current user: public




Query: gi|30260214|ref|NP_842591.1| hypothetical protein (BA_0020) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNLPGGMFLast
1 -57.3001ybx_A mol:protein length:143 Conserved hypothetical protein  ali model follow..  56  30.FPGFGGNINNLVKQAQKMQRDMERVQEELKEKTVEASAGGGAVTVVATGRKDIKEITIKPEVVDPDDVEMLQDLILAAVNEALRKADEMVTAEISKITGGLGGIPGLF 137
2 -55.5001pug_A mol:protein length:109 Hypothetical UPF0133 protein ybaB  ali model follow..  38  3....GKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLE-DDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGF. 105
3 -54.4001j8b_A mol:protein length:112 YbaB  ali model follow..  38  5...FGKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLME-DDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGM. 108
4 -50.0003f42_A mol:protein length:99 protein HP0035  ali model follow..  20  1....GHMDFSQLGGLLDGMKKEFSQLEEKNKDTIHTSKSGGGMVSVSFNGLGELVDLQIDDSLLE--DKEAMQIYLMSALNDGYKAVEENRKNLAFNMLGNFA...... 97
5 -7.1903bul_A mol:protein length:579 Methionine synthase  ali model follow..  16  59LFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASKEQCKTNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILRTAKEVNADLIG--LSGLITPSL.. 163
6 -6.7402ewr_A mol:protein length:170 hypothetical protein TM1012  ali model follow..  6............IMIRPEYLRVLRKIYDRLKNEKVNWVVTGSLSFALQGVPVEVHDIDI---QTDEEGAYEIERIFSEFVSKKVRFSSTEKICSH.............. 85
7 -6.5203fpp_A mol:protein length:341 Macrolide-specific efflux protein macA  ali model follow..  11  127.....QAQIGTIDAQIKRNQASLDTAKTNLDYTRIVAPMAGEVTQITTLQGQTVIAAQQAPNILTLADMSAML--VKAQVSEA----------DVIHLKPGQKA..... 213
8 -6.5004dk0_A mol:protein length:369 Putative MacA  ali model follow..  11  128.....KAEMDVVQENIKQAEIEVNTAETNLGYTKITSPIDGTVISTPVSEGQTVNSNQTTPTIIKVADLSKMR--IKPEISEG----------DITKVKAGQDV..... 214
9 -6.4201w4r_A mol:protein length:195 THYMIDINE KINASE  ali model follow..  11  23MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFC--------EAMANAGKTVIVAALD...... 120
10 -6.4203g9g_A mol:protein length:287 Suppressor of yeast profilin deletion  ali model follow..  12  157............WRESKDLHSKLSKNAASIEHYSKNNENSSHLEEARRQWDQQSPYLFELFETIDYNRLDTLKNCMLTSFSDYLLNTTKECETVMTKFLA......... 247

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]