current user: public




Query: 2hoq_A mol:protein length:241 Putative HAD-hydrolase PH1655, from PDB0516

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst MVKVIFFDLDDTLVDTSKLAEIARKNAIENMIRHGLPVDFETAYSELIELIKEYGSNFPYHFDYLLRRLDLPYNPKWISAGVIAYHNTKFAYLREVPGARKVLIRLKELGYELGIITDGNPVKQWEKILRLELDDFFEHVIISDFEGVKKPHPKIFKKALKAFNVKPEEALMVGDRLYSDIYGAKRVGMKTVWFRYGKHSERELEYRKYADYEIDNLESLLEVLARESSSNKKVHPPRQQILast
1 -72.600[R] KOG3085 Predicted hydrolase (HAD superfamily)  ali follow..  21  6.VRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYKEEAEIICDKVQVKLSKEFHPYNTCITDLRTSHWEEAIQETKAEECYFLWKSTRLQHMTLAEDVKAMLTELRKE-VRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKTVWINKNGIVPLK--SSPVPHYMVSSVLELPALLQSIDCKVSM........ 246
2 -47.200[R] COG0546 Predicted phosphatases  ali follow..  24  8.VQAVAFDLDGTLCDSVPDLAAAAEAMLEQLGMKPLPAK---------VVESYVGDGIGKLVHRVLTEADSELWEKGFVSYMKYYRDHLSVFTRPYPETEAGLALLKSLGIPLAVITNKNEILAAELLKQLGLADYFSLILGGDSLPEKKPSPLPLRHAAEVLGIDVANMVMVGDS-RNDIIAAKAAGCLSVGVTFGYGDMTLLSDATRPDWIIGSLPEIYENLQPQKNKEE......... 235
3 -34.800[R] COG1011 Predicted hydrolase (HAD superfamily)  ali follow..  15  6AKMLYIFDLGNVIVDIDF---NRVLGTWSDLTRIPLATLKKSFHMG--EAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVA---LRPEVIAIMHKLREQGHRVVVLSNNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDN-ADNIEGANQLGITSILVKDKTTIPDYFAK................................... 203
4 -34.600[R] KOG3109 Haloacid dehalogenase-like hydrolase  ali follow..  21  11.YECLLFDLDDTLYPLSSGLSDACSNNIIEYMVEKLGIDEDGVVELNQILYKKYGTSMA------LKAVGYEFDNDEYHRYVHGRLPY--ENLKPDPVLRSLLLGLPLRKL---VFSNGDEVHVMKALTRLGIEDCFERIISFETLNPDKPTEIAFEKAFDIAQLNPHKTLFFDDST-RNIQTGKAVGLHTVLVGKSEKIDG-------SDYALESIHNMKEAFPELWSESIINNKETERI 252
5 -34.400[R] COG0637 Predicted phosphatase/phosphohexomutase  ali follow..  16  4.IEAVFFDCDGTLVDSEVICSRAYVTMFRQFGITLELTEVFRRFK---------GVKLYEIIDTISKEHGVALAKAELEPVYRAVARLFDTELEAIAGANTLLESI---KTPMCVVSNGPVSKMQHSLGKLGMLHHFPLLFSGYDIQRWKPDPALMLHAANAMKVNVEKCILVDDSS-AGAQSGIAAGMEVFYFCADPHNKP---IDHPNVTTFTDLAQLPGLWKARGWEITR........ 221
6 -27.600[R] KOG2914 Predicted haloacid-halidohydrolase and related hydrolases  ali follow..  20  1........MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVM----------GKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHEFFSLFSHIVLGDDVQHGKPDPDIFLACAKRFSPAMEKCLVFEDAP-NGVEAALAAGMQVVMVPDGNLSR---DLTTKATLVLNSLQDF..................... 203
7 -26.900[R] KOG3040 Predicted sugar phosphatase (HAD superfamily)  ali follow..  17  3.IKGALIDLSGTLHVEDETTKDSKATLHERLCRIGFQLDASEIYSSLSAAVSYVENERLNPYYILSEDARQDFPPEDTRRYKDSVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEGLALGPGCFVKGLEFATGR-IGKPNPYFFEGAL--AGRDPASCVMIGDDANDDIVGAMSMGMQGILVKTG-KYLPDVKPSPPPTALLENFAEAVDWIIQKNQS........... 255
