current user: public




1o6sA
Query: 1o6s_A mol:protein length:466 INTERNALIN A, from PDB0709

Results of FFAS03 search in PDB0709
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .
# Score Template Links and tools%idFirst GPLGSATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKALast
1 -99.3001o6s_A mol:protein length:466 INTERNALIN A  ali model  100  1GPLGSATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA 466
2 -59.5001h6u_A mol:protein length:308 INTERNALIN H  ali model follow..  40  2...............................................................................................................................................................SITQPTAINVIFPDPALANAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVQYLNNLIGLELKDNQITDLAPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASLPNLIEVHLKNNQISDVSPLANTSNLFIVTLTNQTITNQPVFYNNNLVVPNVVKGPSGAPIAPATISDNGTYASPNLTWNLTSFINNVSYTFNQSVTFKNTTVPFSGTVTQPLT. 307
3 -54.3002z63_A mol:protein length:570 Toll-like receptor 4, Variable lymphocyte rec  ali model follow..  18  29.STKNLDLSFNPLRHLGSSFFSFPELQVLDLSRCEIQTIEDYQSLSHLSTLILTGNPIQSLALFSGLSSLQKLVAVETNLASLENIGHLKTLKELNVAHNLIQSFKLFSNLTNLEHLDLSSNKIQSIYCLRVLHQMPLLNLSLDLSLNQPGAFKEIRLHKLTLRNNFDSLN-IQGLAGLEVHRLVLGEFRNIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTL-KLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKQSDFGTTSLKYLDLSFNGVITMSSFLGLEQLEHLDFQHSNLKQMSEFLSLRNLIYLDISHTHTRVAFNFNGLSSLEVLKMAGNSFQENFLFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMASNQLKPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRW--LNKNSQKEQGSAKCSGSG 561
4 -53.6002z81_A mol:protein length:549 Toll-like receptor 2, Variable lymphocyte rec  ali model follow..  14  6.ASGVCDGRSRSFTS---PSGLTAAMKSLDLSFNKITYIGHLRACANLQVLILKSSRINTIDAFYSLGSLEHLDLSDNHLSSLSSFGPLSSLKYLNLMGNPYQTLGVFPNLTNLQTLRIGNVETFSEIRFAGLTSLNELEIKALSLRNYQSLKSIRDIHHLTLHLSESAFLLADILSSVRYLELRDTNLARFSPLPVDEVSSPMKKLAFRGSVLTDFNELLKLLRYILELSEVEFDDGKVETVTIRRLHIPQFYLFYDLSYSLLEKVKRITVENSKVFLVPCSQHLKSLEFLDLSENLMVEEYLKGAWPSLQTLVLSQNHLRSMQKLLTLKNLTSLDISRNTFHPMPDCQWPEKMRFLNLSSTGIRVVKT-CIPQTLEVLDVSNNNLDSFSLF----LPRLQELYISRNKLKTLPDASLFPVLLVMKISRNQLKSVDGIFDRLTSLQKIWLHTNPWDCSCPR.... 515
5 -53.2002z7x_A mol:protein length:549 Toll-like receptor 2, Variable lymphocyte rec  ali model follow..  17  3...........................................SCDRNGICKGSSGSLNSIPS-GLTEAVKSLDLSNNRITYISNLQRCVNLQALVLTSNGINTIEEFSSLGSLEHLDLSYNYLSNLSSFKPLSSLTFLNLLGNPYKTLGEFSHLTKLQILRVGDTFTKIQRFAGLTFLEELEIDASDLQSYKSLKSIQNVSHLILHMKQHILLLEVDVTSSVECLELRDTDLDTFHGKVETLTIRRLHIPRFYLFYDLSYSLTERVKRITVENSKVFLVPCSQHLKSLEYLDLSENLMVEEYLEDAWPSLQTLILRQNHLASLEKLLTLKNLTNIDISKNSFHSMPECQWPEKMKYLNLSSTRIHSVTG-CIPKTLEILDVSNNNLNLFSLN----LPQLKELYISRNKLMTLPDASLLPMLLVLKISRNQLKSVDGIFDRLTSLQKIWLHTNPWDCSCPR.... 515
6 -52.0001h6t_A mol:protein length:291 INTERNALIN B  ali model follow..  36  5...................................................................................................................................................................................SETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNKPINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLK. 290
7 -51.3002uzx_A mol:protein length:289 INTERNALIN B  ali model follow..  36  2.................................................................................................................................................................................AMETITVP-TPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNKPINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLK. 288
8 -50.1002z64_A mol:protein length:599 Toll-like receptor 4  ali model follow..  18  28.STKNIDLSFNPLKILKSSFSNFSELQWLDLSRCEIETIEDWHGLHHLSNLILTGNPIQSFSPFSGLTSLENLVAVETKLASLESIGQLITLKKLNVAHNFIHSCKYFSNLTNLVHVDLSYNYIQTITVLQFLRENPSLDMSLNPIDFIQDAFQGIKLHELTLRGN-DDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLD-LPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGC--GTNSLRHLDLSFNGAIIMSAFMGLEELQHLDFQHSTLKRVTEFLSLEKLLYLDISYTNTKIDFDFLGLTSLNTLKMAGNSFKDNNVFANTTNLTFLDLSKCQLEQISWFDTLHRLQLLNMSHNNLLFLDSSHYNQLYSLSTLDCSFNRIEKGILQHFPKSLAFFNLTNNSVACICEHLQWVKEQKQFLVNVEQMTCATPVEMNT 588
