current user: public




3fbsA
Query: 3fbs_A mol:protein length:297 Oxidoreductase, from PDB1009

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MKFDVIIIGGSYAGLSAALQLGRARKNILLVDAGERRNRFASHSHGFLGQDGKAPGEIIAEARRQIERYPTIHWVEGRVTDAKGSFGEFIVEIDGGRRETAGRLILAMGVTDELPEIAGLRERWGSAVFHCPYCHGYELDQGKIGVIAASPMAIHHALMLPDWGETTFFTNGIVEPDADQHALLAARGVRVETTRIREIAGHADVVLADGRSIALAGLFTQPKLRITVDWIEKLGCAVEEGPMGSTIVTDPMKQTTARGIFACGDVARPAGSVALAVGDGAMAGAAAHRSILFPEMRLast
1 -38.500d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  5.HSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTEVENWPGDNDLTGPLLMERMHEHATKFE-TEIIFDHINKVDLQNRPFRLNGDNGE-YTCDALIIATGASARYXHSPNTAIFEGQYIKVQSGIHGNATQ------------------------------------------------------------------------------------------------------------------TSIPGVFAAGDVMDHYRQAITSAGTGCMAALDAERYLDG.... 190
2 -37.300d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  2..YDVLIVGSGPAGAAAAIYSARKGIRTGLMGERFGGQILTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVISASKLIPAAVEGGLHQIETASGAVLKARSIIVATGARMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA................................................................................................................................... 185
3 -34.500d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  25  2................................................................................................................RNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQDKLRSLKNVDILNAQTTEVKGDGDRVSGDIHNIELAGIFVQIGL......................................................................... 126
4 -31.900d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  1..................................................................................................................LGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKMDKVENGNIILTNRTLEEVTGDQMGVTGNIESLDVAGLFVAIG.......................................................................... 126
5 -30.400d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  22  2..................................................................................................................LSFVGSGEFWNRGISACAVCDGAIFRNKPLAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFRASQQRALSNPKIDVWNSSVVEAYGDGNVVTGDVSDLKVSGLFFAI........................................................................... 130
6 -19.700d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  17  1.............................................................................................................................................SKVVIVGNGPGGFELAKQLSQTYEVTVIDKEPNRLFPYSLDWYRKRGIEIRAEEAKLIDRGRKVVITEKGEVPYDTLVLATGAXPNVDLARRSGIHTGRG-----ILIDDNFRTSAKDVYAIGDCAEYSGIIAGTAKAAMEQARVLADILK..... 166
7 -19.600d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}  ali model 3D-neighbors follow..  16  41REYDAIFIGGGAAGRFGSAYLRAMGGRQLIVDRWPFLGGSCPHNACVPHHLFSDCAAELMLARTFSGQYWFPDMTEKVVGIKEVVDLFRAGRNGAGKVFKAKNLILAVGAGPGTLDVP-----------------------------------------------------------XEQPRSAELAKI----------------------------------------------LGLDLGPKG-EVLVNEYLQTSVPNVYAVGDLIGGPMEMFKARKSGCYAARNV.......... 254
8 -19.000d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  17  2..TRIVILGGGPAGYEAALVAATSHPETTQVT--------------------------------DCDGIGGAAVLDDCV---------------------SKTFIASTGLRTEL---------------------------RRAPHLGFHIDFDDAKISLPQIHARVKTL--AAAQSADITAQLLSMGVQVIAGRGELIDSTPGLA-GSTSEHEADVVLVATGASPRI--LERVGIQLGRG---NYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHA.......... 225
9 -18.300d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}  ali model 3D-neighbors follow..  13  3.AYDLVVIGAGSGGLEAGWNAASLHKKRVAV-------------------------------------------------------------IDLQKHHGPPHYAALGGTCVNVGCVPKKLMVTGANYMDTIR-------------LDRESVRPNWKALIAAKNKAVSGINDEGMFADTEGLTFHQGFGALQDNHTVLVRESADPNSAVLETLDTEYILLATGSWPQHSQTLQLEKAGVEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTV.......... 232
10 -17.300d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  23  1MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRLYSAFSIFNNEDSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKVILQTGEVLETNHVVIAVG............................................................................................................................................................................................ 164
11 -17.000d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  16  1..MKVIVLGSSHGGYEAVEELLNLHPEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKSGEERVENYDKLIISPGAVPFELDX-----------------------------------------------------------GVRPNTAWLKGTLELHPN--------------------------------------------------GLIKTDEYMRTSEPDVFAVGDATLIKYNPANARKQGRFAVKNL.......... 191