8 -24.800[R] COG2179 Predicted hydrolase of the HAD superfamily  ali follow..  25  28.IKAVLVDLDNTLIAWNNPDGT--------------------------------------------------------------------------PEMKQWLHDLRDAGIGIIVVSNNTKK---------RVQRAVEKFGIDYVYWALKPFTFGIDRAMKEFHYDKKEVVMVGDQLMTDIRAAHRAGIRSILVKP............................................. 139
9 -23.000[G] COG0647 Predicted sugar phosphatases of the HAD superfamily  ali follow..  15  3.IKNVICDIDGVLMHDNVAVPGAAE------------LHGIMDKGLPLVLLTNYPSQTGQDLANRFATAGVDVPDSVFAMATADFLRRQEGKKAYVVGEGALIHELYKAGFTIFVIVGETRSYNWDMMHKAALCAGIEKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLSGVSSLDDIDSPFRPSWIYPSVAEIDVI.................. 250
10 -22.900[P] KOG2882 p-Nitrophenyl phosphatase  ali follow..  16  39.FDSVITDCDGVLWIYGQALEGSVDNQLKGMGKSIYFCTNNSTKTRSELLKKGVELGFHIKENGIIST----------AHATAAYLKRRNFSKRVF-GSEGITKELDAVGIQHAVVVGFDEHFSFPKMMKASFVRAIQTCAERDPVVIGKPNPAICESLVTEKKIDPSRTLMIGDRANTDILLGFNCGFQTLLVGSGIHQLKDVEKKLIPDVYLPKLGDLLPSIVNSLTDLK......... 330
11 -22.800[R] COG5610 Predicted hydrolase (HAD superfamily)  ali follow..  15  15.YDVISFDIFDTLLLRPFIKP---TDLFLYIETKYNIKGFHQARILAEMQSRKLSKRQDITLDEIYHQIPKEFHSYKGVEIATEK-----EVLVPNLEMLELYRFAKENNKRVIIVSDMYLPLEVLELISKGF-DGYTNFYLSNHIMLTKHSKDLFKHVLKQENITNTQILHIGDNSWADDAMPKSLGIATLFRKS............................................. 202
12 -21.100[R] KOG2961 Predicted hydrolase (HAD superfamily)  ali follow..  20  178.FKGVVFDKDNTLTAPYSL--------------------------------------------------------------------------AIWPPLRPSIERCKAVGHDIAVFSNSAGLTEYDH-DDSKAKALEAEIGIRVLRHRVKKPAGTAEEVEKHFGCTSSELIMVGDRPFTDIVYGNRNGFLTVLTEPLSRAEEPFIVRQVRRLELALLKRWLR--KGLKPVDHSLVSDITQF 341
13 -20.300[E] COG4359 Uncharacterized conserved protein, possibly involved in methylthioadenosine recycling  ali follow..  12  1MVKAVIFDFDGTVTLEDSNDYLTDTLGFGK--------------EKRLKVFEGVLDDTKSFRQGFMEMLES------IHTPFPECIKILEKKIRLDPGFKDTFEWAQENDVPVIVVSSGMKPIIKVLLTRLVGQESIHKIIVSNEVEIDAHDQWKIIYSTLKAGEQRPVYFYCGDGV-SDLSAAKECDL--LFAKRGKDLVTYCKKQNVPFHEFDTFKDILASMKQVLAGEKTVAELMEN. 241
14 -20.100[E] COG0241 Histidinol phosphatase and related phosphatases  ali follow..  20  6..KILFIDRDGTL----------------------------------------------------------------IVEPPVDFQVDRLDKLKLEPYVIPSLLKLQEAGYRLVMVTNAPHNMMMDIFESQGVK--FNDVLIRDNCSCRKPKLGLVKEYLQGGKVDFKSSAVIGDRM-TDLQLAENMAIRGIQYHPQT........................................... 154