9 -49.3003cig_A mol:protein length:697 Toll-like receptor 3  ali model follow..  19  26.NITVLNLTHNQLRRLPPNFTRYSQLAILDAGFNSISKLEPCQILPLLKVLNLQHNELSQIQTFVFCTNLTELDLMSNSIHKIKSFKNQKNLIKLDLSHNGLSSTKLGVQLENLQELLLAKNKILALRSFLGNSSLRKLDLSSNPLKEFSPFQTIGKLFALLLNNATEKLCWELSNTSIQNLSLANNQLLATSE--KWTNLTQLDLSYNNLHDVGNFSYLPSLRYLSLEYNNIQRLRSFYGLSNLRYLSLKRAFTKQSVSFQWLKYLEYLNMDDNNIPSTKS--AHSPLLTLNLTKNHISKIANFSWLGQLRILDLGLNEIEQKLSWRGLRNIFEIYLSYNKYLQLSSFALVPSLQRLMLRRVALKNVSPFRPLRNLTILDLSNNNIANINEDLLEGLENLEILDFQHNNLAPVNFLKGLSHLHILNLESNGLDEIVGVFKNLFELKSINLGLNNLNKLEPFIFDD 582
10 -49.3003fxi_A mol:protein length:605 Toll-like receptor 4  ali model follow..  19  29.STKNLDLSFNPLRHLGSSFFSFPELQVLDLSRCEIQTIEDYQSLSHLSTLILTGNPIQSLGAFSGLSSLQKLVAVETNLASLENIGHLKTLKELNVAHNLIQSFKYFSNLTNLEHLDLSSNKIQSIYCLRVLHQMPSLDLSLNPMNFIPGAFKEIRLHKLTLRNNFDSLNCIQGLAGLEVHRLVLGEFRNIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTL-KLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKQSDFGTTSLKYLDLSFNGVITMSSFLGLEQLEHLDFQHSNLKQMSEFLSLRNLIYLDISHTHTRVAFNFNGLSSLEVLKMAGNSFQENFLFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFDTFPYKCLNSLQVLDYSLNHIMTSKKQELQ-SSLAFLNLTQNDFACTCE..... 560
11 -49.3003bz5_A mol:protein length:457 Internalin-J  ali model follow..  21  4.........KAGQTQSFNDWFPDDNFASEVAAAFEMQATDTEEQLATLTSLDCHNSSITDMTGIEKLTGLTKLICTSNNITTL-DLSQNTNLTYLACDSNKLTNL-DVTPLTKLTYLNCDTNKLTKL-DVSQNPLLTYLNCARNTLTEID-VSHNTQLTELDCHNKKITKLDVTPQTQLTTLDCSFNKITELD-VSQNKLLNRLNCDTNNITKL-DLNQNIQLTFLDCSSNKLTEID-VTPLTQLTYFDCSVNPLTEL-DVSTLSKLTTLHCIQTDLLEI-DLTHNTQLIYFQAEGCRKIKELDVTHNTQLYLLDCQAAGITEL-DLSQNPKLVYLYLNNTELTELD-VSHNTKLKSLSCVNAHIQDFSSVGKIPALNNNFEAEGQTITMPKETLTNNSLPDLLDQFGNPMNIEPGDGGVYDQATNTITWENLSTNPAVTYTFTSENGAIVGTVTTPFEAPQPI.. 456
12 -49.1002a0z_A mol:protein length:705 Toll-like receptor 3  ali model follow..  18  31.NITVLNLTHNQLRRLPANFTRYSQLTSLDVGFNTISKLEPCQKLPMLKVLNLQHNELSQLKTFAFCTNLTELHLMSNSIQKIKNFVKQKNLITLDLSHNGLSSTKLQVQLENLQELLLSNNKIQALKSIFANSSLKKLELSSNQIKEFGCFHAIGRLFGLFLNNV-EKLCLELANTSIRNLSLSNSQLSTTSN-LKWTNLTMLDLSYNNLNVVGNFAWLPQLEYFFLEYNNIQHLHSLHGLFNVRYLNLKRSFTKQSISFQWLKCLEHLNMEDNDIPGIKS--AHSPLHILNLTKNKISKIESFSWLGHLEVLDLGLNEIGQELTWRGLENIFEIYLSYNKYLQLNSFALVPSLQRLMLRRVALKNVDSFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLAPIYFLKGLSHLHILNLESNGFDEIVEVFKDLFELKIIDLGLNNLNTLPASVFNN 587
13 -47.9001m9s_A mol:protein length:605 Internalin B  ali model follow..  22  1.....................................................................MGETITVSTPIKQIFPDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLTNLKNLGWLFLDNKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNKPIQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKEVYTVSYD-----------VDGTVIKTKVEAGTRITAPKPPTKQGYVFKGWYTEKNGGHEWNFNTDYMSGNDFTLYAVFKAETTEKTVNLTRYVKYIRGNAGIYK........ 381
14 -47.6002z7x_B mol:protein length:520 Toll-like receptor 1, Variable lymphocyte rec  ali model follow..  13  1.SEFLVDRSKNGLIHVPKDLSQ--KTTILNISQNYISELWTILSLSKLRILIISHNRIQYLSVFKFNQELEYLDLSHNKLVKI-SCHPTVNLKHLDLSFNAFDALPEFGNMSQLKFLGLSTTHLEKSSVLPNTESLHIVFPTNKEFHFILSVKTVANLELSNIKCVLED-ILAKLQTNPKLSNLTLNNIETTWQLVWHTTVWYFSISNVKLQGQLDFRDYSGTSLKALSIHQVVSIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFCGHLTELETLILQMNQLKELSKTTQMKSLQQLDISQNSVSYDEKCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKVVKLEALQELNVASNQLKSVP----------------------DGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRW--LNKNSQKEQGSAKCSGSG 511
15 -47.5001xeu_A mol:protein length:263 internalin C  ali model follow..  34  1..........................................................................................................................................................................................................ESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGI-PSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN 263
16 -46.7001otm_A mol:protein length:236 internalin B  ali model follow..  30  12..............................................................................................................................................................................GSHMASETITVSTPIKQIFPDAAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNKPIN......................................................................... 230
17 -43.8001g9u_A mol:protein length:454 OUTER PROTEIN YOPM  ali model follow..  16  12.FLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPNGEQREMAVSRLRDCL---------DRQAHELELNNLGLSSLPEL--PPHLESLVASCNSLTELPEPQSLKSLLVDNNNLKALSDLPP-----LLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLP-DLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDL--PLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDL--PPSLEALNVRDNYLTDLPEL--PQSLTFLDVSENIFSGLSEL--PPNLYYLNASSNEIRSL--CDLPPSLEELNVSNNKLIELPA--LPPRLERLIASFNHLAEVPEL--PQNLKQLHVEYNPLREFP----DIPESVEDLRMNSHLAEVPELP---QNLKQLHVETNPLREFPDIP---ESVEDLRMNSERVVDPYEFAHET 438
