current user: public




1sepA
Query: 1sep_A mol:protein length:261 SEPIAPTERIN REDUCTASE, from PDB1009

Results of FFAS03 search in JCSG1009
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MEADGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGLSKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYDLast
1 -65.300MA0019Z NP_066284.2 400328 Purified-2009-05-08  ali follow..  22  26.RRDPLANKVALVTASTDGIGFAIARRLAQ---DGAHVVVSSRKQQNVDQAVATLQGE--GLSVTGTVCHVGKAEDRERLVATAVK----LHGGIDILVSNAAVNPFF--GSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGG--GSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIEPRNIRVNCLAPGLIKTSFSRMLWM---DKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEASYITGETVVVG. 271
2 -65.000MA0019AL NP_005785.1 400390 Purified-2009-07-29  ali follow..  20  30.RKGVLANRVAVVTGSTSGIGFAIARRLAR---DGAHVVISSRKQQNVDRAMAKLQGE--GLSVAGIVCHVGKAEDREQLVAKALE----HCGGVDFLVCSAGVNP--LVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPYMENR---RGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALEPKDIRVNCVVPGIIKTDFSKVFHG---NESLWKNFKEHHQLQRIGESEDCAGIVSFLCSPASYVNGENIAVA. 274
3 -64.900MA0019AT NP_001033027.1 400158 Purified-2009-03-13  ali follow..  19  26TRRNPLSNKVALVTASTDGIGFAIARRLAE---DGAHVVVSSRKQQNVDRAVATLQGE--GLSVTGIVCHVGKAEDREKLITTALK----RHRGIDILVSNAAVNPFF--GNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEKRGG--GSVVIVGSVAGFTRFPSLGPYNVSKTALLGLTKNFAAEPKNIRVNCLAPGLIKTRFSSVLWE---EKAREDFIKEAMQIRRLGKPEDCAGIVSFLCSEASYINGETVVVG. 272
4 -64.500MA16054B NP_077284.2 400347 Cloned-2009-02-26  ali follow..  17  6..MERWRDRLALVTGASGGIGAAVARALVQ---QGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAIRS----QHSGVDICINNAGLARP---DTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVDDGHIININSMSGHRPLSVTHFYSATKYAVTALTEGLRQEQTHIRATCISPGVVETQFAFKLHDKD-----PEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQM.. 253
5 -64.400TM0019 TM0019 281900 Crystal|NMR-2004-03-31  ali follow..  22  2.....LEGKVAVVTGGGQGIGAAIAQLFAE---NGMKVVIAEIDEEAGVEREEMLRER--GLDVTFVKTDVADENSVKNMVRKTVE----IYGGVDVLVNNAAVMSV---KSIFERPLEEWERVIRVNLTGPYICSRYCAEEMIKRGG--GVIINIASTRAFQSEPDTEPYSASKGGLVALTHSLAVSRYHIRVVSISPGWIETSEWKKK-SLRKKPDLRPIDHEQHPAGRVGNPLDIAHLCVFLADDAGFITGTNFIVD. 245
6 -64.100MA0019AB NP_878912.1 400348 Purified-2009-05-08  ali follow..  21  30.RKGVLANRVAVVTGSTSGIGFAIARRLAR---DGAHVVISSRKQQNVDRAMAKLQGE--GLSVAGIVCHVGKAEDREQLVAKALE----HCGGVDFLVCSAGVNPLV--GSTLGTSEQIWDKILSVNVKSPALLLSQLLPYMENR---RGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALEPKDIRVNCVVPGIIKTDFSKVVRIGMGMSLSGRTSRNIISCRGLGSQRTVQESCPSCALQPATSTGRTLRWQ. 278
7 -64.000MA0019AN NP_000851.2 400410 Cloned-2008-02-06  ali follow..  20  2....HVNGKVALVTGAAQGIGRAFAEALLL---KGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVD----HFGRLDILVNNAGVNNE-----------KNWEKTLQINLVSVISGTYLGLDYMSKQNGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALANSGVRLNAICPGFVNTAILESIEKEGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIED-DALNGAIMKIT. 246
8 -63.800MA0019W NP_057370.1 400310 Cloned-2009-02-26  ali follow..  23  4....FLAGRRVLVTGAGKGIGRGTVQALHA---TGARVVAVSRTQADLDSLVRE------CPGIEPVCVDLGDWEATERALGSV--------GPVDLLVNNAAVALL---QPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIAR-GVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALEPHKIRVNAVNPTVVMTSMGQATWS---DPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDSGMTTGSTLPVE. 238
