD....................... 272
2 -23.500d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  2GKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRKVDIKPFAIQGLPMSVQPTQLVTETLNERQRVLPLNELKDKLEAMEGVQFK--QFNSITDYHSLMFDLGIIARRLRSASDRS-KFYRLIEASL---YGGISSAITRSLRDY............................................................................................................................................................................ 217
3 -17.200d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  2.RLVGLELSNFKSYRGVTK-GESNFTSIIGPNGSGKSNMMDAISFVVRSNHLRSNILKDLIYRGVLNAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQ--YKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKSPGLEVLFQGAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHA--SGGEKTVAALALLFAINSY-----QPSPFFVLDEVDAALDIQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSK..... 418
4 -16.900g1xew.1 c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furiosus [TaxId: 2261]}  ali 3D-neighbors follow..  16  2PYIEKLELKGFKSYKKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLSAKAMRASRISDLIFAGSKYAEVAIYFNNEDRGFPIDEDEVVIRRRVYPDGRSSYWLNGRRATRSEI-------DILTAAMISPDGYNIVLQGDITKFIKMSPLERRLLIDDISXVFMR---------------------------------FEAISRNFSEIFAKLSPGGS-----------RLILENPEDPFSGGLEIEAKPAGKDVKRIEAMSG---------------------GEKALTALAFVFAIQKF-----KPAPFYLFDEIDAHLDDKRVADLIKESSKESQFIVIT............................... 285
5 -8.380d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  2IVMQLQDVAESTRLGPLSGEVRAGILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQR--LLDEPMNSLDVAQQSALDKILSALCQQGMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPNLAQA............................................................................................................................................................................ 228
6 -6.090d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  4........................LLAFAAWSGTGKTTLLKKLIPALCARGIRPG----LIKHTHHDMDVDKPGKDSYELRKAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEG......................................................................................................................................................................................................................................................... 104
7 -5.550d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  56................................................................................................................................................................................NLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKF----AEQDNTVLGEGGVTL----SGGQRARISLA---------RAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYF..... 237
8 -5.410d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}  ali model 3D-neighbors follow..  18  127...........................................................................................................................................................................................................................................................................DQLNTEVGERGVKISGGQRQR-----------LAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK---TTLVIAHRLSTIVDADKIYFIEKGQITGSGKH. 221
9 -5.340d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  91.............................................................................................................................................................................................................................................RSIIDNISLANPGMSVEKVIYAAKLAGAHDEGYNTIVGEQGAGLSGGQRQRIAIARAL-----------VNNPKILIFDEATSALDYESEHVIMRNMHKICK---TVIIIAHRLSTVKNADRIIVMEKGKIVEQGKH. 221
10 -4.960d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  18  76..............................................................................................................................................................................................ELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEERFAN----------HKPN--------------SGGQQQRVAIARALA---------NNPPIILADQPTGALDSKTGEKIMQLLEEDGKTVVVVTHDINVARF---GERIIYLKDGEVEREEK.. 228

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.