current user: public




2hoqA
Query: 2hoq_A mol:protein length:241 Putative HAD-hydrolase PH1655, from PDB1009

Results of FFAS03 search in COG1009
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst MVKVIFFDLDDTLVDTSKLAEIARKNAIENMIRHGLPVDFETAYSELIELIKEYGSNFPYHFDYLLRRLDLPYNPKWISAGVIAYHNTKFAYLREVPGARKVLIRLKELGYELGIITDGNPVKQWEKILRLELDDFFEHVIISDFEGVKKPHPKIFKKALKAFNVKPEEALMVGDRLYSDIYGAKRVGMKTVWFRYGKHSERELEYRKYADYEIDNLESLLEVLARESSSNKKVHPPRQQILast
1 -68.800[R] KOG3085 Predicted hydrolase (HAD superfamily)  ali follow..  19  5RVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIIECFHPYNTCITDLRTSHWEEAIQETKGGANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRK-EVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPL-KSSPVPHYMVSSVLELPALLQSIDCKVSMST...... 248
2 -65.400[R] COG0546 Predicted phosphatases  ali follow..  24  8.VQAVAFDLDGTLCDSVPDLAAAAEAMLEQLGMKPLPAK---------VVESYVGDGIGKLVHRVLTEADSELWEKGFVSYMKYYRDHLSVFTRPYPETEAGLALLKSLGIPLAVITNKNEILAAELLKQLGLADYFSLILGGDSLPEKKPSPLPLRHAAEVLGIDVANMVMVGDS-RNDIIAAKAAGCLSVGVTFGYGDMTLLSQATRPDWIIGSLPEIYENLQPQKNKEE......... 235
3 -56.300[R] KOG3109 Haloacid dehalogenase-like hydrolase  ali follow..  19  11.YECLLFDLDDTLYPLSSGLSDACSNNIIEYMVEKLGIDEDGVVELNQILYKKYGTSMAGLKAVGYEFDNDEYHRYVHGRL----------PYENLKPDPVLRSLLLGLPLRKLVFSNGDEVHVMKALTRLGIEDCFERIISFETLVICKPTEIAFEKAFDIAQLNPHKTLFFDDST-RNIQTGKAVGLHTVLVGKSEKIDG-------SDYALESIHNMKEAFPELWSESIINNKETERI 252
4 -51.000[C] COG4229 Predicted enolase-phosphatase  ali follow..  11  19.YSTYLLDIEGTVCPISFVKETLFPYFTNKVPQLVQQDTRDSPVSNILSQFHIDNKEQAHILELVAKDVKDPILKQLQGYVWAHGYESGQIKAPVYADAIDFIKRKKRVFIAQKLLFGYVQDPNAPAHDSLDLNSYIDGYFDINTSG-KKTETQSYANILRDIGAKASEVLFLSDN-PLELDAAAGVGIATGLAS---RPGNAPVPDGQKYQVYKNFETL..................... 241
5 -47.500[R] COG0637 Predicted phosphatase/phosphohexomutase  ali follow..  15  3QIEAVFFDCDGTLVDSEVICSRAYVTMFRQFGITLELTEV---------FRRFKGVKLYEIIDTISKEHGVALAAELEPVYRAEVARLFDTELEAIAGANTLLESI---KTPMCVVSNGPVSKMQHSLGKLGMLHHFDLLFSGYDIQRWKPDPALMLHAANAMKVNVEKCILVDDSS-AGAQSGIAAGMEVFYFC---ADPHNKPIDHPNVTTFTDLAQLPGLWKARGWEITR........ 221
6 -43.900[R] COG1011 Predicted hydrolase (HAD superfamily)  ali follow..  16  6AKMLYIFDLGNVIVDIDF--NRVLGTWSDLTRIPLATLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVF------VALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNAD-NIEGANQLGITSILVKDKTTIPDYFAK................................... 203
7 -42.000[R] COG5610 Predicted hydrolase (HAD superfamily)  ali follow..  16  14KYDVISFDIFDTLLLRP---FIKPTDLFLYIETKYNIKGFHQARILAEMQSRKLSKRQDITLDEIYHQI-----PKEFHSYKGVEIATEKEVLVPNLEMLELYRFAKENNKRVIIVSDMPLEVLEDILISKGF-DGYTNFYLSNHIMLTKHSKDLFKHVLKQENITNTQILHIGDNSWADDAMPKSLGIATLFRK---SVLKQLEEVFPKYKTFNPTSVAQSFILGSLCVFYKNYIQKHE. 243