9 -63.700MA0019I NP_031647.1 399939 Purified-2009-03-14  ali follow..  23  4....NFSGLRALVTGAGKGIGRDTVKALHA---SGAKVVAVTRTNSDLVSLAKE------CPGIEPVCVDLGDWDATEKALGGI--------GPVDLLVNNAALVIM---QPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINR-GVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMEPHKIRVNSVNPTVVLTDMGKKVSA---DPEFARKLKERHPLRKFAEVEDVVNSILFLLSDSASTSGGGILVD. 238
10 -63.700TM1724 TM1724 283580 Purified-2001-12-11  ali follow..  21  2....RLEGKVCLITGAASGIGKATTLLFAQ---EGATVIAGDISKENLDSLVKEAEGL--PGKVDPYVLNVTDRDQIKEVVEKVVQ----KYGRIDVLVNNAGITRDALLVRMKE---EDWDAVINVNLKGVFNVTQMVVPYMIKQR--NGSIVNVSSVVGIYGNPGQTNYAASKAGVIGMTKTWAKEGRNIRVNAVAPGFIETPMTEKLPE-----KARETALSRIPLGRFGKPEEVAQVILFLASDSSYVTGQVIGID. 241
11 -63.400TM0325 TM0325 282200 Crystal|NMR-2003-02-19  ali follow..  20  2....NFQGKVVLITGAGSGIGKKAAVMFAE---RGAKVAINDISEEKGKETVELIKSM--GGEAAFIFGDVAK--DAEQIVKKTVE----TFGRLDILVNNAGIVPY---GNIEETSEEDFDKTMAVNVKGPFLLSKYAVEQMKKQGG--GVIVNVSSEAGLIGIPRRCVYSVSKAALLGLTRSLAVDDYGIRVNAVCPGTTQSEGLMARVKASPNPELLKKMTSRIPMKRLGKEEEIAFAILFAACDAGFMTGSIINID. 245
12 -63.100MA16054A NP_808232.2 399927 Purified-2009-03-14  ali follow..  17  5.GMERWRDRLALVTGASGGIGAAVARALVQ---QGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAVRS----QHSGVDICINNAGMARP---DTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNIDDGHIININSMCGHRVPPVIHFYSATKYAVTALTEGLRQEQTHIRATCISPGLVETQFAFKLHDKD-----PGEAAATYEHIKCLRPEDVAEAVIYVLSTPPHVQVGDIQM.. 253
13 -62.600TM0441 TM0441 282314 PDB-2004-07-14  ali follow..  21  2KEVFDLRGRVALVTGGSRGLGFGIAQGLAE---AGCSVVVASRNLEEASEAAQKL-TEKYGVETMAFRCDVSNYEEVKKLLEAVKE----KFGKLDTVVNAAGINRR---HPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDN--PSIINIGSLTVEETMPNISAYAASKGGVASLTKALAKERYGIRVNVIAPGWYRTKMTEAVFS---DPEKLDYMLKRIPLGRTGVPEDLKGVAVFLASEEAYVTGQIIFVD. 249
14 -62.400MA0019AW NP_038571.2 400480 Purified-2009-05-08  ali follow..  23  3.SQLRLRSALALVTGAGSGIGRAISVRLAA---EGAAVAACDLDGAAAQDTVRLLGSPGPRGKHAAFQADVSQGPAARRLLEEVQAC----SRPPSVVVSCAGITRDEFLLHMSE---EDWDRVIAVNLKGTFLVTQAAAQALVSSGG--GSIINISSIIGKVGNIGQTNYASSKAGVIGLTQTAARERHGIRCNSVLPGFIATPMTQKMPE-----KVKDKVTAMIPLGHMGDPEDVADVVAFLASESGYITGASVEVS. 254
15 -62.300MA0019C NP_055049.1 399864 Purified-2009-03-14  ali follow..  21  6..QNRLRSALALVTGAGSGIGRAVSVRLAG---EGATVAACDLDRAAAQETVRLLGGPGPRGNHAAFQADVSEARAARCLLEQVQAC----SRPPSVVVSCAGITQDEFLLHMSE---DDWDKVIAVNLKGTFLVTQAAAQALVSNGC-RGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARERHGIRCNSVLPGFIATPMTQKVPQ-----KVVDKITEMIPMGHLGDPEDVADVVAFLASESGYITGTSVEVT. 256
16 -62.200TM0297 TM0297 282173 Purified-2001-03-14  ali follow..  19  5EKLFSLKRKVALVTGGGQGIGKAIAQALAA---AGAAVLIMDINEETARRTVEEIKEK--GGEADFYVGDVTKEEDCFGAVKKALD----RWGKLDIGVNNAGIGDW---CEAENYPVEKWKKVIDVNLVGVFLSAKAEFHAMKERKY--GKIINIASMSGHIVNKKQTAYNASKAGVIHLTRSLAAEPYGIRVNSISPGYIRTPLIESP----NVKDLVPLWLDMIPLGRLGEVDDLIGAAIFLASPASYMTGHDLVID. 251
17 -61.900MA0019BE NP_064524.3 400257 Cloned-2009-03-24  ali follow..  22  1..MGRLDGKVIILTAAAQGIGQAAALAFAR---EGAKVIATDINESKLQELEKYPG-------IQTRVLDVTKKKQIDQFANEV--------ERLDVLFNVAGFVHH---GTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKS--GNIINMSSVASVKGVVNRCVYSTTKAAVIGLTKSVAADQQGIRCNCVCPGTVDTPSLQERIQARGNPEARNDFLKRQKTGRFATAEEIAMLCVYLASDSTYVTGNPVIID. 240
18 -61.800MA0019AQ NP_081484.1 400099 Purified-2009-03-13  ali follow..  22  1..MGRLDGKVIVLTAAAQGIGRASALAFAR---EGAKVIATDINESKLQELESYRG-------IQTRVLDVTKKRQIDQFASEI--------ERIDVLFNVAGFVHH---GTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLAQKS--GNIINMSSVASIKGVENRCVYSATKAAVIGLTKSVAADQQGIRCNCVCPGTVDTPSLQERIQARDNPEALKTFLNRQKTGRFASAEEVALLCVYLASDSAYVTGNPVIID. 240
