current user: public




Query: gi|30260206|ref|NP_842583.1| seryl-tRNA synthetase (BA_0012) [Bacillus anthracis str. Ames], from B.anthracis

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQISVLKREKKDAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETEDDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALISFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEELEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMGGKTVIKLast
1 -135.0002dq3_A mol:protein length:425 Seryl-tRNA synthetase  ali model follow..  58  1MIDINLIREKPDYVKERLATRDKELSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHT-KKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYVGT..... 419
2 -129.0002dq0_A mol:protein length:455 Seryl-tRNA synthetase  ali model follow..  44  1MLDIKLIRENPELVKNDLIKRGEKVKWVDEILKLDTEWRTKLKEINRLRHERNKIAVEIGKRRKKGEPVDELLAKSREIVKRIGELENEVEELKKKIDYYLWRLPNITHPSVPVGKDENDNVPIRFWGKARVWEWKPKLHVDLLEILGGADFARAAKVSGSRFYYLLNEIVILDLALIRFALDRLI-EKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIYKVEDEDLYLIPTAEHPLAGMHANEILDGKDLPLLYVGVSPCFRKEAGTAGKDTKGIFRVHQFHKVEQFVYSRPEESWEWHEKIIRNAEELFQELEIPYRVVNICTGDLGYVAAKKYDIEAWMPGQGKFREVVSASNCTDWQARRLNIRFRDRTDEKPRYVHTLNSTAIATSRAIVAILENHQEEDGTVRIPKVLWKYTGFKEIVP 445
3 -119.0003err_A mol:protein length:536 fusion protein of microtubule binding domain  ali model follow..  33  98ALLLGESTTDWKQIRSIIMRENFIPTSDAIREKMKKNYMSNPSYNYEIVNRASLAAGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKLEALLLQVPLPPWPGAPVGGEE-ANREIKRVGGPPEFSFPPLDHVALMEKNGWWE-PRISQVSGSRSYALKGDLALYELALLRFAMDFMA-RRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEAEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYR-DPEGRVRYAYTLNNTALATPRILAMLLENHQLQDGRVRVPQALIPYMGK..... 523
4 -118.0001ser_A mol:protein length:421 PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11)  ali model follow..  38  1MVDLKRLRQEPEVFHRAIREKGVAL-DLEALLALDREVQELKKRLQEVQTERNQVAKRVPKAP--PEEKEALIARGKALGEEAKRLEEALREKEARLEALLLQVPLPPWPGAPVGGEE-ANREIKRVGGPPEFSFPPLDHVALMEKNGWWE-PRISQVSGSRSYALKGDLALYELALLRFAMDFMA-RRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLTEAEASDRAFQELLENAEEILRLLELPYRLVEVATGDMGPGKWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDP-EGRVRYAYTLNNTALATPRILAMLLENHQLQDGRVRVPQALIPYMGK..... 414
5 -116.0003qne_A mol:protein length:485 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  34  1MLDINAFLVDPEIIKASQKKRGDSVELVDEIIAEYKEWVKLRFDLDEHNKKLNSVQKEIGKRFKAKEDAKDLIAEKEKLSNEKKEIIEKEAEADKNLRSKINQVGNIVHESVVDSQDEENNELVRTWTPENTGAPAKLSHHEVLLRLDGYDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSFLS-SKGYVPLQAPVMMNKEVMAKTAQLSQFDEELYKVGEDEKYLIATSEQPISAYHAGEWFESEQLPVRYAGYSSCFRREAGSHGKDAWGIFRVHAFEKIEQFVLTEPEKSWEEFDRMIGCSEEFYQSLGLPYRVVGIVSGELNNAAAKKYDLEAWFPFQQEYKELVSCSNCTDYQSRNLEIRCKQQNQQEKKYVHCLNSTLSATERTICCILENYQKEDGLV-IPEVLRKYIPGEPEF. 441
6 -113.0001wle_A mol:protein length:501 Seryl-tRNA synthetase  ali model follow..  31  34LLDMESLCAYPEDAARALDLRKGELRDLPGIISTWQELRQLREQIRSLEEEKEAVTEAVRALVVNDPQYQSLRARGREIRKQLTLLYPKEAQLEEQFYLRALRLPNQTHPDVPVG-DESQARVLHVVGDKPAFSFQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTLNKLI-HRGFTPMTVPDLLRGVVFEGCGMTPNAKPSIYNIDPEDLNLAGTAEVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDT-GKEPWGLYRVHHFTKVEMFGVTGPEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTE-AGELQFAHTVNATGCAVPRLLIALLESYQQKDGSVLVPPALQPYLGTDRITT 469