8 -39.500[R] KOG2914 Predicted haloacid-halidohydrolase and related hydrolases  ali follow..  20  1........MDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLV----------MGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHEFFSLFSHIVLGDDVQHGKPDPDIFLACAKRFSPPPEKCLVFEDAP-NGVEAALAAGMQVVMVPDGNLSRDLTT---KATLVLNSLQDFQPELFGL.............. 210
9 -39.000[R] COG2179 Predicted hydrolase of the HAD superfamily  ali follow..  19  28.IKAVLVDLDNTLIAW--------------------------------------------------------------------------NNPDGTPEMKQWLHDLRDAGIGIIVVSNNTKKRVQRAVEKFGIDYVYWA---------LKPFTFGIDRAMKEFHYDKKEVVMVGDQLMTDIRAAHRAGIRSILVKPLVQHDSIKTQRTRERRVMRKITEKYGPIT................ 170
10 -38.800[R] COG4996 Predicted phosphatase  ali follow..  17  1ML--IALDLDGTVWDHH---------------------------------------------------DISSLYPPFKRVSPLKIQDNRGAEVTLRKHVRDFLQWARNSGHIITTLSWNDFQVAYQALRAFEIDAYFHYLVIEPHPRKDKMLYYLLRKAERGVEIKPQDIVYIDDR-DIHIREIWENIGPVRFIQFGIDVKCFLE.................................... 153
11 -36.900[R] KOG4549 Magnesium-dependent phosphatase  ali follow..  12  7FPKCVVFDLDYTLWPLWIDTHVTAPF-------------------------------------------------KPSKNDPGVLIDKYGTEICFYSDITGILQELRNQKVTLCVASTCAPKYAKQALNLMKVPIDGSLKPAIEFFTYVKSKMDHFKEIHNESGIDYREMVFFDDE-SRNREVER-LGVTFCLVPDGLNRASFEQG-------INKWRKLKKT.................. 176
12 -31.000[E] KOG2630 Enolase-phosphatase E-1  ali follow..  12  8.FNALLLDIEGTITSISFVKDELFPYAFENVGNYLEEHYDNPATQIIVEDLRHIADQQAENDVAVVNIFQLTPMKALQGLIWEEAYQRGDVKGHVYPDVLPVLKIVENRKIPIYIYSSGSVHAQKLLFANSIEGDMTKILYGYDTNIGLKGESNSYTKISERIKIPPSEILFLTDV-EAEAAAAKKAGLQTKLVVRPGNAGLT-QEAINAYGTIETFLNIQNSEFEFRMIIRCFQNLNQS. 283
13 -30.800[R] KOG2961 Predicted hydrolase (HAD superfamily)  ali follow..  11  75.DSFLLYQFSSPTEDPGFSNRIPEQFDGEPRELVLPRVEDNNKGLAISSNMWWADEGIVSSVSVVVKDRQFVLPHVSVKDLRYIDWEVLKRKLAIWPPLRPSIERCKAVFGHDIAVFSNSAGLTEYDHDDSKAKALEAEIGIRVLRHRVKKPAGTAEEVEKHFGCTSSELIMVGDRPFTDIVYGNRNGFLTVLTEPLSRAEEP--------FIVRQVRRLELALLKRWLRKGLKPVDHSLV 335
14 -30.700[G] COG0647 Predicted sugar phosphatases of the HAD superfamily  ali follow..  14  3.IKNVICDIDGVLMHDNVAVPGAAEFLIMDKGLPLVLLTNYPSQTGQDLANRFATAGVDVPDSVFYTS----------AMATADFLRRQEGKKAYVVGEGALIHELYKAGFTITIATNPDTHGRGFYPACGALCAGIEKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLSGVSSLDDIDSPFRPSWIYPSVAEIDVI.................. 250
15 -29.800[S] COG5663 Uncharacterized conserved protein  ali follow..  12  1.MLRLGIDIDGTITAQDTFVPYLNRSFNLSISLNDMTDYDLTKL--------------------------LNITQEEFWDWMNQNEAIIYKEALLAQHAKQSLDLLKEEHKLIYITARRTTDITYEWFDRQNIHYDHIELVGGHH----KVE------AVKNHNID----LFFEDHHGNAMMIAKEAGIPVILFNSPYNQLPIDS----NIIRVNNWLEAVQWMNNNKHHLIRVNN..... 193
16 -29.500[R] KOG3040 Predicted sugar phosphatase (HAD superfamily)  ali follow..  17  3.IKGALIDLSGTLHVEDEPTPNAVEALHERLCRIGFQLDASEIYSSLSAAVSYVENERLNPYYILSEDARQDFPPEDTRRYKDSVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEGLALGPGCFVKGLTGRTAKVIGKPNPYFFEGALA--GRDPASCVMIGDDANDDIVGAMSMGMQGILVKTGKYLPDVKP-SPPPTALLENFAEAVDWIIQKNQS........... 255