19 -61.400MA0019D NP_065715.1 399869 Purified-2009-03-14  ali follow..  18  21FCPDLLRDKVAFITGGGSGIGFRIAEIFMR---HGCHTVIASRSLPRVLTAARKLAGAT-GRRCLPLSMDVRAPPAVMAAVDQALK----EFGRIDILINCAAGNFL---CPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHG--GVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEPQNIRVNSLAPGPISGTEGLRR---GGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPASYVTGAVLVAD. 268
20 -61.100MA0019A 14318639 399823 Purified-2009-03-27  ali follow..  21  2.......DKVCAVFGGSRGIGRAVAQLMAQ---KGYRLAIVSRNLEVAKVTAGEL-----GGNHLAFRCDVAKEQDVQSTFQEMEK----HLGPVNFLVNAAGINRGSLLVRTKT---EDMISQLHTNLLGSMLTCKAAMKTMIQQ---GGSIVNVGSIIGLKGNVGQSAYSATKGGLVGFSRSLAKERKKIRVNVVAPGFIRTDMTRHLKE--------EHFKKNIPLGRFGETLEVAHAVVFLLE-SPYITGHVLIVD. 229
21 -60.900MA0019AJ NP_116172.2 400081 Purified-2009-03-27  ali follow..  23  2.......DKVCAVFGGSRGIGRAVAQLMAR---KGYRLAVIARNLEGAKAAAGDL-----GGDHLAFSCDVAKEHDVQNTFEELEK----HLGRVNFLVNAAGINRDGLLVRTKT---EDMVSQLHTNLLGSMLTCKAAMRTMIQQQ--GGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKERKKIRVNVVAPGFVHTDMTKDLKE--------EHLKKNIPLGRFGETIEVAHAVVFLLE-SPYITGHVLVVD. 230
22 -60.900FL10785A NP_416123.1 376099 Purified-2007-04-13  ali follow..  16  1..MGKTQPLPILITGGGRRIGLALAWHFIN---QKQPVIVSYRTHYPAIDGLI-------NAGAQCIQADFSTNDGVMAFADEVLK----STHGLRAILHNASAWMA---EKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKAPEVKVNSIAPSLILFNEHD-------DAEYRQQALNKSLMKTAPGEKEVIDLVDYLLT-SCFVTGRSFPLD. 234
23 -60.300MA0019AF 18257359 400013 Purified-2009-03-27  ali follow..  19  21FCPDLLQDKVAFITGGGSGIGFRIAEIFMR---HGCHTVIVGRSLQKVTTAAKKLVAAT-GKRCLPLSMDVRVPPEVMTAVDQALQ----EFGKINILINCAAGNFL---CPASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHG--GVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEPQNIRVNSLAPGAISG--TEGLRRLRGSNASSKLKHFSNPIPRLGTKTEIAHSVLYLASPASYVSGIVLVVD. 268
24 -60.200MA0019H NP_076012.2 399938 Selected-2008-12-22  ali follow..  17  11LAAGLLKNQVAVVTGGGTGIGKAVSRELLH---LGCNVVIASRKLDRLTAAVDELRASSSSAEVSAIQCNIRKEEEVSNLVKSTLA----KYGKINFLVNNGGGQFM---APVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMREHG--GSIVNIIVLLN-NGFPTAAHTGAAREGVYNLTKSMALASSGVRINCVAPGTIYSQTAVDNYGEMGQ-TLFEMAFDSIPAKRLGVPEEISPLVCFLLSPASYITGQLINVD. 262
25 -59.900MA0019V NP_060911.2 400308 Cloned-2009-02-26  ali follow..  17  11LAPGLLQGQVAIVTGGATGIGKAIVKELLE---LGSNVVIASRKLERLKSAADELQANTKQARVIPIQCNIRNEEEVNNLVKSTLD----TFGKINFLVNNGGGQFL---SPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHG--GSIVNIIV-PTKAGFPLAVHSGAARAGVYNLTKSLALECSGIRINCVAPGVIYSQTAVENYGSWGQ-SFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPASFITGQSVDVD. 262
26 -58.600MA0019T NP_004484.1 400289 Cloned-2009-02-26  ali follow..  18  4.ACRSVKGLVAVITGGASGLGLATAERLVG---QGASAVLLDLPNSGGEAQAKKL-----GNNCVFAPADVTSEKDVQTALALAKG----KFGRVDVAVNCAGIAVASKTYNLKKHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDPIGIRVMTIAPGLFGTPLLTSLPE-----KVCNFLASQVPFSRLGDPAEYAHLVQAIIE-NPFLNGEVIRLD. 254
27 -58.300FL10872A NP_394371.1 376146 Purified-2007-04-20  ali follow..  17  1........MNAIIIGASETFGFFAAKDLLH---QGFHVTINARNEEKLSSMKADLAKEG---YIEFVAGDISQEYTLKTIRDHYKE------SKINALIMGLGGYAPD-----NISDPKGIMKMFEDNVMRPFTTLSKFIDLMAT----PSSVVFMSSVYSVSVSENSLSYSGSKAALNRMVASAAKSKNRIRVNAVVTTSMDDKSHS------------ERNIYFNPGKQSIDPELVAMVVGFLAGESLGITGSVIVVD. 223
