current user: public




Query: 1o6s_A mol:protein length:466 INTERNALIN A, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .
# Score Template Links and tools%idFirst GPLGSATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKALast
1 -88.3001o6s_A mol:protein length:466 INTERNALIN A  ali model  100  1GPLGSATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYTEPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA 466
2 -65.5004fmz_A mol:protein length:347 Internalin  ali model follow..  35  2.........................AATLATLPAPINQIFPDADLAEGIRAVLQKASVTDVVTQEELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISPLANLTKMYSLNLGANLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTSLHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISDISVLNNLSQLNSLFLNNNQLGDMEVIGGLTNLTTLFLSQNHITDIRPLASLSKMDSADFANQVIKK................................................................................................... 347
3 -63.8005il7_A mol:protein length:1102 Rab family protein  ali model follow..  34  20.PVDKLKWYSKGYK--LDKDQRVTAIGLYDCGSDTLDRIIPLESLKSLSELSLSSNQITDISPLASLNSLSMLWLDRNQITDIAPLASLNSLSMLWLFGNKISDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELSLSGNNISDIAPLESLKSLTELSLSNQITDIAPLASLKSLTELSLSSNQISDIAPLESLKSLTELQLSRNQISDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELQLSRNQISDIAPLESLNSLSKLWLNGNQITDIAPLASLNSLTELELSSNQITDIAPLASLKSLSTLWLSSNQISDIAPLASLESLSELSLSSNQISDISPLASLNSLTGFDVRRNPIKRLPEWNDFSSSGFITFFDNPLESPPPEIKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGETFDPKESQTHGLNV...... 489
4 -56.1001otm_A mol:protein length:236 internalin B  ali model follow..  31  2..............................................................................................................................................GSSSSGLVPRGSHMASETITVSTPIKQIFPDAAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNKP................................................................................................. 228
5 -54.3004aw4_A mol:protein length:311 INTERNALIN B  ali model follow..  28  2.....................................................................AMETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNLTSLNLSNNQITDISPIQYLPNVTKLFLNNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNKPHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKE.......................................................................................... 311
6 -54.2004r5c_A mol:protein length:304 Leucine rich repeat protein  ali model follow..  34  3....................................................TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQ-------------------GVFEKLTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPQFERLTSLHTLDLSNNGITDISALKNLDNLHTLDLSNNGITDISALKNLDNLHTLDLSNNGITDISALKNLTSLHTLDLSNNGITDISALKNLDNLETLDLRNNGI..................................................................................................... 304
7 -53.5004r58_A mol:protein length:220 Leucine Rich Repeat protein  ali model follow..  34  6...................................................................................................................................................................STPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNLKTLKLSNNKITDISALKQLNNLGWLDLSNNGITDISALKNLASLHTLDLSNNGITDISALKNLDNLHTLDLSNNGITDISALKNLDNLHTLDLSNNGITDISALKNLTSLHTLDLSNNGITDISALKNLDNLETLDLRNNGITDKSALKNLNNLK........................................................................................ 220