7 -112.0003lsq_A mol:protein length:484 Seryl-tRNA synthetase  ali model follow..  35  7VLDIQLFRDETNIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEAVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEEGNTVVRTFGNTT--KRAKLNHVSIMERLGMMDTSKATSMAGGRSYVLKGGLVQLQVALVSYSLDFLV-KRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRDTLGIFRVHQFDKIEQFVVCSPEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGTAAQNVKEYCHMLNGTLCAITRTMCCICENYQTEEG-VVIPDVLRPYMMGIEMIR 468
8 -108.0003vbb_A mol:protein length:522 Seryl-tRNA synthetase, cytoplasmic  ali model follow..  34  2VLDLDLFRVDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDDNKVERIWGDCTV--RKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLG-SRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKDKVEFVHMLNATMCATTRTICAILENYQTEKG-ITVPEKLKEFMPPGL... 464
9 -49.6003w3s_A mol:protein length:527 Type-2 serine--tRNA ligase  ali model follow..  17  60TIYMEITGTRYLRPHEAAMRVRKR---LAERLGRKHRVGVRDLKIPRYEVVLRFDREVTYDYVGYVPVADDVVVEDGTVRLTFQDVDEEMLR-----RHVIDRVIRLVAWAVEERSELVERVTKVEPGTVVDESGPRRIRFRGDVTEEARRRGWVKEFPGRGQWIYTPPMAALFEVLRDFLLERVTRKLGFEPALFPKLIPLETMFRMRYLHGLPDGMYKLRDPGYVLAPAQCEPFYELLRDEVVDPERLPIKYDCSGWTYRWEGGA----AKGLERVNEFQRIEHVWIAEPEEAYRIRRELLEATKRVAEELELEWKVVVLEDRDIELPDVPSYEFEVYLPFKGERSSEEAWISVGSFNVHGEHFVDGFNVKEKSGRTLFTGCAGLGVTRWVVGLLAQHYPYEWPEPILERIDEKFGGLPEVP 520
10 -34.9004h2w_A mol:protein length:346 Amino acid--[acyl-carrier-protein] ligase 1  ali model follow..  17  1.................................................................................................................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS--HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGSLSPADLVLSPAACYPVYPIAASRGPLPKG-GLRFDVAADCFRREPS------KHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRDQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANG-----EPAHT-GCVAFGMDRLAVAMFHTHGTDLSA---PAKVRDILGLQPHVA 331
11 -34.0003mey_A mol:protein length:346 Bll0957 protein  ali model follow..  16  1.................................................................................................................MGSSSSGLVPRGSHMNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS--HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGSLSPADLVLSPAACYPVYPIAASRGPLPKG-GLRFDVAADCFRREPS------KHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANG-----EPAHT-GCVAFGMDRLAVAMFHTHGTDLSA---PAKVRDILGLQPHVA 331
12 -15.6002cim_A mol:protein length:522 SERYL-TRNA SYNTHETASE  ali model follow..  14  86............................DAIFRLRKQLAEALGKKYKIGIRGIEVESFIIKVPADHELRMLKVPYIKSMENQLELEVGEAEMKNRVPDRILTLLEEKIEAAQYGAKAEHWNLLWQREPMEHPFKEDPTQ--------AMMKEGWLKRGSSRGQWIHGPQSARIFRTFEKIVLEELLEPLGYREMIFPKLVTWEVWMKSGHAKGVYPEIYKIAEPIGGMCYAQCPPFWMYVAGETLPNEEIPVKFDRSGTSHRYESGG----IHGIERVDEFHRIEIVWIGTKEEVLKCAEELHDRYMHIFDILDIEWRKARVTPWFMAENTVGTTDYEACLPPDGEWLEFQNVSINGDKYPKGFNVKLQSGDELWSGCS------GVGLERWAAVFLAQKGLDPAN---PEEFRNRVGEMP... 510
13 -13.7001nyq_A mol:protein length:645 threonyl-tRNA synthetase 1  ali model follow..  17  117............................DDFEQIEKTMKQIVNENMKIERKVVSRDEAKELFSNDEYKLE-LIDAIPE--------DENVTLYSQGDFTDLCRGVHVPSTA-AYWRGDSNNKMLQRFFDKKELK-KERDHRKIGKELELFTNS---QLVGAGLPLWLPNGATIRREIERYIVDKE-VSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFLDETESMVLRPMNCPHHMMIYANKPHSYRELPIRIAELGTMHRYEASGA---VSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGFEDYSFRLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSDVQVKRFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEETKGA-----FPTWLAP......... 545