18 -39.2002id5_A mol:protein length:477 Leucine rich repeat neuronal 6A  ali model follow..  17  10............................................SAQDRAVLCHRKRFVAVPE-GIPTETRLLDLGKNRIKTLNQFASFPHLEELELNENIVSAVEPFNNLFNLRTLGLRSNRLKLIPLFTGLSNLTKLDISENKIVILLD-------------------YMFQDLYNLKSLEVGDNDLVYIRAFSGLNSLEQLTLEKCNLTSIPTLSHLHGLIVLRLRHLNINAIYSFKRLYRLKVLEISHWPYLDTMTCLYGLNLTSLSITHCNLTAVPYVRHLVYLRFLNLSYNPISTIEGLHELLRLQEIQLVGGQLAVVEPFRGLNYLRVLNVSGNQLTTLEEFHSVGNLETLILDSNPLACDCRLWVFRRRWRLNFNRQQPTCATPEFVQGKEFFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHL.......... 426
19 -39.1001xku_A mol:protein length:330 Decorin  ali model follow..  23  1.................................................................DEASGIGPEEHFPEVPEIEPFRCQCHLRVVQCSDLGLEKV-PKDLPPDTALLDLQNNKITEIKDFKNLKNLHTLILINNKISKISPFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRVFNGLNQMIVVELGTNPLKSSGAFQGMKKLSYIRIADTNITTIPQ-GLPPSLTELHLDGNKITKVDALKGLNNLAKLGLSFNSISAVDNLANTPHLRELHLNNNKLVKVPGLADHKYIQVVYLHNNNISAIGSNTKKASYSGVSLFSNPVQYWETFRCVYVRAAVQLGNYK...................................................................................................... 330
20 -35.8002ft3_A mol:protein length:332 Biglycan  ali model follow..  22  8.............................................................ETTSGIPDLDSLPPTYSAMC---PFGCHCHLRVVQCSDLGLKAV-PKEISPDTTLLDLQNNDISELRKFKGLQHLYALVLVNNKISKIHEFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVGVFSGLRNMNCIEMGGNPLENSGFEPGA-KLNYLRISEAKLTGIPK-DLPETLNELHLDHNKIQAIELLLRYSKLYRLGLGHNQIRMIENLSFLPTLRELHLDNNKLSRVPALPDLKLLQVVYLHTNNITK--------------VGVNDFCPVGFGVKRAYYNGISLFNNPVPYWETFRCVTDRLAIQFGNYK................................................................................ 331
21 -34.8003g06_A mol:protein length:622 SspH2 (Leucine-rich repeat protein)  ali model follow..  17  2.................................PVDPAEYDWSAWRRAAPAEESRGRAAVVQKACLNNGNAVLNVGESGLTTL-PDCLPAHITTLVIPDNNLTSLP--ALPPELRTLEVSGNQLTSLP--VLPPGLLELSIFSNPLTHLPAL--PSGLCKLWIFGNQLTSLP-VLPPGLQELSVSDNQLASLP--ALPSELCKLWAYNNQLTSLPML--PSGLQELSVSDNQLASLPTL--PSELYKLWAYNNRLTSLPAL--PSGLKELIVSGNRLTSLP--VLPSELKELMVSGNRLTSLP--MLPSGLLSLSVYRNQLTRLPELIHLSSETTVNLEGNPLSERT-LQALREITSAPGYSGPIIRFDMASAPRETRALHLAAADWLVPARGEPAPADRWHMFGQEDNADAFSLFLDRLSETENFIKDAGFKAQISSWLAQLAEDEALRANTFAMATEATSSCED 421
22 -32.7001wwl_A mol:protein length:312 Monocyte differentiation antigen CD14  ali model follow..  17  15.....................................................................................CNFSDPKPDWSSAFNCLGAADVYGGGRSLEYLLKRVDTEADLGQFTDILSLKRLTVRAARIPSRI----------------LFGALRVLGISGLQELTLENLEVTGTATGPDLNILNLRNVSWATRDAWLA-WLKPGLKVLSIAQAHSLNFEQVRVFPALSTLDLSDNPELGERGLLKFPTLQVLALRNAGMETPSGAAARVQLQGLDLSHNSLRDAAGCDWPSQLNSLNLSFTGLKQV-PKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLD................................................................................................... 310
23 -32.6002z80_A mol:protein length:353 Toll-like receptor 2, Variable lymphocyte rec  ali model follow..  19  1.....................................................................MPHTLWMVWVLGVIISKEESSNQASLSCDRNGI--------------CKGSSGSLNSI-PSGLTEAVKSLDLSNNRITYISN-------------------SDLQRCVNLQALVLTSNGINTIESFSSLGSLEHLDLSYNYLSNLSSFKPLSSLTFLNLLGNPYKTLGEFSHLTKLQILRVGNMDTFTKIQFAGLTFLEELEIDASDLQSYEPLKSIQNVSHLILHMKQHILLLEVDVTSSVECLELRDTDLDTFHFLIKKFTFRNVKITDESLFQVMKLNQISGLLELEFSRNQLKSVPDFDRLTSLQKIWLHTNPWD.............................................................................. 314
24 -30.9001dce_A mol:protein length:567 PROTEIN (RAB GERANYLGERANYLTRANSFERASE ALPHA  ali model follow..  20  301........................................................................................LCDLPAASLNDQLPQHTFRWTGSDSQKECVLLKDRPECWCRSATDEQLFRCELSVEKSTVLQSLESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFSTLKAVDPMR--------------AAYLDDLRSKFLLENSVL----KMEYADVRVLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPLAALRCLEVLQASDNALENVDGVANLPRLQELLLCNNRLQQSAPLVSCPRLVLLNLQGNSLCQEEGAEMLPSVSSIL........................................................................................................... 566