17 -27.400[P] KOG2882 p-Nitrophenyl phosphatase  ali follow..  16  39.FDSVITDCDGVLWIYGQALEGSVDVMLKGMGKSIYFCTNNSTKTRSELLKKGVELGFHIKENGIIST---------AHATAAYLKRRNFSKRVFVIGSEGITKELDAVGIQHAVVVGFDEHFSFPKMMKASFVRAIQTCAERDPVVIGKPNPAICESLVTEKKIDPSRTLMIGDRANTDILLGFNCGFQTLLVGSGIHQLKDVEKKLIPDVYLPKLGDLLPSIVNSLTDLK......... 330
18 -27.000[S] COG4502 Uncharacterized protein conserved in bacteria  ali follow..  15  1MKKVIAIDMDQVLADLLSDWVAYINTYDD-----------------------------PFLKEKDILCWDIKKYTNTNNNVYRHLDYDLFRNLNVIEGSQRVTKELMKKY-EVYVVTTATNHPDSLKAKLEWLTEYFPFIPHSN-------------VVLCGNKNIIKADIMIDDGIH-NLESFEGMKILF---------DAPHNRNENRFIRVMNWEEIERKL................. 171
19 -25.300[R] KOG3120 Predicted haloacid dehalogenase-like hydrolase  ali follow..  13  1MAKVILFDFDRTLIDGD-----SDNWVVTEMGLTEIFHQLRFTLPWNRLMDRMMME--------------------QSQGRSIDDIKSCLKKMPIDSHIIEAIKSAKSSGCDLKIVSDANQFFIEKILEHHDLVDCFSEIYTNPPSNLCKGLVMDHLRASSSNDQIPRRFIYLGDGG-GDFCPTLKLRECDFVMPRTNYPLWKKISDNPLLIKAESAEEQQRILLQLVST........... 238
20 -25.200[E] COG0241 Histidinol phosphatase and related phosphatases  ali follow..  17  6..KILFIDRDGTLIVEPP----------------------------------------------------------------VDFQVDRLDKLKLEPYVIPSLLKLQEAGYRLVMVTNQDHNMMMDIFESQGVK-LICPHFERDNCSCRKPKLGLVKEYLQGGKVDFKSSAVIGDRM-TDLQLAENMAIRGIQYHPQT........................................... 154
21 -24.600[E] COG4359 Uncharacterized conserved protein, possibly involved in methylthioadenosine recycling  ali follow..  14  1MVKVIFTDFDGTVTLED-----SNDYLTDTLGFGK---------EKRLKVFEGVLDDTKSFRQGFMEML------ESIHTPFPECIKILEKKIRLDPGFKDTFEWAQENDVPVIVVSSGMKPIIKVLLTRLVGQESIHKIIVSNEVEIDAHDQKKKFESTLKAGEQRPVYFYCGDGV-SDLSAAKECDL--LFAKRGKDLVTYCKKQNVPFHEFDTFKDILASMKQVLAGEKTVAE..... 237
22 -22.800[E] COG0560 Phosphoserine phosphatase  ali follow..  16  76..RVLAMDMDSTLITIECIDEIADFCGLKPQVAAITEASMRGEIKDFNESLTRRVELLKGLDASVLERV-------------------YAERLQLSPGAEHMLKAVQALGIRTLLVSGGFDFFTSRLQERLGLDRTRANTLVLGEIVNADVKAQTLKAFCHDLGVTPQEAIAMGDG-SNDLKMMGAAGLSV-----AFRAKPIVQAQADVAFNVVGLDGLLNLFP................ 283
23 -21.500[E] KOG1615 Phosphoserine phosphatase  ali follow..  14  57..DAVCFDVDSTVCQDEGIDELA---------------AYLGVGEAVANVTRTAMNGNARFRDALAARLQV-----MKPNHEQLEQFVNISKPKLTVGIRELVSRLHARGTHVYLVSGGFRRLILPVAELLGIEK--FGKYHGFDTSLFGPTGKPAVIALLKKMYNYKTVVMVGDGA-TDVEASPPADA---FIGFGGNVIREGVKA-RAKWYVTDFDVLRKDLDHDESDIDD........ 289
24 -20.200[R] KOG1618 Predicted phosphatase  ali follow..  14  16.TFGFLLDIDGVLVRGHRVIPAALKAF------RRLVNSQGQLRVPVVFVTNAGNILQHSKAQELSALLGCEVDADQVHSPMKLFSEYHEKRMLVS-GQGPVMENAQGLGFRNGVLLLGEPVRWETSLQLICLETIYQKVTGKYEGLMGKPSILTYQYAEDLIRAPIRKLYAVGDNPMSDVYGANLFHQYLQKATHDGAPELGAGGTQQPSASQSCISILVC................... 332