28 -58.000MA0019AR NP_080448.1 400129 Purified-2009-03-27  ali follow..  16  52LPPDAFQGKVAFITGGGTGLGKAMTTFLST---LGAQCVIASRNIDVLKATAEEISSK-TGNKVHAIRCDVRDPDMVHNTVLELIK----VAGHPDVVINNAAG---NFISPSERLTPNGWKTITDIVLNGTAYVTLEIGKQLIKAQK-GAAFLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAERYGMRFNIIQPGPIKTKGAFSRLD--PTGRFEKEMIDRIPCGRLGTMEELANLATFLCSDASWINGAVIRFD. 300
29 -57.700MA0019X NP_932349.2 400312 Purified-2009-05-08  ali follow..  22  24.RRDPLTNKVALVTASTDGIGFAIARRLAQ---DRAHVVVSSRKQQNVDQAVATLQGE--GLSVTGTVCHVGKAEDRERLVAMAVK----LHGGIDILVSNAAVNPFF--GSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGG--GSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIEPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA.......................................... 230
30 -57.600MA16030A 13278171 399828 Purified-2009-03-14  ali follow..  21  2..VAPMKGQVCVVTGASRGIGRGIALQLCK---AGATVYITGRHLDTLRATAQEAQSL--GGRCVPVVCDSSQESEVKSLFEQVDR---EQKGRLDVLVNNAYAILNTTNKSFWEVPASIWDDINNVGLRGHYLCSVYGARLMVPAGK--GLIVIVSSPGGL-QHMFNVPYGVGKAACDRLAADCAHERHGVSYVSLWPGLVQTEMVKEFMAKEDTPEDPLFKKMKPDFSSAESPEMSGKCVVALATDPNNLSGKVLPSCD 257
31 -57.500MA0019R NP_001350.1 400285 Selected-2008-12-22  ali follow..  17  52LPPNSFQGKVAFITGGGTGLGKGMTTLLSS---LGAQCVIASRKMDVLKATAEQISSQ-TGNKVHAIQCDVRDPDMVQNTVSELIK----VAGHPNIVINNAAG---NFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQK-GAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEKYGMRFNVIQPGPIKTKGAFSRLD--PTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDASWINGAVIKFD. 300
32 -56.900FL10795A NP_242709.1 376110 Purified-2007-04-04  ali follow..  2.........NILVSNGEEHVNQTIASFFHQ---RGDRPILLFTEKEKHLEYVAG------HPEQEAVLCTTYEEETLAAMVKEAFEE-----EAIDVLVHGNEMVNE---AELLERDPSSLNEVVQKALYHLFLLNKVVVRDMVKRK--QGKIIFPLFY-DPLYYAGYASSPILNQAKLSLMKCMSREAFKINVNSITFGYYNDQFTREEKK-----ATKSQVEIFCLKPKLPEIEEYVHSIGLLVDPASLIGGENLHVG. 230
33 -56.300TM1169 TM1169 283034 PDB-2003-09-17  ali follow..  18  4....GIRDKGVLVLAASRGIGRAVADVLSQ---EGAEVTICARNEELLKRSGHRY-----------VVCDLRK----------DLDLLFEKVKEVDILVLNAGGPKA---GFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKG---GRIVAITSFSVISPIENLYTSNSARMALTGFLKTLSFEPYGITVNCVAPGWTETERVKEL----LSEEKKKQVESQIPMRRMAKPEEIASVVAFLCSEASYLTGQTIVVD. 229
34 -56.100MA16030B NP_612461.1 399883 Purified-2009-03-14  ali follow..  21  4....PMNGQACVVTGASRGIGRGIALQLCK---AGATVYITGRHLDTLRVVAQEAQSL--GGQCVPVVCDSSQESEVRSLFEQVDR---EQQGRLDVLVNNAYAILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQ--GLIVVISSPGSL-QYMFNVPYGVGKAACDKLAADCAHERHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNSLSGKVLPSCD 257
35 -54.500MA16027D NP_079798.1 399999 Purified-2009-03-27  ali follow..  21  2.........VVWVTGASSGIGEELAFQLSK---LGVSLVLSARRAQELERVKRRCLENGKEKDILVLPLDLTDTSSHEAATKAVLQ----EFGKIDILVNNGGR---SQRSLVLETNLDVFKELINLNYIGTVSLTKCVLPHMIERK--QGKIVTVNSIAGIASVSLSSGYCASKHALRGFFNALHSEYPGITFCNVYPGPVQSDIVKNA-----TEEVTKSMRNNIDQSYKMPTSRCVRLMLISMANDLWISDHPVLL.. 243
36 -53.900MA0019AD 18043883 400008 Purified-2009-03-27  ali follow..  15  30.RRKSVTGQTVLITGAGHGIGRLTAYEFAK---QKSRLVLWDINKRGVEETADKCRKL--GAVVHVFVVDCSNRAEIYNSVDQVKR----EVGDVEIVVNNAGAIYP---ADLLSAKDEEITKTFEVNILGHFWIIKALLPSMLRRN--SGHIVTVASVCGHGVIPYLIPYCSSKFAAVGFHRALTAEKTGIKTSCLCPVFVNTGFTKNPST---------------RLWPVLEPEEVARSLINGILTNK........... 254
37 -53.800MA0019S NP_835236.1 400288 Purified-2009-05-08  ali follow..  15  30.RRKSVAGEIVLITGAGHGIGRQTTYEFAK---RQSILVLWDINKRGVEETAAECRKL--GVTAHAYVVDCSNREEIYRSLNQVKK----EVGDVTIVVNNAGTVYP---ADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERN--HGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSEKTGIKTSCLCPVFVNTGFTKNPST---------------RLWPVLETDEVVRSLIDGILTNK........... 254