12 -16.800d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  5.SHDVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTCLNVGCIPSKALLNNSHLFHQMHTEAQKRG--------------------IDVNGDIKINVANFQ-----------------------------------KAKDDAVKQLTGGIELLF-----KNKVTYYKGNGSFEDETKIRVTPVDGLEGTVKEDHILDVKNIIVATGS----EVTPFXVGRRPYIAGLGAEKIGLEVDKRG-RLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEGIAAVEMLKTGHGHVN.. 234
13 -16.400d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]}  ali model 3D-neighbors follow..  16  4...KVVVVGGGTGGATAAKYIKLASIEVTLIE---PNTDYYTCYLSNEVIGGDRKLESIKHGYDGLRAHG-IQVVHDSATGIDPDKK--LVKTAGGAEFGYDRCVVAPGIELIYDKIEXQRAGKIAQIAGLTNDAGWSSIHKGIHVIGDGYSANSQGKVAAA....................................................................................................................................... 177
14 -16.100d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  3.DFDLIIIGGGSGGLAAAKEAAKFDKKVMVLDFVTP--------------------------------------------------------TPLGTNWGLGGTCVNVGC------IPKKLMHQAALLGQAL-------DSRNYGWKLEDTVKHDWEKMTESVQNHI------GSLNWGYRVALREKKVVYENA-YGKFIGPHKIMAGKEKVYSAERFLIATGERPRTRTIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTVAIQAGRLLA............. 224
15 -16.000d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}  ali model 3D-neighbors follow..  18  4.............................................................................................................................................APVVVLGAGLASVSFVAELRQAGYQGLITVAHGDAEKIRLDCKRAPEVEWLGVTAQSFDPQAHVALSDGRTLPYGTLVLATGAAPRAXVLANDALARAAGACDDGIFVDAYGRTTCPDVYALGDVTRRIETWSNAQNQGIAVARHL.......... 181
16 -15.900d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  18  1.........................................................................................................................................EAYSAKIALLGAGPASISCASFLARLGSDITIFEKQEYVGGLSTSEIPQFRLDVVNFEIELMKSENEITLNTLKEEGYKAAFIGIGLPEXVLRVKEALSPIKFNRWDLPEVDPETMQTSEPWVFAGGDIVGMANTTVESVNDGKQASWYIHKYIQAQY.. 176
17 -15.900d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  15  2.AYQVLIVGAGFSGAETAFWLAQKGVRVGLLTPFPPGSLLERAYDP----KDERVWAFHARAKYLLEGLRPLHLFQATATGLLLEGNRVVVRTWEGPPARGEKVVLAVGS........................................................................................................................................................................................... 122
18 -15.700d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}  ali model 3D-neighbors follow..  16  5AEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKDGVVSRLTGGGMAKSRKVDVIQGD-------------------------GQFLDPHHLEVSLTAGDAYEQA-----------------------------------------------APTGEKKIVAFKNCIIAAGSRXAPGKLISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAA............. 219
19 -15.600d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  17  4IQTTLLIIGGGPGGYVAAIRAGQLGIPTVLVEGQALGGTCLN--------------------------------------------------------IPSKALIHVAEQFHQASRFTEPSPL-----------------------ISVASPRLDIGQSVAWKDGIV------DRLTTGVAALLKKHGVKVVHGW-AKVLDGKQVEV-DGQRIQCEHLLLATGSSSVELPXRRPRTKGFNLECLDLIAIDERCQTSMHNVWAIGDVAGEPMLAHRAMAQGEMVA............. 210
20 -15.500d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}  ali model 3D-neighbors follow..  15  7.EVDVLVVGAGFSGLYALYRLRELGRSVHVIETAGDVGG-VWYWNRYPGAR-ASQPEILRYINFVADKFDLRSGIHTTVTAAAEATNTWTVDTNHGDRIRARYLIMASGSXDALTGALFKIDIRGVGVALKEKWAAGPRTYLGLSTAGFPNLFFIAGPGSPSALSNMLVSIEQH........................................................................................................................... 210
21 -15.400d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  2.HYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGG-----------------------------------------------------------------TCVNVGC------VPKKVMWHAAQIREAIHMYGPDY-------FDTTINKFNWETLIASRTAYI------DRIHTSYENVLGKNNVDVIKGFARFV--DAKTLEVNGETITADHILIATGGRPSHPXREPANDNINLEAAGGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAGRRLSE............ 206
22 -15.100d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  22  4.YSENIIIGAGAAGLFCAAQLAKLGKSVTVFDNGKKIGRVKSALARYTNWDDEGAEQIVEMLKSECDKYGAKILLRSEVSQVERIQNDEKVRFVNSTQWQCKNLIVATG............................................................................................................................................................................................ 165
23 -15.000d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}  ali model 3D-neighbors follow..  13  51...SVLIVGAGPSGSEAARVLMESGYTVHLTDTAEKIGGHLNQVAALPGLGEWS--YHRDYRETQITKLLKKNKESQLALGQK------PMTADDVLQYGADKVIIATGAXSECTLWNELKARESEWAEN---------AEAPRLIADATFTGHRVAREIEEANPQIAIPYKRETIAWGTPHM.................................................................................................................. 223
