current user: public

anford Burnham Prebys Medical Discovery Institute

Query: 3fbs_A mol:protein length:297 Oxidoreductase, from PDB0516

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
1 -17.900d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  1.AYDVLIVGSGPAGAAAAIYSARKGIRTGLMGERFGGQILTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAV--QIETASGAVLKARSIIVATGA-KXLPNIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKT.................................................................................................................................... 184
2 -17.100d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}  ali model 3D-neighbors follow..  15  42.EYDAIFIGGGAAGRFGSAYLRAMGGRQLIVDR-------WPFLGGSCPHNACVPHHLFSDCAAELSGQYWFPDMTEKVVGIKEVVDLFRAGRNGPHGIMNFQSKEQLNLEYIL---------------------------------------------------------------NCPAKVIDNHTVEAAGKVFKA----KNLILAVGAGPGTLDVPXEQPRSAEL--AKILGLDLGPK---GEVLVNEYLQTSVPNVYAVGDLIGGPMEMFKARKSGCYAARNV.......... 254
3 -15.400d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Chromatium vinosum [TaxId: 1049]}  ali model 3D-neighbors follow..  17  2.GRKVVVVGGGTGGATAAKYIKLADPEVTLIE---PNTDYYTCYLSNEVIGGDRKLESIKHGYDGLRAH-GIQVVHDSATGIDPDKK--LVKTAGGAEFGYDRCVVAPGIELIYDKIEXQRAGKIAQIAGLTNDAGW................................................................................................................................................................ 133
4 -15.300d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  3.DFDLIIIGGGSGGLAAAKEAAKFDKKVMVLDFVTPTPLGTNWG-GTCVNVGCIPKKL---------------------------------------------MHQAALLGQALKDSRNY---------------GWKLEDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMATNNK-EKVYSAERFLIATGERPRYLGIXRDSCTRTIGL------VGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTVAIQAGRLLAQRL.......... 227
6 -14.500d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  15  2.AYQVLIVGAGFSGAETAFWLAQKGVRVGLLTQSPPKPPFPPGSLLERAYDPKDERAFHARAKYLLEGLRPLHLFQATATGLLLEGNRVVVRTWEGPPARGEKVVLAVGLLEDLSRLGFRFVEREGEVPETPSTPGYRVRYLAFHPEEWEEKTFRLKRLEGLYAVGLCVREGDYARMSEEGKRLAEHLL............................................................................................................ 227
7 -14.300d1xhca1 c.3.1.5 (A:2-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  17  1..............................................................................................................................................KVVIVGNGPGGFELAKQLSQTYEVTVIDKEPNRLFPYSLDWYRKRGIEILAEEAKLIDRGRKVVITEKGEVPYDTLVLATGAXPNVDLARRSGIHTGRG-----ILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILKGE... 167
9 -12.900d3dk9a1 c.3.1.5 (A:17-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  3ASYDYLVIGGGSGGLASARRAAELGARAAVVESHK----------GTCVNVGCVPKKV---------------------------------------------MWNTAVHSEFMHDHADY---------------GFPSCEGKF-----------------NWRVIKEKRDAYVSLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTP-LNKLGIQTDDK---GHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAG................. 206
10 -12.600d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  16  3....VIVLGSSHGGYEAVEELLNLHPEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVVSGEERVENYDKLIISPGAVPFELDXGVRPN............................................................................................................................................................................... 125
11 -12.500d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  8....LLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTE----PNDLTGPLLMERMHEHATKF-ETEIIFDHINKVDLQNRPFRLNGDNGE-YTCDALIIATGASARYXHSPNTAIFEGQGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDG....................................................................................................................................... 190
12 -12.400d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  20  2..TRIVILGGGPAGYEAALTSHPETTQVTVIDC--------DGIGGAAVLDDCVP---------------------------------------------SKTFIASTGLRTELRRAPHLG-------------------------IDFDDAKISLPQIHARVKTLA------AAQSADITAQLLSMGVQVIAGRGELIDSTPGATAADGSTSEHEADVVLVATGASPRILPSXGSVPNTSGLGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHA.......... 225
16 -11.900d2gqwa1 c.3.1.5 (A:6-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}  ali model 3D-neighbors follow..  17  1LKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRP-----SKDFMAHGDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAH-TVALSDGRTLPYGTLVLATGAAPRAXVLANLARAAGLACDDGIFVDA-YGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAVARHLVD................................................................................................................ 182
17 -11.800d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  19  5...NVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDAPHHLPPLSKAYLA--GKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQ-QVILSDGRALDYDRLVLATGGRPXLIPNCELASAAGLQVDN-------HMQTSDPLIMAVGDCARFHSQLYDRWVRIESVPNALEQARKIAAILCGK............................................................................................................... 186
18 -11.800d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  22  5...................................................................................................................NVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKILNAQTTEVKGDGGLEYRD-HNIELAGIFV............................................................................. 122