38 -53.600MA0019P NP_444492.1 399997 Purified-2009-03-27  ali follow..  14  30.KKKSVAGEIVLITGAGHGIGRLTAYEFAK---LNTKLVLWDINKNGIEETAAKCRKL--GAQAHPFVVDCSQREEIYSAAKKVKE----EVGDVSILVNNAGVVYT---ADLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNN--HGHIVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDERTGVRTSCLCPNFINTGFIKNPS---------------TNLGPTLEPEEVVEHLMHGILTEK........... 254
39 -53.400MA0019AO NP_057329.2 400423 Cloned-2008-02-06  ali follow..  16  30.RRKSVTGEIVLITGAGHGIGRLTAYEFAK---LKSKLVLWDINKHGLEETAAKCKGL--GAKVHTFVVDCSNREDIYSSAKKVKA----EIGDVSILVNNAGVVYT---SDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNN--HGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDEITGVKTTCLCPNFVNTGFIKNPS---------------TSLGPTLEPEEVVNRLMHGILTEQ........... 254
40 -53.000MA0019BC NP_742034.1 400213 Selected-2008-12-22  ali follow..  15  30.KEKSVAGQVCLITGAGSGLGRLFALEFAR---RRALLVLWDINTQSNEETAGMVRHPHCNLQVFTYTCDVGKRENVYLTAERVRK----EVGEVSVLVNNAGVVSG---HHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEIN--HGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHEKDGIKTTLVCPYLVDTGMFRGCRIR----------KEIEPFLPPLKPDYCVKQAMKAIDQPMICTPRLMYI.. 295
41 -52.600MA16027F NP_861420.1 400375 Cloned-2009-02-26  ali follow..  20  27FRPEMLQGKKVIVTGASKGIGREMAYHLAK---MGAHVVVTARSKETLQKVVSHCLELG-AASAHYIAGTMEDMTFAEQFVAQAGK----LMGGLDMLILNHIT---NTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS---NGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKERVNVSITLCVLGLIDTETAMKAVSG-------------IVHMQAAPKEECALEIIKGGALRQ........... 253
42 -52.600FL10809A NP_742899.1 376128 Selected-2007-03-12  ali follow..  15  2.....INSRSFWVTGASNGLGLALVERMLD---EGHRVAASGKDSDALDDLGARY-----GNQLLRLPWQLQEEQHVTDACQQICH----AWCSLDGLILNTGTTDYLP---DNVSDSELIEAIVTTNQLAAEHCLSKALPLLTKGQ--SPQVMGLFNRYSALQLFAPTQVTAGWNNLPQWLREQRKADQGVALTIVAPQSLKVTVTS---AQAIPEAWTPGSAAEELLRRWPQREELVLETLDLSS.............. 226
43 -52.400MA16027G NP_057113.1 400391 Purified-2009-03-27  ali follow..  20  45..EWELTDMVVWVTGASSGIGEELAYQLSK---LGVSLVLSARRVHELERVKRRCLENGKEKDILVLPLDLTDTGSHEAATKAVLQ----EFGRIDILVNNGGM---SQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERK--QGKIVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTEYPGIIVSNICPGPVQSNIV----ENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMANDLWISEQPFLL.. 293
44 -52.200NS10696D NP_744871.1 380843 Purified-2007-09-18  ali follow..  22  3LINDLQTPANVLVCGASQGIGLALCTQLLAR-DDIGLVFAVSRRATTSPALDTLFTEH--ARRLVRLDCDARSEQALQTLAAQVGA----CCDQLNLVFSTLGVLQERAEKALTQLDMAGLLSSFTTNCFAPVLLLKHLLPLLRRHP---MAFVALSARVGSIGLGGWYSYRASKAALNQLLRTASIENPASTVLALHPGTTDTQLS-------------RPFQGNVPPGKLFSPAFAATCILALVSRGPAQSGTFWAWD. 250
45 -51.800FP7591B YP_509278.1 382336 Purified-2007-10-20  ali follow..  21  165....NPKHRRILITDAWNPNTPALAKALLE---AGAATIFVGEAESWRPHPNRDTLAG--MENVDILPLDVTDTASVQTLAGEI-------GGKTDILINNARFMRPGGV--LARGDTGFARDEMEVNYLGLMRLAQAFGPGMCARMNSAAAWVNILSAHALSNAPDYGCFSASNAAAYSLSQSLRGESAGLRVMNVFVGPTDDDWYAPLPPPKVLPTARSVVDGLRDGLEDVWCGDIAKDMRDRWRRAKVLEREMTFGSE 416
46 -51.600MA0019BB NP_620419.2 400206 Purified-2009-05-08  ali follow..  20  34.PRKNVAGEIVLITGAGSGLGRLLALQFAR---LGSVLVLWDINKEGNEETCKMAREAG-ATRVHAYTCDCSQKEGVYRVADQVKK----EVGDVSILINNAGIVTG---KKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIAND--HGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVEQKGIKTTIVCPFFIKTGMFEGCTT------------GCPSLLPILEPKYAVEKIVEAILQEK........... 262