25 -30.8002z66_A mol:protein length:306 Variable lymphocyte receptor B, Toll-like rec  ali model follow..  15  8.................................................................................................................................................................................SGTEIRCNSKGLTSVPT-GIPSSATRLELESNKLQSLPHFDKLTQLTKLSLSSNGLSFKGSDFGTTSLKYLDLSFNGVITMSSFLGLEQLEHLDFQHSNLKQMSEFLSLRNLIYLDISHTHTRVAFNFNGLSSLEVLKMAGNSFQENFLFTELRNLTFLDLSQCQLEQLSPFNSLSSLQVLNMSHNNFFSLDTYKCLNSLQVLDYSLNHIMTSKKQELQHF---------------------PSSLAFLNLTQNDFACHQSFLQWIKDQRQLLVEVERMECATPSDKQG 296
26 -29.9003cvr_A mol:protein length:571 Invasion plasmid antigen  ali model follow..  14  6PINNNFSLSQNSFYNTISGTSAWDKWEKQALPGENRNEAVSECLINQFSELQLNRLNLSSLPD-NLPPQITVLEITQNALISLPE--LPASLEYLDACDNRLSTLPE--LPASLKHLDVDNNQLTMLPEL--PALLEYINADNNQLTMLPE--LPTSLEVLSVRNNQLTFLP-ELPESLEALDVSTNLLESLPAHHSEETEIFFRCRENRITHIPEILSLDPTCTIILEDNPLSSRRESLSQQTAQPDYHGPRIYFSMSDQQNTLHRPLADAVTAWFPENKQVSQIWHAFEHEEHANTFSAFLDLSDTVSARNTSGFREQVAAW--LEKLSASAELRQQSFAVAA-RVALTWNNLRKTLLVHQASEGLFDTGALLSLGREMFRLEILEDIARDKVRTLHFVDEIEVYLAFQTMLAEFYGVSGVTANDLRTAEAMVRSREENEFDWFSLWGPWHAVLKRTEADRWAL 500
27 -29.2001z7x_W mol:protein length:461 Ribonuclease inhibitor  ali model follow..  17  3...................................................................LDIQSLDIQCEELSDA--LPLLQQCQVVRLDDCGLTESSALRVNPALAELNLRSNELGDVGVQTPSCKIQKLSLQNCCLTGAGCGVLSSTLR---------------TLPTLQELHLSDNLLGD-GLLDPQCRLEKLQLEYCSLSAASVLRAKPDFKELTVSNNDINEAGVKDSPCQLEALKLESCGVTSCGIVASKASLRELALGSNKLGDVGMLHPSSRLRTLWIWECGITACRVLRAKESLKELSLAGNELGDEGALEPGCQLESLWVKSCSFTASSVLAQNRFLLELQISNNRLEDAGVGQPGSVLRVLWLADCDVSD------------------SSCSSLAATLLANHSLRELDLSNNCLGDVESVRQPGCLLEQLVLYDIYWSEEMEDRLQA 449
28 -29.0002o6q_A mol:protein length:270 Variable lymphocyte receptor A  ali model follow..  22  1.........................................................................................................................................................................................NEALCKKGVCSCNNNKNSVDCSSKKLTAI-PSNIPADTKKLDLQSNKLSSLPAFHRLTKLRLLYLNDNKLQTLPAFKELKNLETLWVTDNKLQALPIFDQLVNLAELRLDRNQLKSLPPFDSLTKLTYLSLGYNELQSLPKFDKLTSLKELRLYNNQLKRVPEFDKLTELKTLKLDNNQLKRVPEFDSLEKLKMLQLQENPWDCTCNGIIYMAKWLKKKADEGLGGV--TAGCEKGGKAVLEITEKDAA................................ 263
29 -28.5001dfj_I mol:protein length:457 RIBONUCLEASE INHIBITOR  ali model follow..  20  3.......................................................................NLDIHCEQLSDARWLPLLQQYEVVRLDDCGLTEGSALRANPSLTELCLRTNELGDAGVQSPTCKIQKLSLQNCSLTEPSTLRSLPTLRELHLSDNPLGDAGLRLLCHLEKLQLEYCRLTAASVLRATRALKELTVSNNDIGEAGAADSACQLETLRLENCGLTPCGIVASQASLRELDLGSNGLGDAGILSPASRLKTLWLWECDITACRVLQAKETLKELSLAGNKLGDEGARLLCESL---------------LQPGCQLESLWVKSCSLTASLMLTQNKHLLELQLSSNKLGDSGI-QPGTTLRVLCLGDCEVTN------------------SGCSSLASLLLANRSLRELDLSNNCVGDLGSLEQPGCALEQLVLYDTYWTEEVEDRLQA 445
30 -27.9001a9n_A mol:protein length:176 U2A`  ali model follow..  18  2.................................................................................................................................................................................................................................VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEDQALPDLTELILTNNSLVELGDLASLKSLTYLCILRNPVTNKKHIYKVPQVRVLDFQKVKLKERQEAEKFKGKRGAQLAKD................................................................................. 173
31 -27.5001ook_G mol:protein length:290 Platelet glycoprotein Ib alpha chain precurso  ali model follow..  23  6..................................................................................................................................................................................................VSKVASHLEVNCDKRNLTAL-PPDLPKDTTILHLSENLLYTFSTLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLGQTLPALTVLDVSFNRLTSLPLLRGLGELQELYLKGNELKTLPPLTPTPKLEKLSLANNNLTELPALNGLENLDTLLLQENSLYTIPKFFGSHLLPFAFLHGNPWL.............................................................................. 208