8 -53.0004fho_A mol:protein length:231 Internalin C2  ali model follow..  34  9................................................................................................................................................................IAQPTPINVIFPDPALANAVKTATGKSNVTDAVTQADLDGIATLSAFNTGVTTIEGIQYLNNLIGLELKDNQITDLTPLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQITNISPLAGLTNLQYLSIGNNQVNDLTPLANLSKLTTLRADDNKISDISPLASLPNLIEVHLKDNQISDVSPLANLSNLFIVTLT................................................................................... 231
9 -52.7004cil_A mol:protein length:287 YOPM-CAP, INTERNALIN B  ali model follow..  27  2...............................................................................................AMGKSKAEYYNAWSEWERNAPPGNGEQRGMAVSRLRDCLQAHELELNNLGLSSLPGIQYLPNVTKLFLNNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKE.......................................................................................... 287
10 -51.2002y5q_A mol:protein length:362 INTERNALIN B  ali model follow..  29  1GPLGSETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKEVYTVSYDVDGTVIKTKVEAGTRITAPKPPTKQGYVFKGWYTEKNGGHE.................................................................................................................................. 339
11 -51.0001h6u_A mol:protein length:308 INTERNALIN H  ali model follow..  28  2........................................................................SITQPTAINVIFPDPALANAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVQYLNNLIGLELKDNQITDLAPLKNLTKITELELSNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLASLPNLIEVHLKNNQISDVSPLANTSNLFIVTLTNQTITNQPVFYNNNLVVPNVVKGPSGAPIAPATDNGTYASPNLTWNLTSFINNVSYTFNQSVTFKNTTVPFSGTVTQPLTE.......................................................................................... 308
12 -50.2004r6g_A mol:protein length:464 leucine rich repeats DLRR_K  ali model follow..  28  12...................FPDDAFAETIKANLKKKSVTDAQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQFEKLTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNNLANLNDFEGLTNLTTLNLSNNLARLWKLKGLTNLTTLNLSNNGFDELPKFKDLTSLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPQFERLTSLTTLNLSNNQLTSLPKLERLTNLKTLNLSNNQITKEVCLKQAASLHELHLSNNNIGEEGALHPGSTLETLDLSNCNLTKEAALKQATTLHELHLSNNNIGEEGALHPGSTLETLDLSNCNLTKEACR------------------EIARALKQATSLHELHLSNNNIGS............................... 464
13 -49.8002wqw_A mol:protein length:286 INTERNALIN B  ali model follow..  27  1.............................................................................................ETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQISDIVPLACLTKLQNLYLSKNHISDLRALCGLKNLDVLELFSQEALNINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKE.......................................................................................... 286
14 -48.8002z7x_B mol:protein length:520 Toll-like receptor 1, Variable lymphocyte rec  ali model follow..  13  1.SEFLVDRSKNGLIHVPKDLS--QKTTILNISQNYISELWTILSLSKLRILIISHNRIQYLDIFKFNQELEYLDLSHNKLVKI-SCHPTVNLKHLDLSFNAFDALPEFGNMSQLKFLGLSTTHLEKSSVIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKSGTSLKALSIHQVVSDVFGFPQSYEIFSNMNIKNFTVSGTRMVHMPSKISPFLHLDFSNNLLTDTVFCGHLTELETLILQMNQLKELSKTTQMKSLQQLDISQNSVSYDEKCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVASNQLKSVPDGFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGS......... 504