24 -15.000d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  20  5...NVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDA-PHHLPPLSKAYLAGKATAESLYLRTPDAYAAQNIQLLGGTQVTAINRDRQ--QVILSDGRALDYDRLVLATGGRPXLI--------------------------------------------------------------------------------------------------------------PNCELASAAGLQVDNG-----IVINEHMQTSDPLIMAVGDCARRIESVPNALEQARKIAAIL.......... 183
25 -13.800d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  16  3...QICVVGSGPAGFYTAQHLLKSRAHVDIYEKQLVPFGLVR---------GVAPDHPEVK-----------NVINTFTQTARSDRCAFYGNVEVGRDVTVHAVVLSYGAEDKSRPIDPSVPF--LGVVP-LYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVS........................................................................................................ 194
26 -13.700d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  45...NLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIPGKEEFY--ETLRYYRRMIEVTGVTLKLNHTV--------------TADQLQAFDETILASGIXNRALAQPLID------------------SGKTVHLIGGCDVAMELDARRA........................................................................................................................................ 169
27 -13.600d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  11  31EEADVVIVGAGPAGLSAATRLKQLDLRVCLVEKAAHIGAVTEDRFGILTEKYVRLGHLVSWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCE------------QXGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGTLAAESIFNQLTSENL------------------------QSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCILGVYGGMIYTGIFYMEPWTLKHKGSDSDQLKPAKDCT.. 369
28 -13.600d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  6...PFLLIGGGTAAFAAARSIRARDPRVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTAQDLPHIENGGVAVLTGKKVVQLDVRDN--MVKLNDGSQITYEKCLIATGGTXE----PNVELAKTGGLEIDSDFGGFRVNQARSNIWVAGDAACFYDIKLGR....................................................................................................................................... 186
29 -13.400d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  13  2.PYYIAIVGSGPSAFFAAASLLKADMAVDMLEMLPTPWGLVR----SGVAPDHPKIKSISKQFEKTAEDPRFRFFGNVVVGEHVQPGELSERYD--------AVIYAVGAQXRGVPTPGLPFDDQSGTI--EYVVGWIKRGPTGVIGTNKKDAQDTVTLIKNLGNAKEGAECKSFPEDHADQVAD-QVIDAFERAAGEPHGRPRVKLASLAEL.................................................................................... 234
30 -13.300d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}  ali model 3D-neighbors follow..  30  3.HFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDFEPNSGLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPDSVKIETANGS-YTADKLIVSMGA........................................................................................................................................................................................... 203
31 -13.000d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  39...SITIIGGGFLGSELACALGRKAREVIQLFPEKG-------------MGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGL........................................................................................................................................................................................... 137
32 -12.800d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}  ali model 3D-neighbors follow..  17  4.HYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGGLGEELYALSGVDHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGD-VWANHVVVASGV........................................................................................................................................................................................... 204
33 -12.600d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  20  37...RLVVIGGGYIGLEVAATAIKANMHVTLLDTAAR-------------LERVTAPPVSAFYEHLHREAGVDIRTGTQVCGFEMSTDQ-AVLCEDGTRLPADLVIAGIG............................................................................................................................................................................................ 133
34 -12.500d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}  ali model 3D-neighbors follow..  12  6...KIAIIGAGPSGLVTAKALLAEKAQVTLFERRGSPGNTPIELMGYCDQS-PHRHTIQEYQRIYAQPLLPFIKLATDVLDIEKKDGSWVVTYKGTKKDIFDAVSICNGEVPYXTGYLYSVPFPSLAKL---YQHIFYIPDPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPSKEEQL.................................................................................................................. 262