32 -27.5001m0z_A mol:protein length:290 Glycoprotein Ib alpha  ali model follow..  23  6..................................................................................................................................................................................................VSKVASHLEVNCDKRQLTAL-PPDLPKDTTILHLSENLLYTFSTLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLGQTLPALTVLDVSFNRLTSLPLLRGLGELQELYLKGNELKTLPPLTPTPKLEKLSLANNQLTELPALNGLENLDTLLLQENSLYTIPKFFGSHLLPFAFLHGNPWL.............................................................................. 208
33 -27.1001ogq_A mol:protein length:313 POLYGALACTURONASE INHIBITING PROTEIN  ali model follow..  15  25...............................................................................................................................................................................SSWLPTTDCCNRTWLGVDTDTQTYRVNNLDLSGLNLPKPYPLANLPYLNFLYIGGNNLVGPPAIAKLTQLHYLYITHTNVSGAIPLSQIKTLVTLDFSYNALSGTLPISSLPNLVGITFDGNRISGAIPYGSFSKLTSMTISRNRLTGKIPPTANLNLAFVDLSRNMLEGSVLFGSDKNTQKIHLAKNSLAFLGKVGLSKNLNGLDLRNNRIYG----------------------TLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPACT 313
34 -27.0002jqd_A mol:protein length:169 Acidic leucine-rich nuclear phosphoprotein 32  ali model follow..  21  2...................................................................................................................................................................................................................................................PLGSMEMDKRIYLELRN-RTPSDVKELVLDNCKSIEGK-TDEFEELEFLSTINVGLTSISNLPKLNKLKKLELSENRISGDLEAEKCPNLKHLNLSGNKIKDLSTLKKLENLKSLDLFNCEVTNLNAFKLLPQVMYLDGYDRDNKEAPDSDVEGY.................................................................... 168
35 -26.7001m9l_A mol:protein length:199 Outer Arm Dynein Light Chain 1  ali model follow..  23  1.............................................................................................................................................................................................................................HMAKATTIKDAIRIFEERKVATEAEKVELHIPPIEKMDALSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLAVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNNKITNWGELAALDKLEDLLLAGNPLYNDYKVKRLPNLKKLD..................................................................................... 181
36 -25.7002je0_A mol:protein length:149 ACIDIC LEUCINE-RICH NUCLEAR PHOSPHOPROTEIN 32  ali model follow..  21  1.......................................................................................................................................................................................................................................................MEMGRRIHLEL-RNRTPSDVKELVLDNSRSNEGK-TDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEAEKCPNLTHLNLSGNKIKDLSTLKKLENLKSLDLFNCEVTNLNDFKLLPQLTYLDGYD.................................................................................. 149
37 -25.2001ozn_A mol:protein length:285 Reticulon 4 receptor  ali model follow..  19  9....................................................................................................................................................................................................YNEPKVTTSCPQQGLQAV-PVGIPAASQRIFLHGNRISHVPSFRACRNLTILWLHSNVLARIDAFTGLALLEQLDLSNAQLRSVDPFHGLGRLHTLHLDRCGLQELGPFRGLAALQYLYLQDNALQALPDFRDLGNLTHLFLHGNRISSVPEFRGLHSLDRLLLHQNRVAHVHPFRDLGRLMTLYLFANNLSALPTEA----------------------LAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAG 270
38 -25.2001k5d_C mol:protein length:386 Ran GTPase activating protein 1  ali model follow..  15  5..........................................................................................SIEGKSLKLDAITTFAVLLEDDSVKEIVLSGNTIGTSENIASKKDLEIAEFSDIFTGRVKDEIP-EALRLL--------LQALLKCPKLHTVRLSDNAFGPIDFLSKHTPLEHLYLHNNGLGPQAGAKIARALQELAV-------NKKAKNAPPLRSIICGRNRLENAKTFQSHRLLHTVKMVQNGIRP-EGLAYCQELKVLDLQDNTFTH-IALKSWPNLRELGLNDCLLSARGAAAVVDAFSKL--------------ENIGLQTLRLQYNEIELDAVDEKMPDLLFLELNGNRFSEE----------------DDVVDEIREVFSTRGRGELDELDDMEELTDEEEEAESQSPEPETSEEEKEDKELADELSK 383
39 -25.0002z62_A mol:protein length:276 Toll-like receptor 4, Variable lymphocyte rec  ali model follow..  21  8.................................................................................................................................................................................PNITYQCMELNFYKIPD-NLPFSTKNLDLSFNPLRHLGSFFSFPELQVLDLSRCEIQTIEAYQSLSHLSTLILTGNPIQSLALFSGLSSLQKLVAVETNLASLENIGHLKTLKELNVAHNLIQSFKLFSNLTNLEHLDLSSNKIQSIYCLRVLHQMPSLDLSLNPMNFIQGAFKEIRLKELALDTNQLKSVPDFDRLTSLQKIWLHTNPWD.............................................................................. 237