25 -19.000[R] COG3700 Acid phosphatase (class B)  ali follow..  17  64..MAVGFDIDDTVLFSSPGFWRGKKTY------------------------------------------PDSDDYLKNPAFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDSIYFVTGRSQTKTETVSKTLADNFHMNPVIFAGDKPEQNTK----VQWLQEKNM----RIFYGDSD-NDITAARDCGIRGIRI............................................... 210
26 -16.200[G] COG1877 Trehalose-6-phosphatase  ali follow..  10  15..YAWFFDLDGTLAEIKPHVPDNILQGLQLLATASDGALALISGRSMVELDALAKDAIARDINVQLHTVIAQYPGAELETKGMAFALHYRQAPQHEDALMTLAQRITQIWPQMALQQG-------------------KCVVEIKPRGTSK---EAIAAFMQEAPFIGRTPVFLGDD-LTDESGFAVVNRLGGM------SVKIGTGATQASWRLAGVPDVWSWLEMITTALQQKRENNRS. 256
27 -15.500[R] COG2503 Predicted secreted acid phosphatase  ali follow..  20  53..PAVILDLDETVLNTFDYAGYLIKN-------------------------------------------CIKYTPETWDKFEKE------GSLTLIPGALDFLEYANSKGVKIFYISNRTQAFTLKTLKSFKLPQVSEESVLLKEKGKPKAVRR------ELVAKDYAIVLQVGDTL-HDFDAIFAKDAKNS................................................. 189
28 -15.200[R] COG1778 Low specificity phosphatase (HAD superfamily)  ali follow..  15  26.IRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY-----------------------------------------------------------------GIRCALTSNIEVAIITGRKAKLVEDRCATLGIVHLYQGQ---------SNKLIAFSDLLEKLAIAPENVAYVGDDL-IDWPVMEKVGLSVAVADAHPLLIPRADYVTHIAGGRGAVREVCDLLLLAQGKLDEA....... 183
29 -13.900[R] COG3769 Predicted hydrolase (HAD superfamily)  ali follow..  13  6QPLLVFSDLDGTLLDSHSYDWQPAAPWLSRLREANVPVCSSKTSAEMLYLQKMLGLQGLPLIHGEISQVLNTLREKEHFKFTTFDDVDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERMAQFTARLN-ARFWHVL----DASAGKDQANWIIATYQQLSGKRPTTLGLGDG-PNDAPLLEVMDY-AVIVKGLNREGVHLHDEDPARVWRTQREGWREGLDHFFSAR.......... 271
30 -13.800[R] COG4087 Soluble P-type ATPase  ali follow..  14  1MKVAIVFDSAGTLVKIMRVIKDDIVDKKKGRALVIIKEDPLKVVDNPEKLISDLLKEVEIGISGIFKDRKTKVKELQEPLNILKRYEVETGYGSLFKEVKETIKQLKDLGVKVFIASGDRKGFIKRLAEITGVDER----IMAEAHQELKRD------LIRNLKKEGYFTIMVGDGA-NDVPAMIESDLAVVTLQNGNVSRRALET---ADIKIYNIKEIVDICKKVINGEIKGR...... 266
31 -13.400[R] COG0561 Predicted hydrolases of the HAD superfamily  ali follow..  13  3.VKVIVTDMDGTFLNDVKTYNQPFMAQYQELKKRGIEFQLISFFPELKDEISFVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLPVKDYQEIDDVLFKFSLNLPDEQIPLVIDKLHIALDGIMKPVTSGDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDS-GNDAEMLKMARYSFAM------GNAAENIKQIARYATDDNNHALNVIQAVLDNTSPFNS..... 271
32 -13.200[I] KOG3189 Phosphomannomutase  ali follow..  13  12PKTLVLFDVDGTLTPARLSVSPEMLETLQNLRKVAIGFVGGSDLSKQQEQLSVNGENVIDSFDYAFAEASQSFIAWLGEEKYQKLVNFCLHYIADLDIPVKRGTFIEFRNGMINISPVGRNANTEERNEFETMVDVLREKFKDYGLTFSIGGQISFDYCLQHVKEGFDTIHFFGDKTYNDYEIFVDPRTIGHSVT-------------NPDDTIAELKKIFNI.................. 257
33 -13.100[K] KOG1605 TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation)  ali follow..  17  288..FSLVLDLDETLVHCSLNELEDAALTFP----------------------------------------------------VLFQDVIYQVYVRLRPFFREFLERMSQ--YEIILFTASKKVYADKLLNILD-KQLVRHRLFREHCVCVQGN---YIKDLNILGRDLSKTIIIDNSPQAFAYQLSNG----IPIESWFMDKND-----------NELLKLIPFLEKLVELNEDVRP..... 451