35 -12.100d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}  ali model 3D-neighbors follow..  17  1.................................................................................................................IPNIKGLDEY-GSVLHSSLFREPELFVGESVLVVGGASSANDLVRHLTPVAKHPIYQSLLGGGDIQNESLQQVPEITKFDPTTREIYLKGGKVLSNIDRV.................................................................................... 104
36 -12.100d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  17  20VETDILIIGGGFSGCGAAYEAAYGGLKVTLVEKAAVERS------GAVAQGLSAINTYIDLTGRSERQNTLEDYVRYVTLDMMGLAREDLVADYARHVDGTVHLFEKWG-------LPIWKTPDGKYVREGQWQIMIHGESYKPIIAEAAKMAVGEENIYERVFIFELLKD-----NNDPNAVAGAVGFSVREPKFYVFKAKAVILATGGGEAAGRTWYAIFDTGSGYYMGLKAGAMLTQEEYAKLFPLKYNRMTTVKGLFAIGDCAGANPHSSGSFTEGRIAAKAAVRFILEQKPN 328
37 -12.000d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  20  34...EAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAMFLGL--------------DEELSNMIKDMLEETGVKFFLNSELLEANEEG-----VLTNSGFIEGKVKICAIGI........................................................................................................................................................................................... 121
38 -12.000d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}  ali model 3D-neighbors follow..  28  3IKYDVVIVGSGPIGCTYARELVGAGYKVAMFDIGEIDSGLKIGAH............................................................................................................................................................................................................................................................ 47
39 -11.900d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  1MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLMVDLLREAGVDRYGQTEVTRDLMEAREACGATTVYQAAVRLHDLQGERPYVTFERDLRLDCDYIAGCDGFHGISRQSIPAE................................................................................................................................................................................ 172
40 -11.900d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  12  32AETDVVVVGAGSAGLSAAYEISNPNVQVAIIEQSVSPGGGA-----WLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDRVGGVVTNWALVAQNHHTQSCMDPNVM-EAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGM.......................................................................................................................... 207
41 -11.800d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}  ali model 3D-neighbors follow..  16  21VPGKLGVIGAGVIGLELGSVWARLGAEVTVLEA-------------MDKFLPAVDEQVAKEAQKILTKQGLKILLGARVTGTEVKNKQVTVKFVDAKSQAFDKLIVAVG............................................................................................................................................................................................ 119
42 -11.700d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  23...RVAVVGAGYIGVELGGVINGLGAKTHLFEMFDA----------LPSFD----PMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGLTLELEDGRSETVDCLIWAIG............................................................................................................................................................................................ 116
43 -11.500d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}  ali model 3D-neighbors follow..  16  4.TDRIAVVGGSISGLTAALMLRDAGVDVDVYERGVELDSISVPSSSMEYVDALTGERVGSVPADWRFTSPERYHTSKCLVGLSQDSETVQMRFSDGTKAEANWVIGADGGASVV....................................................................................................................................................................................... 154
44 -11.500d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  18  6.EYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSIT............................................................................................................................................................................................................................................................ 49
45 -11.400d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}  ali model 3D-neighbors follow..  16  25VPGKLLIIGGGIIGLEMGTVYSTLGSRLDVVEM-------------MDGLMQGADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGAEPQRYDAVLVAAG............................................................................................................................................................................................ 124
46 -11.300d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  18  20LPQHLVVVGGGYIGLELGIAYRKLGAQVSVVEARER---------------PTYDSELTAPVAESLKKLGIALHLGHSVEGYENGCLLANDGKGGQLRLEADRVLVAVG............................................................................................................................................................................................ 115