40 -24.9002ell_A mol:protein length:168 Acidic leucine-rich nuclear phosphoprotein 32  ali model follow..  22  1.........................................................................................................................................................GSSGSSGMDMKRRIHLELRNRTPAAVRELVLCKSNDGKIEGLAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDAEKLPNLTHLNLSGNKLKDISTLKKLECLKSLDLFNCEVTNLNDFKLLPQLTYLDGYDREDQEA.................................................................................................................................................................... 162
41 -24.6003e6j_A mol:protein length:229 Variable lymphocyte receptor diversity region  ali model follow..  23  14.......................................................................................................................................................................................................SGTTVDCRSKRHASV-PAGIPTNAQILYLHDNQITKLEPFDSLINLKELYLGSNQLGALPVFDSLTQLTVLDLGTNQLTVLPSFDRLVHLKELFMCCNKLTELPRIERLTHLTHLALDQNQLKSIPHFDRLSSLTHAYLFGNPWD---ECRDIMYLRNWVADHTSIAMRWDAVNDPDSAKCAGTNTPVRAVTEASTSPSK................................................................... 221
42 -22.6001koh_A mol:protein length:277 TIP ASSOCIATING PROTEIN  ali model follow..  13  33...........................................................................................................................................................RKYDKAWLLSMIQSKSSV----PFTPIEFHYENTRAQFFVEDASTASALKAVNYKI--------------LDRENRRISIIINSSAPPHTILNELKPEQVEQLKLMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSSMAATLRIIENIPELLSLNLSNNRLYRLDDMSSIPNLKILNLSGNELKSERELDKIKKLEELWLDGNSLSDTFRRERFPKLLRLD..................................................................................... 257
43 -22.1002r9u_A mol:protein length:174 Variable lymphocyte receptor  ali model follow..  21  13...................................................................................................................................................................................................................................................DQTLVNCQNIRLASV-PAGIPTDKQRLWLNNNQITKLEPFDHLVNLQQLYFNSNKLTAIPTFDKLTQLTQLDLNDNHLKSIPRFDNLKSLTHIYLYNNPWD---ECRDIMYLRNWVADHTSIVMRWDAVNDPDSAKCAGTNTPVRAVTEASTSPSK................................................................... 173
44 -22.0001fo1_A mol:protein length:271 NUCLEAR RNA EXPORT FACTOR 1  ali model follow..  12  23.......................................................................................................................................................IPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQVEDASTASALKAVNYKILDRERISIIINSSAPPHTILNELKPEQVEQLKLMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIENIPELLSLNLSNNRLYRLDDMSSI------------------VQKAPNLKILNLSGNELKSERELDKIKKLEELWLDGNSLCDTFRRERFPKLLRLD..................................................................................... 251
45 -21.6001xwd_C mol:protein length:252 Follicle stimulating hormone receptor  ali model follow..  17  10............................................................................................................................................................SNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQAFSGFGDLEKIEISQNDVLEVIEFSNLPKLHEIRIEKNNLLYINPFQNLPNLQYLLISNTGIKHLPDKIHSLQKVLLDIQDNINIHTIERNSFVGLVILWLNKNGIQEIHNFNGTQLDELNLSDNNNLEELPNFHGASGPVILDISRTRIHSLPSLENLKKLRARST--YNLKKLPTLEKLVALMEAS..................................................................................... 252
46 -21.5002p1m_B mol:protein length:594 TRANSPORT INHIBITOR RESPONSE 1 protein  ali model follow..  12  2.........QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAIRRFPKVRSVELKGKPHFADFNLSSYTWLEEIRLKRMVVTDDC-AKSFKNFKVLVLSSCEGFSTDGLATCRNLKELDLRESDVDDVSGPDTYTSLVSLNISCLASEVSFVTRCPNLKSLKLNRAVPLE-TLLQRAPQLEELGTGGYTAE-SVALSGCKELRCLSGFWDAVPAPAVYSVCSRLTTLNLSYATVQSVKLLCQCPKLQRLWVLDYIEDAGLEASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMG----------CPKLESVLYFCRQMTNAA-ARNRPNMTRFRLCIIEPKAPD-VEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSMHHVLSGCDSLRKLEIRDCPFGALLANASKLETMRSLWMSSCSVSFGACKLLGQ 528