34 -12.600[K] KOG2832 TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation)  ali follow..  16  191..FTLVLDLNETLLYTDWKRERGWRTFKR-------------------------------------------------------------------PGVDAFLEHLGKF-YEIVVYSDQMEMYVLPVCEKLDPNGYIRYKLARGATKYENGK---HYRDLSKLNRDPKKILFVSANAFESTLQPENS----VPIKPYKLEADD-----------TALVDLIPFLEYVARNSPA........ 335
35 -12.300[S] COG4030 Uncharacterized protein conserved in archaea  ali follow..  10  1...MFFTDWEGPWILTDFALELCMAVFNNARFFSNLSEYDDYLAYEVRREGYEAGYTLKLLTPFLAAA----------GVKNRDVERIAELSAKFVPDAEKAMATLQERWTPV-VISTSYTQYLRRTASMIGVRGELSIAVPEGLREEAGEKAKIMRGYCESKGI--DFPVVVGDSI-SDYKMFEAAR-GLGGVAIAFNGNEYALKHADVAIISPTAMSEAKVIELFMERKERA....... 264
36 -12.000[Q] COG3882 Predicted enzyme involved in methoxymalonyl-ACP biosynthesis  ali follow..  17  258..KVLALDLDNTLWG-----------VIGDDGVTGIQLSNE-------------------------------------------------FPGNQFKTLQQLIVKLYKQGVLLTIASKNDWRNVKDVFTKN------HMIITEEMLTQISPKTDSLRKMAKQLNLGLDSFVFADDH................................................................. 371
37 -10.500[K] KOG0323 TFIIF-interacting CTD phosphatases, including NLI-interacting factor  ali follow..  11  196...KQYIDNDYAFDNGV-----------------------------LLKAQPEEVRPTSDGQEKVCRPVIRLPEKNTVLTRIKPEIRDTSVLVKLRPAWEELRSYLTAKTFEVYVCTMAERDYALEMWRLLDPEAHLLKELRDRIVCVKPDAKKSLLSVFNGGICHPKMAMVIDDRMKV.............................................................. 347
38 -10.400[K] COG5190 TFIIF-interacting CTD phosphatases, including NLI-interacting factor  ali follow..  17  165..LSLIVDLDQTIIHATVDPTVGEWMSDPGNVNYDVLRDVRSFNLQEGP-------------------------------------YTSCYYIKFRPGLAQFLQKISEL-YELHIYTMGTKAYAKEVAKIID-----TGKLFQDRVLSRDDSGSLAQKSLRRLPCDTSMVVVIDDRGDV.............................................................. 302
39 -9.800[S] COG4850 Uncharacterized conserved protein  ali follow..  12  146...GLISDIDDTIMVT----------------------------------------WLPRALLAAWNSWVLHTNTR-----------------KPVPGMNRFYEELLKDDAPVFYLSTGAWNTFETLQEFINKHALPDGPMLLTDWGFRSGQEHKKVQLRNLFIEYPDKWILVGDDGQHDPLIYGEAVIAGVAIR-SLSTITTNGGQGVPVVHGRDGYELLQRYETK.............. 341
40 -9.490[P] COG2216 High-affinity K+ transport system, ATPase chain B  ali follow..  12  301.VDVLLLDKTGTITLGNRQASEDAAQLASLADETPEGRSIVILAKQIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEAT---------PEAKL--ALIRQYQAEGRLVAMTGDGT-NDAPALAQADV-AVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGS........ 574
41 -9.050[P] COG2217 Cation transport ATPase  ali follow..  15  410.LSTVIFDKTGTLTRGEPSVTDRLAAAVEAGSEHPLGEAIVRAARHNRRLFREQGYQINPATEEILTRLESDGKTAMLVGCNGLLMGIVAVADTIKPEAKEAIAALRREKVKVVMLTGDNQRTAEAIARQLGIDKVIAEVL-----------PGDKAQVVKDIQRRGEVVAMVGDGV-NDAPALATADI-------GIAIGSGADVAKETGGIILVKNDVRDVVTSIRLSRATMLKIKQNL 674

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.