47 -11.300d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]}  ali model 3D-neighbors follow..  11  2.PYDYIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAP------------ATSSGLTKFDIPGLFESLFTDSNPFWWCKDITVFAGCLVSVNGALYWYPNDGDFSSSVGWPSSWTNHAPY--------TSKLSSRLPSTDHPSTDGQRYLEQSFNVV---------QLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNGKRAGPVATYLQTALRPNFTFKTNLGVQTNDPTLGPNGFIPVTPKGRV--ILSAGAFGTS--RILFQSGIGPTDMIQ........... 273
48 -11.200d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}  ali model 3D-neighbors follow..  15  24...TVVVVGGSKTAVEYGCFFNATGRRTVMLVRTEP----------KLIKD----NETRAYVLDRMKEQGMEIISGSNVTRIEEDANGRVQAVNGEMRIETDFVFLGLG............................................................................................................................................................................................ 121
49 -10.700d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}  ali model 3D-neighbors follow..  12  16.TVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAA------GGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGA-----DLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGAKNNERVAKLDPSLKGFISTNQPGAVGDVAENAGGALKDMQYXIDTKAENAKKQVIPGLYGAGEVTGGV-HGANRLGGNAISDIITFGRLAGEEA. 305
50 -10.700d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  6HSCDVLIIGSGAAGLSLALRLADQH-QVIVLSKGPVTEGSTFYAQG--GIAAVFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQ------------LIDQGVTHIQPNGEESYHLTREG-SHRRILHAADATGREVETTLVSKALNHPNIRVLERTNAVDLIVSDKIGLPGTRRVVGAWVWNRNKETVETCHAKA-VVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANXCGGVMVDDHGRTDVEGLYAIGEVSYT------LHGANRMASNSLLECLVYGWS. 285
51 -10.700d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  13  2.SKKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGGNSYDAR............................................................................................................................................................................................................................................................ 45
52 -10.700d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  29  1..MRVVVIGAGVIGLSTALCIHERYHSVLQPLD........................................................................................................................................................................................................................................................................ 31
53 -10.700d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  22  2..YDYIIVGSGLFGAVCANELKKLNKKVLVIEKRNHIGGNAYTEDCEGIQIHKYGAHIFHTNDKYIWDY.................................................................................................................................................................................................................................... 68
54 -10.600d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}  ali model 3D-neighbors follow..  10  6SYCDVLIVGAGPAGLMAARVLSEPDLKVRIIDKRSTKVYNGQAD-QCRTLESLKNLGLADKILSEANDMSTIALYNPDENGHIRRTDRIPDTLPGISRYHQVVLRIERRILDSIAEISDTRIKVERPLISSKAEDPEAYPVTMTLRYMSEDESTPLQFGHKTENGLFRS--------NLQTQEEEDANYRLPEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIXVTEKFS---------------------KDERVFIAGDAC---HTHSPKAGQGMNTSMMDTYNL...... 280
55 -10.400d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}  ali model 3D-neighbors follow..  29  2.YVPAVVIGTGYGAAVSALRLGEAGVQTLMLEMGQ...................................................................................................................................................................................................................................................................... 35
56 -10.400d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}  ali model 3D-neighbors follow..  13  4QYCDSLVIGGGLAGLRAAVATQQKGLSTIVLSLIPVKRSHSAAAQG--GMQASLGNSKMSDGDNEDLHF------MDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPTRIHKGDRMAIINAQKTT-----TEEDFRHGLIHSRDFGGTKKWRTCYTADATGHTMLFAVANECLKLGVSIQDRKEAIALIHQDGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGRIYKNTTNAVVCEGTGGGIRTDYRGEAKLKGLFSAGEAACWDMHGFNRLGGNSVSEAVVAGMIVGEYFA 305
57 -10.300d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  21VPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGE---------------SGFEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEANKTIDADYVLVT.............................................................................................................................................................................................. 117
58 -10.200d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}  ali model 3D-neighbors follow..  13  1..............................................................................................................VPQLPNFPGLKDFAGNLYHTGNW-EPVDFSGQRVGVIGTGSSGIQVSPQIAKQAAELFVFQRTPHFAVPADRDANERVAEFIRNKIRNTVRDPEVAERGTKRLILEIDYYEMFNRDNVHLVDTLSAPIETITPRGVRTSEREYELDS--VLATG................................. 234