47 -20.4002v70_A mol:protein length:220 SLIT HOMOLOG 2 PROTEIN N-PRODUCT  ali model follow..  20  14.....................................................................................................................................................................................................................................................TTVDCSNQKLNKI-PEHIPQYTAELRLNNNEFTVLEAFKKLPQLRKINFSNNKITDIEEFEGASGVNEILLTSNRLENVQHFKGLESLKTLMLRSNRITCVGNFIGLSSVRLLSLYDNQITTVAPFDTLHSLSTLNLLANPFN.............................................................................. 166
48 -20.1002o6s_A mol:protein length:208 Variable lymphocyte receptor B  ali model follow..  25  10.....................................................................................................................................................................................................................................................TTVECYSQGRTSV-PTGIPAQTTYLDLETNSLKSLPNFDELTSLTQLYLGGNKLQSLPNFNKLTSLTYLNLSTNQLQSLPNFDKLTQLKELALNTNQLQSLPDFDKLTQLKDLRLYQNQLKSVPDFDRLTSLQYIWLHDNPWD.............................................................................. 161
49 -20.0002v9s_A mol:protein length:220 SLIT HOMOLOG 2 PROTEIN N-PRODUCT  ali model follow..  25  14.....................................................................................................................................................................................................................................................NIVDCRGKGLTEI-PTNLPETITEIRLEQNTIKVIPPFSPYKKLRRIDLSNNQISELAPFQGLRSLNSLVLYGNKITELPKFEGLFSLQLLLLNANKINCLRVFQDLHNLNLLSLYDNKLQTIAKFSPLRAIQTMHLAQNPFI.............................................................................. 165
50 -19.6003g3b_A mol:protein length:170 variable lymphocyte receptor VLRB.2D  ali model follow..  20  10...............................................................................................................................................................................................................................................................................................SGTTVDCSGKSLASV-PTGIPTTTQVLYLYDNRITKLEPFDRLTQLTRLDLDNNQLTVLPAFDKLTQLTQLSLNDNQLKSIPRFDNLRSLTHIWLLNNPWDCACSDIL----------------YLSRWISQHPWLVFGYLNLDHDSARCSGTNTVRAVTKASTSPSKCPG........ 170
51 -19.3001fqv_A mol:protein length:336 SKP2  ali model follow..  14  10.........................................................................................................................DSLPDELLLGIFSCLCLPELLKVSGVC-RLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPR-QPLAEHFSPFRVQHMDLSNSVIEVHGILSQCSKLQNLSLEGLRLSDVNTLAKNSNLVRLNLSGCSGFSEFALSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTL------------VRRCPNLVHLDLSDSV-DCFQEFFQLNYLQHLSLSRCY-ETLLELGEIPTLKTLQVFGIVPDGTLQLL-------------------------KEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL.. 336
52 -18.7001w8a_A mol:protein length:192 SLIT PROTEIN  ali model follow..  27  11...........................................................................................................................................................................................................................................................................TTVDCTGRGLKEIPR----LHTTELLLNDNELGRISSFGRLPHLVKLELKRNQLTGIEPFEGASHIQELQLGENKIKEISNFLGLHQLKTLNLYDNQISCVMPFEHLNSLTSLNLASNPFN.............................................................................. 139
53 -17.2002o6r_A mol:protein length:177 Variable lymphocyte receptor B  ali model follow..  26  10...........................................................................................................................................................................................................................................................................TEIRCNSKGLTSV-PTGIPSSATRLELESNKLQSLPHFDKLTQLTKLSLSQNQIQSLPDFDKLTKLTILYLHENKLQSLPNFDKLTQLKELALDTNQLKSVPDFDRLTSLQKIWLHTNPWD.............................................................................. 137
54 -17.1001fs2_A mol:protein length:272 SKP2  ali model follow..  18  19.....................................................................................................................................................................GIFSCLCLPELLKVSGVCKRWYRLASLWQTLDEFRVQHMDLSNSVIEVST-LSQCSKLQNLSLEGLRLSDVNTLAKNSNLVRLNLSGCSGFSEFALSSCSRLDELNLSWCFDFTEKHVHVSETITQLNLSGYRKNLQKSVRRCPNLVHLDLSDSV-DCFQEFFQLNYLQHLSLSRCY-ETLLELGEIPTLKTLQVFGIVPDGTLQ-LLKEALPHLQINCSHFTTI............................................................................ 270