47 -51.400NS10696B YP_264403.1 380837 Purified-2007-09-18  ali follow..  18  1.....MNTKNYFIIGGTGGIGKAMVEQLLQ---TATNEHASTGMNNRVFATYHKSIPDFEADNLYWIAMDICDEQSIKHAVDTIKQ----QTTHIDWVINCAGLLHTQPEKALQQLESEFFLQNMQVNALASLLIAKHIKPLLAKAEDKPAIFATISARVGSISLGGWYSYRMSKAALNMGMKNLSIELKDVCVVVMQPGTVNTQLS-------------APFQGNVADGQLFSPTYSAECLLEVLSKSAAQSGSFVDWA. 253
48 -51.300MA16027A NP_663403.1 399816 Purified-2009-03-14  ali follow..  20  45RSKAYLRNAVVVVTGATSGLGRECAKVFHA---AGAKLVLCGRNVKALEELSRELAGSSQTHQPFVVTFDLADPGTIAAAAAEILQ----CFGYVDVLINNAGI---SYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERK--QGHIVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEEANIKVTVISPGYIHTNLSVNAVTADGSRYGALD----KNTAQGRSAAEVAQDVFDAVGKKK........... 282
49 -51.200MJ16363A YP_775298.1 402450 Purified-2009-08-05  ali follow..  16  4.TVSNASTPSILLIAASRGLGLAMAEHFLN---KGWHVTGTVRAGSGRTKLHELAERF--GERLEIDTLDICAPDQLAALRARL------SGRRFDMLFVNAGTTND-PNETIGEVTTDEFVRVMITNALAPMRVIEALHDLVPE----GGLIGAMSSGQGSVANGMREVYRGSKAALNQFMRSFAARATPRAMVLMAPGWVRTELGGPDAR--------------------LTIDESVPSLVNVLIGQRRAGLEYLDYQ. 232
50 -51.200NS10696C YP_324470.1 380842 Purified-2007-08-29  ali follow..  19  4..IDEINRANVLIVGASQGIGLGFVKKLLQD-DRIAKIYATYRQKDSASELITLEKEY--SPRLTCLSLDITDELQIAEILQQINT----ETNRLHLVINCVGILHEGNLQSLRQLNSENLLRYFHINSIGAVLLAKHLLPCFQHNE--PSVFASISAKLGSIGLGGWYGYRASKAALNMFMRTVAVECPKTTVVTLHPGTTDTRLS-------------RPFQKNVAAEKLFSIERTVDQLLAVIAQQKGDSGKFFSWD. 250
51 -51.100MA16027E NP_081810.1 400040 Purified-2009-03-27  ali follow..  18  26.KPLALPGAHVVVTGGSSGIGKCIAIECYK---QGAFITLVARNEDKLLQAKKDIEKHSINDKVLCISVDVSDYNQVENVIKQAQE----KLGPVDMLVNCAGTSMS---GKFEELEVSSFEKLMSINYLGSVYPSRAVITTMKERR--VGRIVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEPYNVYVTVAYPPDTDTPGLAEE-----NKTKPLETRLISETTAICKPEQVAKQIVKDAIQGNF.......... 263
52 -51.100MA0019AX NP_871789.1 400495 Purified-2009-05-08  ali follow..  19  34.PRKNVAGEIVLITGAGSGLGRLLALQFAR---LGAVLVLWDVNKEANDETHQLAREAG-AARVHAYTCDCSRREEVYRVADQVKK----EVGDVSILINNAGIVTG---RNFLDCPDDLMEKSFDVNFKAHLWMYKAFLPAMIANN--HGHLVCISSSAGLIGVNGLSDYCASKFAALGFAESMFIEQWGIKTTIVCPFFIKTGMFEGCTT------------KCPTLLPILDPEYAVRKIIDAILQEQ........... 262
53 -51.100MA16027C NP_002026.1 400344 Cloned-2009-02-26  ali follow..  17  26.KPLALPGAHVVVTGGSSGIGKCIAIECYK---QGAFITLVARNEDKLLQAKKEIEMHSDKQVVLCISVDVSDYNQVENVIKQAQE----KLGPVDMLVNCAGMAVS---GKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERR--VGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEPYNVYITVAYPPDTDTPGFAEENRTKP-----LETRLISETTSVCKPEQVAKQIVKDAIQGN........... 262
54 -50.500MA3792C NP_113651.3 400501 Cloned-2009-03-24  ali follow..  16  61.DLIKQYGRWAVVSGATDGIGKAYAEELAS---RGLNIILISRNEEKLQVVAKDIADTY-KVETDIIVADFSSGREIYLPIREALK-----DKDVGILVNNVGV-FYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERK--KGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYESKGIFVQSLIPFYVATSMTAPSNFLHRCSWL------------VPSPKVYAHHAVSTLGISKRTTGYWSH... 295
55 -50.300MJ10696A YP_267274.1 402785 Purified-2009-08-29  ali follow..  14  1.....MTNKATLIVGANSDIAKALALKIIN--SEYPQLIIVSRDITFYQQALFS--------QAILIETASYNDEDIGKVADTIKQIGARD---ISRVFICHGVLHSQPEKRLEDFSAEAFIKVINANTITPMLWLKHLTPLLASQH--RCKIIIFTARVGSISLGGWYSYRSSKAAMNMLIKSAAVEAKNIKLISFHPGTTDTPLS-------------KPFQANVPQGKLFTCEFVAKQLLTIVEDVIDGEASFLDWQ. 238
56 -50.200MA3792D NP_780394.1 400525 Selected-2008-12-22  ali follow..  16  61.DLIKQYGRWAVISGATDGIGKAYAEELAS---HGLNVILISQEEEKLQAAAKHIADTY-RVETLVLVADFSRGREIYAPIREALR-----DRDIGILVNDVGAF--PYPQYFSQVPEDTLWDIVNVNIAAASLMVHIVLPGMVERK--KGAIVTVSSGSCCKPTPQLAAFSASKAYLDHFSRALQYESKGIFVQSLIPFYVTSSGAAPASFLHRCPWL------------APSPRVYAQHAVSTLGISKRTTGYWSH... 295