59 -10.200d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  19  32...NVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDR-------------LGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKV-VTDKNAYDADLVVVAV............................................................................................................................................................................................. 123
60 -10.100d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]}  ali model 3D-neighbors follow..  14  6.QKRVVVLGSGVIGLSSALILARKGYSVHILARDLPEDVSSQTFASPWA---VHAPKYCQYLARELQKLGA-TFERRTVTSLEQAFD------------GADLVVNATGL........................................................................................................................................................................................... 183
61 -10.100d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}  ali model 3D-neighbors follow..  12  32...HVVIVGAGMAGLSAAYVLAGAGHQVTVLEAERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREY-----------------RKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVK--------SLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGM-----DKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAH 311
62 -10.000d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  4FQADLAIVGAGGAGLRAAIAAAQANAKIALISKVYPMRSHTVAAEG--GSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMT------------LELWGCPWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGTLVQIRANAVVMAGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDXMG-----------IETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQA. 280
63 -9.910d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}  ali model 3D-neighbors follow..  20  1..MNVAVVGGGISGLAVAHHLRSRGTDAVLLESSARLGGAVGTHA............................................................................................................................................................................................................................................................ 43
64 -9.900d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}  ali model 3D-neighbors follow..  15  20...RALCVGGGYISIEFA--YKARGGQVDLAYRGDM----------LRGFD----SELRKQLTEQLRANGINVRTHENPAKVTKNADGRHVVFESGAEADYDVVMLAIG............................................................................................................................................................................................ 116
65 -9.650d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  22IPKRLTIIGGGIIGLEMGSVYSRLGSKVTVVEF-------------QPQIGASMDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVKQENLEAEVLLVA.............................................................................................................................................................................................. 122
66 -9.510d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  10  6.DFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFS----------SGLLSWLKEYQENNDVVTENSMWQEQILENEEAIPLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQKNHASVTSAQSAEAAEAAETSLSMGSCEIPAEQSQCPGPESSPEVNDAEATGKKENSDAKSSTEEPSENVPKVQDNTETPKKNRITYSQIIKEGRRFLVSKLLYSRGLLIDLLIKSNVSRYAEFKNITRI-------AFREGTVEQVPCSRADVFNSKQLTMVE........... 286
67 -9.500d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1...DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRL----AKELGLETYKVNEVERLIHHVKGKSYPFRG-MTMKELLDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDR-VKL-ERPVIYIDQTREVETLNHEMYEAKYVISAIPPTLGMKI................................................................... 267
68 -9.440d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  14  22...KTLVVGASYVALECAGFLAGIGLDVTVMVRSI-----------LRGFDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLKVTAKSTNEDEFNTVLLAVG............................................................................................................................................................................................ 122
69 -9.060d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  31...KVAIIGCGGIGFDTAMYLSQPGESTSQNQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKIDDDGLHVVIN-GETQVLAVDNVVICAGQE.......................................................................................................................................................................................... 162

FFAS is supported by the NIH grant R01-GM087218-01
5 9 8 9 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.