15 -17.300[E] COG0560 Phosphoserine phosphatase  ali follow..  18  76..RVLAMDMDSTLITIECIDEIA---------------DFCGLKPQVAAITEASMRGEIKDFNESLTRRVELLKGLDASVLERVY----AERLQLSPGAEHMLKAVQALGIRTLLVSGGFDFFTSRLQERLGLDRTRANTLVLGEIVNADVKAQTLKAFCHDLGVTPQEAIAMGDG-SNDLKMMGAAGLSVAF-----RAKPIVQAQADVAFNVVGLDGLLNLFP................ 283
16 -17.200[E] KOG1615 Phosphoserine phosphatase  ali follow..  13  57..DAVCFDVDSTVCQDEGIDELA---------------AYLGVGEAVANVTRTAMNGNARFRDALAARLQV------MKPNHEQLEQFVNISPKLTVGIRELVSRLHARGTHVYLVSGGFRRLILPVAELLGISRIYANEILFDKFGKDSGSKELKSSITNLFGYNYKTVVMVGDGA-TDVEASPPADAFIGF----GGNVIREGVKARAKWYVTDFDVLRKDLDHDESD........... 286
17 -17.000[R] KOG3120 Predicted haloacid dehalogenase-like hydrolase  ali follow..  12  1MAKIVILDFDRTLIDGDSD-----NWVVTEMGLTEIFHQLRFTLP-------------------WNRLMDRMMMELQSQGRSIDDIKSCLKKMPIDSHIIEAIKSAKSSGCDLKIVSDANQFFIEKILEHHDLVDCFSEIYTNPPSNLCKGLVMDHLRASSSNDQIPRRFIYLGDG-GGDFCPTLKLRECDFVMPRTNYPLWKKISDNPLLIKASSAEEQQRILLQLVSTITKEED..... 244
18 -16.700[C] COG4229 Predicted enolase-phosphatase  ali follow..  12  19.YSTYLLDIEGTVCPISFVKETLFPYFTNKVPQLVQQDTRDSPVSNILSQFHI--DNKEQLQAHILELVAKDVKDPILKQLQGYVWAHGYESGQIKAPVYADAIDFIKRKKRVFIYSSGSVKAQKPAHDSLDLNSYIDGYFDINTSG-KKTETQSYANILRDIGAKASEVLFLSDNP-LELDAAAGVGIATGLASRPGNAPVPDGQKYQ---VYKNFETL..................... 241
19 -15.000[E] KOG2630 Enolase-phosphatase E-1  ali follow..  14  8.FNALLLDIEGTITSISFVKDELFPYAFENVGNYLEEHDNPATQIIVEDLRHIADQQAENDVAVVRIREPRKECIEDVTKNVRHWIKRDKKKGHVYPDVLPVLKIVENRKIPIYIYSSGSVHAQKLLFANSILYGYFDTNI-------LKGESNSYTKISERIKIPPSEILFLTD-VEAEAAAAKKAGLQTKLVVRPGNAGLT-QEAINAYGTIETFLNI..................... 263
20 -14.900[R] COG3700 Acid phosphatase (class B)  ali follow..  13  65...AVGFDIDDTVLFSSPGFWRGKKT-----------SPDSDDYLKNPAFWEK-------------------------------MNNGWDEFSIPKEVARQLIDMHVRRGDSIYFVTGTKTETVSKTLADNFHIPAANMNPVIFAGDKPEQNTK------VQWLQEKNMRIFYGDSD-NDITAARDCGIRGI................................................. 208
21 -14.500[R] COG4996 Predicted phosphatase  ali follow..  15  3....IALDLDGTVWDH----------------------------------------------------DISSLYPPFKRVSPLKIQDNRGAEVTLRKHVRDFLQWARNSGHIITTLSWNDFQVAYQALRAFEIDAYFHYLVIEPHPRKDKMLYYLLRRIKAEVEIKPQDIVYIDDRDIH.............................................................. 128
22 -13.200[R] KOG4549 Magnesium-dependent phosphatase  ali follow..  14  9..KCVVFDLDYTLWPLWIDTHVT----------------------------------------------------KPSKNDPGVLIDKYGTEICFYSDITGILQELRNQKVTLCVASTCAPKYAKQALNLMKVPIDGSLKPAIEFFTYVKSKMDHFKEIHNESGIDYREMVFFDDESRN--REVERLGVTFCLVPDG............................................ 157