57 -50.100MA16027B NP_056325.2 399871 Purified-2009-03-14  ali follow..  20  45RGKAYLRNAVVVITGATSGLGKECAKVFYA---AGAKLVLCGRNGGALEELIRELTASHATHKPYLVTFDLTDSGAIVAAAAEILQ----CFGYVDILVNNAGI---SYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRR--QGHIVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMD----TTTAQGRSPVEVAQDVLAAVGKKK........... 284
58 -50.100FJ9332A YP_168769.1 370293 Selected-2006-06-19  ali follow..  15  3..........IIVVGAEGDVGRAVCKELGS----RHEIIRAGRSRGDVT-------------------VDIADPHSVAAMYART--------GPVDAVISTAGEVHF---APLRDFDRETFMIGLRNKVMGQINLVLGGFYTVAE----GGSFTLTSGVLDRDPIPMGSGAAAANGALGGFVMGAAIEPRHQRINVVSPGLLDVSVPRYG--------------AWFPGHEPVPAQRVGRAYAKSVE--GALSGQVIIV.. 198
59 -50.000NS10696G YP_001052213.1 380878 Crystal|NMR-2007-12-14  ali follow..  24  3..........VLIVGGSGGIGQAMVKQVQE---TYPDATVHATYRHHLPNDRQN--------NIQWHALDVTNEAEIKQLSEQL--------TELDWLINCVGILHTQDKGSLQSLDIDFFQHNLTLNTLPSVMLAKHFCHALKQSD--SARFAVISAKVGSITLGGWYSYRASKAALNMFLKTLAIEMKHCVVLSLHPGTTDTPLS-------------QPFQQSVPKGKLFTPEYVANCLLPIIANTPAQTGCFFAYD. 229
60 -49.900FL10900A YP_049075.1 376185 Purified-2007-04-13  ali follow..  13  2....................................KVDLCARKQADAQASVGIIQRE--GGTARAYQCDIANPDSVRDFSVQLLE----DSTPVDILVLSAAQWLEGAL--GEEDTDTDIVSTINSGLTGSILLTKTLLPSLRRSQS--ADILAMISVCGVPQFHDHPAFFAAKHGLSGFSQNLAHHQENIRVTGFYPPDFEVTGFDDYPASGE-----------KMGEHLLNARSIWETMRFVLTQPRHINAIHFQGP. 211
61 -49.900MA0019AA NP_004744.2 400346 Purified-2009-05-08  ali follow..  22  32.KLRDLSRENVLITGGGRGIGRQLAREFAERGAR--KIVLWGRTEKCLKETTEEIRQM--GTECHYFICDVGNREEVYQTAKAVRE----KVGDITILVNNAAVVHG---KSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQ--NGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGCPGVSATTVLPFHTSTEMFQGMRV------------RFPNLFPPLKPETVARRTVEAVQLNQ........... 258
62 -49.700MJ10696C YP_957804.1 403192 Purified-2009-08-20  ali follow..  18  2.........TTVIAGVSGAIGGALARRYLSS-YPDRSLIGLCRRPETAPDDLRN------HSGVRLMAWDAEDEQRLDVA---EFKAVLEASGPVYTVIYAGGLLHDFPEKRLEDIDGRSMMRSYQVNCLGFVSLMQRLAPALRGKH--FKRIAAVSAKVGSISLGGWYAYRASKAALNMVVKNLSIEYAPLACVSLHPGTTLSSLS-------------QPFQQSLEQLTVHEPEQTASNLFSVLESDARDNGRFISWD. 238
63 -49.700MA0019G 15488817 399937 Purified-2009-03-14  ali follow..  22  32.KLRDLSRESVLITGGGRGIGRHLAREFAERGAR--KIVLWGRTEKCLKETTEEIRQM--GTECHYFICDVGNREEVYQMAKAVRE----KVGDITILVNNAAVVHG---KSLMDSDDDALLKSQHVNTLGQFWTTKAFLPRMLELQ--NGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGCPGVSATTVLPFHTSTEMFQGMRV------------RFPNLFPPLKPETVARRTVDAVQQNQ........... 258
64 -49.600NS10696E YP_612402.1 380858 Purified-2007-11-01  ali follow..  20  2.....TDPRTVVIFGASGGIGRALVETYAGM-SAVETVHAVSRGGDISFEGSPAGQE-----KIAQHQADITSDSDLEALATRI--------GAAEMVIVATGILTDQETGSYRHQDKAAFEQVFGINTIGPALVAKHFLGRMPRKG--RTVFAALAARVGSNGLGGWHAYRASKAALCMLMRNYAIENEDAICVCLHPGTVDTGLS-------------APFQGNVPEGKLFTPEYSAKCLASVLSQTPKDSGKQFDWA. 240
65 -49.600MJ10696B YP_156827.1 403089 Purified-2009-08-20  ali follow..  17  3..........MVVLGAGGGLGRAITLELSKQ-YPDERIFALSRQPEVPETDSSDVT---------YCRIEDYDEKALGAWVSEFKN----NGEQLSGVVSTIGMLHDFPEKKLTDITADNLNKLFSVNAVKPMLALKAFLPILDRKK--TRFWVQLSAKVGSIELGGWYAYRSSKAGLNMLLKTASIEHKNLIVAAIHPGTTDTRLS-------------EPFQERISTDKLYSPELSAERIVAVVKNKPENTGALWHWD. 234
66 -49.500FP7591C YP_164960.1 382372 Selected-2007-08-07  ali follow..  15  162..TADPKHRRVLVTDGRTDTGQAIARALLD---AGAAKVFVGDCAPLMRFAGKQQLAALDGAEL--VPLDVTDTHSVGNLAAQL-------GGRIDIVINTAGQVREG--GVAFGAKLSDLQAGLDTGVVGLMRLAQAFGPALGARSNSAAAFLDVVPVSGLSGQSGYSGTAASAAARLSLLSGFRGEKAGIRVMSVLTGPVDDAWHQRL----PQPKTAPSHLARTVVAALRDGQEISCAGDVAKDFARWRADPLLTMRE 409