14 -13.7002i4l_A mol:protein length:458 Proline-tRNA ligase  ali model follow..  17  27......................................................................................................................................................ENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLVREEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIAKRELLYGPTNEEMITEIFRAYIKSYKSLPLNLYHIQWKFRDEQ----RPRFGVMRGREFLMKDAYSFVDEAGARKSYNKMFVAYLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVY-EVGQIFYFGTKYSDSMKANVTGPDGTDAPIH--GGSYGVGVSRLLGAIIEACHDDNG-IIWPEAVAPFRVTILNLK 368
15 -13.1004p3n_A mol:protein length:415 Threonine--tRNA ligase, cytoplasmic  ali model follow..  21  3.....................................................................................................................................SSSSGDHRKIGRDQELYFFHELS--PGSCFFLPKG--AYIYNALIEFIRSEY-RKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGA---LTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQKIDIQIKDAIGRYHQCATIQDFQLIRFNLTYVSHDGDRPVIVHAILGS---VERMIAILTENYGGK-----WPFWLSP......... 304
16 -13.0004hwt_A mol:protein length:413 Threonine--tRNA ligase, cytoplasmic  ali model follow..  22  3.........................................................................................................................................RDHRKIGRDQELYFFHELS--PGSCFFLPKG--AYIYNALIEFIRSEY-RKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGA---LTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQKIDIQIKDAIGRYHQCATIQDFQLIRFNLTYVSHDGDRPVIVHAILGS---VERMIAILTENYGGK-----WPFWLSP......... 300
17 -13.0003ugq_A mol:protein length:460 Threonyl-tRNA synthetase, mitochondrial  ali model follow..  20  3....................................................................................................................SSSSGLVPRGSHKNASSATPATMTSMVSQRQDLFMTDPLS--PGSMFFLPNG--AKIFNKLIEFMKLQQKFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFDEEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGA---LSGLTRLRKFSNYFINFSTRPDHFIGDLKVWNHAEQVLKEILEESGKPWKLNPGDGAF-----YGPKLDIMVTDHLRKTHQVATIQDFQPERFDLKFKDQDNSYPIMIHATFGS---IERFMALLIDSNEGR-----WPFWLNP......... 339
18 -11.8002j3l_A mol:protein length:572 PROLYL-TRNA SYNTHETASE  ali model follow..  17  13......................................................................................................................................................EVPNDAEVLSHQILLRAGYIRQVAAGIYSYLMREEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKDRDYILGPTHEETFTELIRDEINSYKRLPLNLYQIQTKYRDEK----RSRSGLLRGREFIMKDGYSFHADEASLDQYRDYEKAYSRIFERCGLEFRAIIGDGGAMGGKDSKEFMA------SEIGEDTICYSTESDYAANLEMATSLYTPKKSHETQLDLEKIATPEVGTIAEVAN.......................... 268
19 -11.6003a31_A mol:protein length:471 Probable threonyl-tRNA synthetase 1  ali model follow..  13  18.....................................................................................................................................ITVKPDSRVPVFNREFATFT------GAGVPLFSLGGGPIRYALAEVLAKFHA-RRGYYVVETPIIASTELFKVSGHIEFYRNNMYDIEGHEFAVKPPYHILLFLNEVAKHRSKLPLPFKVFEFGRVHRYEPSGS---IYGLLRVRGFTQDDAHIIVPGGRVIDVVYDVFEEMKLVLERLF-----------KLGVSS-ETFKVRLSMSDKSLIGK-EFMGSKEEWEGAEEALREAASRINEKYGIDIVELEG-GVSKEWQM-LYDVVREEFGIEEVYIIRALLGSIERF. 320
20 -11.5004hwo_A mol:protein length:411 Threonine--tRNA ligase  ali model follow..  19  3.........................................................................................................................................RDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELEVFVRSKL-KEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS---LHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLST-----PEKRIGSDEMWDRAEADLAVALEENNIPDFSPSRLSASYVGEDNERPVMIHAILGS---MERFIGILTEEFAGF-----FPTWLAPVQVVIMNI. 308