19 -11.500d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  20  4IQTTLLIIGGGPGGYVAAIRAGQLGIPTVLVEGQA----------GTCLNIGCIPSKALIHVAEQFHQASRFTEPSPLGISVASPRLDIGQSVAWKDGIVDR---LTTGVA-------------------------------------------------------ALLKKHGVKVVHGWAKVLDGKQVEVDGQRIQC----EHLLLATGSS---SVELPXRRPRTKGFNLECLDLKMNGA----AIAIDERCQTSMHNVWAIGDVAGEPMLAHRAMAQGEMVAEII.......... 213
20 -11.500d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  40....ITIIGGGFLGSELACALGRKAREVIQLFPEKG--------------GKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGL........................................................................................................................................................................................... 137
21 -11.500d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}  ali model 3D-neighbors follow..  16  3IKYDVVIVGSGPIGCTYARELVGAGYKVAMFDIGEIDSGLKIGAH------------KKNTVEYQKNIDKFVNVIQGQLMSVSVPVNTLVVDTLSPTSWQASTFFVRNGSNPEQDPVGGMSTHWT............................................................................................................................................................................ 127
22 -11.200d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}  ali model 3D-neighbors follow..  15  3.HFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGS-HHG--------DTRIIRHAYGEGREYVPLALRSQELWYELEKETHHKIFTKTGVLVFGPEAAKEHSLTVDLLEGDEINKRW-----------GITVPENYNAIFEPNSGVLFSENCIRAYRELAE-ARGAKVLTHTRVEDFDISPDSVKIETANGSYTADKLIVSMGA...................................................................................... 203
24 -10.800d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  6...PFLLIGGGTAAFAAARSIRAR--RVLIVDPELPYMRPPLSKELWFSDDPQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDN-MVKLNDGSQITYEKCLIATGGT.......................................................................................................................................................................................... 136
25 -10.800d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}  ali model 3D-neighbors follow..  13  4.HYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGMLGAHAEERDAFFDFAMHSQRLYKGLGEELYALSGVDHNGGMFKLAFSEEDVLQLRQWYSKEEVLEKEPYASG------FGASFIQ--DDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWANHVVVASG....................................................................................................... 203
26 -10.300d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  22  3QYSENIIIGAGAAGLFCAAQLAKLGKSVTVFDNGKKIGRKILMSGG-FTNLEVTPAHYLSQVKSALARYTNWDFISSEVSQVERIQNDFVLQVNST-QWQCKNLIVATG---SMPGLGAIAEQFGIPVI........................................................................................................................................................................ 190
28 -10.200d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}  ali model 3D-neighbors follow..  17  7.EVDVLVVGAGFSGLYALYRLRELGRSVHVIETAGPGARCDIESIEYVLQEWNWTERYA--SQPEILRYSGITFTTVTAAAFDEATNTWTVDTNHGDRIRARYLIMASGQXDALTGALFLKEKWGLSTAGFP---------NLFFIAGPGSPSALSNMLVSIEQHVEWVTDHIAYMFKNGLTRSEAV.............................................................................................................. 232
29 -10.100d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  19  1.........................................................................................................................................EAYSAKIALLGAGPASISCASFLARLGDITIFEK-PYDVVNFEIELMKDLGVKIICGKSLSENEITLNTLKEEGYKAAFIGIGLPEXVLRDPKVKEALSPIKFNRWDLPEVDPETMQTSEPWVFAGGDIVGMANTTVESVNDGKQASWYIHKYIQAQ... 175
30 -10.000d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  3....................................................................................................................LPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKMDKVENGNIILHNRTLEEVTGDQGVRLRD-ESLDVAGLFVA............................................................................ 124
31 -9.820d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}  ali model 3D-neighbors follow..  19  5AEYDVVVLGGGPGGYSAAFAAADEGLKVAIVE-------RYKTLGGVCLNVGCIP---------------------------------------------SKALLHNAAVIDEVRHLAA---------------NGIKYPEPELDI-----------DMLRAYKDGVV-----SRLTGGLAGMAKSRKVDVIQGDGQFLDPHHEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRXAPNG--GFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENC.......... 222
32 -9.560d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}  ali model 3D-neighbors follow..  17  7....IAVVGGSISGLTAALMLRDAGVDVDVYERGVELDSISVPSSSMEYVDALTGERVGSVPADWRFTSPERYHTSKCLVGLSQDSETVQMRFSDGTKAEANWVIGADGGASVV....................................................................................................................................................................................... 154
34 -9.560d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  24  34...EAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAM----------FLGLD----EELSNMIKDMLEETGVKFFLNSELLEANEEG-----VLTNSGFIEGKVKICAIGIV.......................................................................................................................................................................................... 122
35 -9.330d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  11  2...............TDGLAGFPRYKVANIQQVQQQIKSSGCAVYFFAYPLTDEPCFLVDLQALTGQQITEIPNPYYGKYAGPLGQIQTIKGVGPNGTIFAFSDVCVLPAQVIVSSESDPGLYAKGADLHCP-CHGYALKDGGVVVSGPAPRPLPIVILDYDSSTGDIYAVGTNAPYFSAGIPRTTPQDNLLYDPRYSYSVPNNPSCSNG....................................................................................... 202

FFAS is supported by the NIH grant R01-GM087218-01
9 4 2 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.