67 -49.400MA3792B NP_000188.1 400036 Purified-2009-03-27  ali follow..  20  42.SFLRSMGQWAVITGAGDGIGKAYSFELAK---RGLNVVLISRTLEKLEAIATEIERTT-GRSVKIIQADFTKDDIYEHIKEKL------AGLEIGILVNNVGMLPNLLPSHFLN-APDEIQSLIHCNITSVVKMTQLILKHMESRQ--KGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEAKEVIIQVLTPYAVSTAMTKYLNTNKTADEFVKESLNYVTIGGETCGCLAHEILAGFLS.............. 279
68 -48.900FL10699A YP_293001.1 376051 Purified-2007-04-20  ali follow..  13  7.DKSRFKGLKIAITGANGSLGKSLIEVLKK---EGAYLIGLTHDKKNDSNSEG-------GKPDEWILWSCGKERLLSSILANI-----------DILILNHGF------NPKGMIESNEINKALEINSLSHLRLIEIFEDLALSNNLNKSKEIWVNTSEAEIQIAFSPVYEITKRLIGELISLKKSKSFIIKKLILGPFKSKLNPQ-----------------------GIMSPEFVAKKIVQKAKKEDLVIVSPNPI.. 224
69 -48.700MA3792A NP_057226.1 400351 Selected-2008-12-22  ali follow..  20  44.GVGPGLGEWAVVTGSTDGIGKSYAEELAK---HGMKVVLISRSKDKLDQVSSEIKEKF-KVETRTIAVDFASEDIYDKIKTGL------AGLEIGILVNNVGMSYEYPEYFLDVPDLDNIKKMININILSVCKMTQLVLPGMVERS--KGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEESKGVFVQSVLPYFVATKLAKIRKPT-SPETFVKSAIKTVGLQSRTNGYLIHALMGSIIS.............. 283
70 -48.600NS10696F YP_928368.1 380870 Purified-2007-09-18  ali follow..  22  3..........ILIVGGSGGIGSAMVKDALA---RFQDAEVHATFCTDSTHTGCSHFS-----GVKWHRLDVTDEAGIKALSESF--------ESLDWLINCVGMLHSGSKGPLSQFDGEFFLHNMTLNTLPTLLLAKHFSARLKSSV--SPRLAVLSARVGSISLGGWYSYRASKAALNMLIKTLAVELKGGVVLALHPGTTKTRLS-------------EPFQANVPGDKLFLPERVAADLMDIIAREVCDSGSFLAYD. 232
71 -48.400FJ8772A YP_750026.1 370103 Selected-2006-06-19  ali follow..  16  1.....MSTATAMIIGASSQLSQALARQLSA---QQVSLVLFVNDPESLNEFSQSLPG-----EVSVYPLAIDQPDTLITQLNTAWT----KHNGAHLVIVNTGVNDYD-----PSLPWAIDKLAIEINVMGFAAANNCIFKLMCDQG--YGQLAAINSIAGQRGGPN-VAYHASKAFAENYLQGLSMHKLPITISDIQLGLFDKAVHLNTQ-------------------LLSPIDKVAKQIITALQKGK........... 211
72 -48.200MA0019Q NP_000404.1 400282 Selected-2008-12-22  ali follow..  18  1.....MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPGSLETLQLDVRDSKSVAAARERVTE------GRVDVLVCNAGL---GLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRG--SGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYQNPEEVAEVFLTALRAPK........... 249
73 -47.500MA0019AU NP_115679.2 400471 Cloned-2009-02-26  ali follow..  17  4.NTGRLAGCTVFITGASRGIGKAIALKAAK---DGANIVIAAKTAQPHPKLLGTIYTEAVGGKALPCIVDVRDEQQISAAVEKAIK----KFGGIDILVNNASAISL---TNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKV--AHILNISPPLNLNPFKQHCAYTIAKYGMSMYVLGMAEEKGEIAVNALWPKTAIHTAA------------MDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFV.... 243
74 -47.200FL10715A NP_895859.1 376072 Purified-2007-04-13  ali follow..  18  3.QAARTPIRSSFVLGSTSEIAKAICHELAR--CGCRQFHLIARNQAGNEQLAEQLRNHYG----AVVTQEQTDLLTDVALDGPGKP----QVGNYDLYLITAGSLGDLE---LARNDATEALRITAANYSGLLPWLTAIATPERLSG--PGRLWVFSSVAADLGRPSNYHYGAAKAALTAFCEGLQLRRKPFAVRTIKAGFMATSMTI----------------GKAPKVLCVSPQSVARDLLRRPNRRGIE......... 224
75 -47.200MA0019B 12805470 399830 Purified-2009-03-14  ali follow..  15  4.NTGKLAGCTVFITGASRGIGKAIALKAAK---DGANIVIAAKTTQKHPKLLGTIYTEAAGGTALPCVVDVRDEQQINSAVEKAVE----KFGGIDILVNNASAISL---TNTLDTPTKRVDLMMNVNTRGTYLTSKACIPFLKKSKV--GHILNLSPPLNLNPFKQHCAYTIAKYGMSMCVLGMAEERGEIAVNALWPRAIHTAAMDMLGGS-------------GVENQCRKVDIIADAAYSIFKRPKSFTGNFI.... 243

FFAS is supported by the NIH grant R01-GM087218-01
5 9 7 8 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.