21 -11.5001qf6_A mol:protein length:642 THREONYL-TRNA SYNTHETASE  ali model follow..  17  115............................EDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGES------KVSILDENIAHDDKPGLYFHEEYVDMCRG-PHVPNMRFAYWRGDSNNKMLQRWADKKALN-AKRDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELEVFVRSKL-KEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGS---LHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGFEKIVVKLST-----PEKRIGSDEMWDRAEADLAVALEENNIPAWQCGTVQLDFEDNERKVPVMIHAILGS---MERFIGILTEEFAGF-----FPTWLAPVQVVIMNI. 547
22 -11.2001nj8_A mol:protein length:459 Proline-tRNA Synthetase  ali model follow..  20  11...........................................................................................................................................YSDILEKAEIYDVRYPIK-----CGVYLPYGFKIRRYTFE-IIRNLLDESGHDEALFPMLIPEDLLAKEAEIKGFEDEVYWVTDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYET----KHTRPLIRLREIMTFK-TAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPD-GRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISD---RVIASIIAIHGDEKGLILPPIV............ 280
23 -9.9903ial_A mol:protein length:518 Prolyl-tRNA synthetase  ali model follow..  16  22...........................................................................................................................................FDAIMDAAELVDRRYPVK-----CVVFRPYGFFMENAIMR-LCEEEYAKVGISQILFPTVIPESFLKKESDIKGFEAECFWVEEERLALRPTSETAIYSMFSKWVRSYKDLPLKIHQTCTIFRHET----KNTKPLIRVREINEAHCCHATAEDAVSQLSDYWKVIDTIFSDELCFKGQKLRRVCWDRFPGADYSEVSDVVMPC-GRVLQTAGIHNLGQRFSSTFDILYANKANESVHPYLTCAGIST---RVLACALSIHGDSGGLVLPPLI............ 291
24 -9.9101nj1_A mol:protein length:501 Proline-tRNA Synthetase  ali model follow..  18  38...........................................................................................................................................FHNILEEAEIIDQRYPVK-----MHVWMPHGFMIRKNTLKIL---RILDRDHEEVLFPLLVPEDELAKEAIVKGFEDEVYWVTQRKLALRPTSETVMYPMFALWVRSHTDLPMRFYQVVNTFRYET----KHTRPLIRVREI-KEAHTIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGSEYTVAFDTLMPD-GKTLQIGTVHNLGQTFARTFEIKFETPEGDHEYVHQTCYGLSD---RVIASVIAIHGDESGLCLPPDV............ 306
25 -9.8702zni_A mol:protein length:308 Pyrrolysyl-tRNA synthetase  ali model follow..  14  52.....................................................................................................................................DALSRDRAFQGIEHQLMSQGKRH-LEQLRTVKHRPALLELEEKLAKAL-----HQQGFVQVVTPTIITKSALA-TIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWR-ELERLWDKPIRIFEIGTCYRKESQGAQ-------HLNEFTMLNLTELGTPLE--ERHQRLEDMARWVLEAAGIR-------------------EFELVTESSVVYGDTV------DVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSL--YLDGVRL.. 299
26 -9.1404cs2_A mol:protein length:274 PYRROLYSINE--TRNA LIGASE  ali model follow..  14  58..........................................................................................................................................................................GKLEREITRFFVD-----RGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLANYLRKLDRALPDPIKIFEIGPCYRKESDGKE-------HLEEFTMLNFCQM----GSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFG------------LDVMHGDLELSS------------AVVGPIPLDREWGIDKPWIGAGFGLERLLKV-FKNIKRAARSESYYNGIS.......... 265

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.