23 -12.800[R] COG1778 Low specificity phosphatase (HAD superfamily)  ali follow..  14  26.IRLLILDVDGVLSD---------------------------------LIYMGNNGEELKAFNVR-------------------------------------IRCALTSNIEVAIITGRKAKLVEDRCATLGIVHLYQ----------QSNKLIAFSDLLEKLAIAPENVAYVGDDL-IDWPVMEKVGLSVAVADAHPLLIPRADYVTHIAGGRGAVREVCDLLLLAQGKLDEA....... 183
24 -12.800[R] COG2503 Predicted secreted acid phosphatase  ali follow..  21  53..PAVILDLDETVLNTFDYAGYLIKN--------------IKYTPETWDKFEKEGS------------------------------------LTLIPGALDFLEYANSKGVKIFYISNRTQKNKAKTLKSFKLPQVSEESVLLKEKGKPKAVRR------ELVAKDYAIVLQVGDTL-HDFDAI......................................................... 181
25 -12.200[R] COG4087 Soluble P-type ATPase  ali follow..  16  1MKVAIVFDSAGTLVKKKGRALVIIKEDPLKVVDKENPEKLISDLLKEVEIGISYCNPPINREGIFKDRKTKVKELQEPLNILKRYEVETGYGSALIKEVKETIKQLKDLGVKVFIASGDRKGFIKRLAEITGVDERY---IMAEAHQELKRD------LIRNLKKEGYFTIMVGDGA-NDVPAMIESDLAVVTLQNGNVSRRALET---ADIKIYNIKEIVDICKKVINGE.......... 262
26 -11.700[S] COG5663 Uncharacterized conserved protein  ali follow..  12  1.MLRLGIDIDGTITAQDTFVPYLNRSFNLSI--------------------------SLNDMTDYDLTKLLNITQEEFWDWMNQNEAIIYKEALLAQHAKQSLDLLKEEH-KLIYITARRTHLTDITYEWFDRQNIYDHIELVGGHHKVE--------AVKNHNID----LFFEDHHGNAMMIAKEAGIPVILFNSPYNQLPIDSN-----IRVNNWLEAVQWMNNNKHHLIRVNN..... 193
27 -11.600[R] KOG1618 Predicted phosphatase  ali follow..  13  18...GFLLDIDGVLVRGHRVIPAALKAF------RRLVNSQGQLRVPVVFVTNAGNILQHSKAQELSALLGCEVDADQVSHSPMKLFSEYHEKRMLVSGQGPVMENAQGLGFR--LLSNGMAEAKMPRFGHGTFLLCLETIYQKYEGLMGKPSILTYQYAEDLIAAPIRKLYAVGDNPMSDVYGANLFHLQKATHDGAPELGAGGTRQQQPSASQSCISILVC................... 332
28 -11.000[S] COG4502 Uncharacterized protein conserved in bacteria  ali follow..  15  1MKKVIAIDMDQVLADLLSDWVAYINTYDDPFLKEK------------------------------ILCWDIKKYTNTNNNVYRHLDYDLFRNLNVIEGSQRVTKELMK-KYEVYVVTTATNHPDSLKAKLEWLTEYFPFI------------------PHSNVVLCGNKNIIKADIMIDDIHNLESFEGMKILFDAPHNRNENRFI------RVMNWEEIERKL................. 171
29 -9.550[G] COG1877 Trehalose-6-phosphatase  ali follow..  11  16...AWFFDLDGTLAEIPDNILQGLQLLATASDGALALISGRSMVELDALAKPYRFPLAGVHGAERRDINGKTHIVHLPDAIARDINVQLHTVIAQYPGAE-----LETKGMAFALHYRQAPQHEDALMTLAQ-----KCVVEIKPRGTSK---EAIAAFMQEAPFIGRTPVFLGDDLTDEFAVVNRLGGMSVKIGTG---------ATQASWRLAGVPDVWSWLEMITTALQQKRENNRS. 256
30 -9.020[R] COG3769 Predicted hydrolase (HAD superfamily)  ali follow..  11  6QPLLVFSDLDGTLLDSHSYDWQPAAPWLSRLREANVPVILCSS-KTSAEMLYLQKMLGLQGLPLIAENGAVIQLAEQWQEIDG---FPRIISGISHGEISQVLNTLREKHFKFTTFDD-WTGLSRSQAALTQLHEASVTLIWRDS-SAGKDQANWIIATYQQLSGKRPTTLGLGDG-PNDAPLLEVMDYAVIVKGLNREGVHLHDEDPARVWRTQREGPLDHFFSA............... 270

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.