55 -17.1002wfh_A mol:protein length:193 SLIT HOMOLOG 2 PROTEIN C-PRODUCT  ali model follow..  24  13...........................................................................................................................................................................................................................................................................TVVRCSNKGLKVL-PKGIPRDVTELYLDGNQFTLVPKLSNYKHLTLIDLSNNRISTLSNFSNMTQLLTLILSYNRLRCIPPFDGLKSLRLLSLHGNDISVVPEFNDLSALSHLAIGANPLY.............................................................................. 139
56 -17.1002ra8_A mol:protein length:362 Uncharacterized protein Q64V53_BACFR  ali model follow..  10  3...................................................................RVFVFQDFKSQKFWSID-----VRGTDVIVNYGKLDGQTQVKNFSSAGEAEKAAGKLIAEKTKKGYVETLEEVAKEMKVEAKKYALSYDE--AEEGVNLMDKILKDKKLPSLKQITIGCWGYEGEDCSDIADGIVE------------NKEKFAHFEGLFWGDIDFEESPVLDAMPLLNNLKIKGTNNLSIG-KKPRPNLKSLEIISGGLPD-ILGSDLPNLEKLVLY-NVFRPLFSKDRFPNLKWLGIVDAEEQNFLESDILPQLETMDISAGVLTDLDHVDKIKHLKFINMKYNYLSDQKSLPMKIDVSDSQEYDDDYSYPMITELE...................................................................... 356
57 -16.6003g3a_A mol:protein length:178 Variable lymphocyte receptor VLRB.2D  ali model follow..  26  18...............................................................................................................................................................................................................................................................................................SGTTVDCSGKSLASV-PTGIPTTTQVLYLYDNQITKLEPFDRLTQLTRLDLDNNQLTVLPAFDKLTQLTQLSLNDNQLKSIPRFDNLKSLTHIWLLNNPWD.............................................................................. 123
58 -15.9003goz_A mol:protein length:362 Leucine-rich repeat-containing protein  ali model follow..  15  18...............................................................TSIPHGVTSLDLSLNNLYSISTVNTPASVTSLNLSGNSLGFKNS-AIPANVTSLNLSGNFLSYKSS-AIPFTITVLDLGWNDFSSKSSSEFKQAFSNLP--------------ASITSLNLRGNDLGIKSSDELIQILAAIP---------------ANVNSLNLRGNNLASKNCASIPASVTSLDLSANLLGLKSYAELAYIFS---------------SIPNHVVSLNLCLNCLHGPLLKDSLKHLQTVYLDYDIVKNMSKFPNIQKIILVDKNGKEIHPSHSIPISNLIRELSGKADVPSLLNQCLIFAQKHQTNIEDLNIPDELRESIQTCKPL................................................................. 354
59 -13.3002ifg_A mol:protein length:347 High affinity nerve growth factor receptor  ali model follow..  22  6...........................................CPHGSSGLRCTRDGADSLHHLPGAENLTELYIENQQLQHLELLRGLGELRNLTIVKSGLRFVAPFHFTPRLSRLNLSFNALESLSKTVQGLSLQELVLSGNPLHCSCALRWLQRWEE.................................................................................................................................................................................................................................................................................................................. 129
60 -10.7001pgv_A mol:protein length:197 tropomodulin TMD-1  ali model follow..  12  11..............................................................................................................................................................................................................................................MQSYVPRIVPDEPDNDTDVESCINRLTDLKEVNINNMKRVSKERIRSLKHIEKFSLANTAISDIELIETSPSLRVLNVESNFLTPLRSTLVTQSIVEFKADNQRQSVLGNIEENESLLRVGISFASMEARHRVSEAYERVRLRRLGKDPN.............................................................................. 196
61 -10.6003dze_A mol:protein length:176 ATP synthase subunit s, mitochondrial  ali model follow..  14..........................................................................................................................................................................................................................DHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTPLDKYKIQAIDATDSCIMSFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQL---------------ENLQKSMLEMEIISCG-KGIIALHHFRNLKYLFLSDLP-KEKIVQAFKTSLPSLELK................................................................................... 172

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 0 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.