15 -48.4002wqx_A mol:protein length:289 INTERNALIN B  ali model follow..  26  1..........................................................................................GAMETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNNKLTDIKPLANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLEDNQIRRIVPLARLTKLQNLYLSKNHISDLRALRGLKNLDVLELFSQEALNKPIQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKE.......................................................................................... 289
16 -47.0004l3f_A mol:protein length:347 Internalin K  ali model follow..  17  3.................SSSSGLVPRGSHMAASQDNVNI-PDSTFKAYLNGLLGQASTANITE-AQMDSLTYITLANINVTDLTGIEYAHNIKDLTINNIHATNYNQISGLSNLERLRIMGADVTSIPNLSGLTNLTLLDLSHSAHDD-------------------SILTKINTLPKVTSIDLSYNGITDIMPLKTMPELKSLNIQFDGVHDYRGIEDFPKLNTLLAYSQTIGGKKLINSDIKSSKLTYNAENQTLYVPFSLMTERTVNYDGYVPD-----FVKSTASSDTYFTMNEQQ-VNGNRLTITSDGLTVSDVSKTDFDNLEKMEYNARIDLSYQSYNTPEQFQNGGSYTISMPIYDHYFTVDHSLNITADSE....................................................................................... 340
17 -46.6003a79_B mol:protein length:562 Toll-like receptor 6, Variable lymphocyte rec  ali model follow..  14  32.LESMVDYSNRNLTHVPKDLP--PRTKALSLSQNSISELRMISFLSELRVLRLSHNRIRSLDFFLFNQDLEYLDVSHNRLQNI-SCCPMASLRHLDLSFNDFDVLPEFGNLTKLTFLGLSAAKFRQLDL----LSCILLDLVSYHIKGGEESLQIPNTTVLHLVFHLFSVQVNMSVNALGHLQLSNIKLNDENELTRGPTLLNVTLQHIETTWKCQFFWPRPVEYLNIYNLTITERIDETALKSLMIEHVKNQVFLFSKEYSVFAEMNIKMLSISDTPFIHMPPSPSSFTFLNFTQNVFTDSVFCSTLKRLQTLILQRNGLKNFFKTKNMSSLETLDVSLNSLNSHRTCAWAESILVLNLSSNMLTGSVFRCLPPKVKVLDLHNNRIMSIPKDVTHLQALQELNVASNQLKSVPDGFDRLTSLQYIWLHDNPWDCTCPGIRYLSEWINKHSGVVR........... 531
18 -46.5004z0c_A mol:protein length:709 Toll-like receptor 13  ali model follow..  23  12.DIHHVLCIRKKITNLTEISDIPRYTTHLNLTHNEIQVLPPFTNLSALVDLRLEWNSIWKIDEFRGLENLTLLNLVENKIQSVNNFEGLSSLKTLLLSHNQITHIHKFTPLIKLKYLSLSRNNISDFSGVQHLPCLERLDLTNNSIMYLDSPRSLVSLTHLSFENKLRELNSALSLPNLTNLSASRNGNKVIQNLKTLPQLKSLNLSGTVIKLENSAKHLQNLRAMDLSNWELRHGHLLGNLPKLETLVFQKNVTNAEGILAKCTRLLFLDLGQNSDLIYLNFNALPSLQKLNLNKCQLSFINNWSSLQNLTSLDLSHNKFKSFPDFSPLKHLEFLSLSRNPITELNNFSGLFALKELNLAACWIVTIDRFTQFPNLEVLDLGDNNIRTLHGTFRPLKKLQSLILSHNCLKLEPNSFSGLTNLRSLDLMYNSLSYFEHLFSGLEKLLILKLGFNKITYETTRTLQY 518
19 -46.5004g8a_A mol:protein length:635 Toll-like receptor 4  ali model follow..  18  53.STKNLDLSFNPLRHLGSSFFSFPELQVLDLSRCEIQTIEDYQSLSHLSTLILTGNPIQSLALFSGLSSLQKLVAVETNLASLENIGHLKTLKELNVAHNLIQSFEYFSNLTNLEHLDLSSNKIQSIYCLRVLHQMPSLDLSLNPMNFIQPFKEIRLHKLTLRNNFDSL-TCIQGLAGLEVHRLVLGEFRNESALEGLCNLTIEEFRLAYLDYYLDFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTL-KLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKQSDFGTISLKYLDLSFNGVITMSSFLGLEQLEHLDFQHSNLKQMSEFLSLRNLIYLDISHTHTRVAFNFNGLSSLEVLKMAGNSFQENPDIFTELRNLTFLDLSQCQLELSPTAFNSLSSLQVLNMSHNNFFSLTFPYKCLNSLQVLDYSLNHIMTSKKQELQH 564
20 -46.3003w3g_A mol:protein length:811 Toll-like receptor 8  ali model follow..  20  149.NLKNLYLAWNCYFNKVCEFETLTNLELLSLSFNSLSHVPP-KLPSSLRKLFLSNTQIKYISEFKGLINLTLLDLSGNCPRCFNAFQNLTQLRYLNLSSTSLRKINAFKNMPHLKVLDLEFNYLVGEIALTMLPRLEILDLSFNYIKGSRNFSKLLSLRALHLRGY-DDFQPLMQLPNLSTINLGINFIKQIDFFQNFSNLEIIYLSENRISPLVKRQSYANSSSFQRHIRKRRSTDKPQCAAYGKALDLSLNSIFFIGPFENLPDIACLNLSANSNAQVLSFSAIPHVKYLDLTNNRLDFDNALTELSDLEVLDLSYNSHYFRIAIQNFTNLKVLNLSHNNIYTLTDNLESKSLVELVFSGNRLDILSIFKGLKNLTRLDLSLNRLKHIPNEAFLNLSLTELHINDNMLKFFWTLLQQFPRLELLDLRGNKLLFLDSLSDFTSSLRTLLLSHNRISHLPSGFLSE 712
21 -46.1002z63_A mol:protein length:570 Toll-like receptor 4, Variable lymphocyte rec  ali model follow..  18  8.PNITYQCMELNFYKIPDNL--PFSTKNLDLSFNPLRHLGSFFSFPELQVLDLSRCEIQTIEDYQSLSHLSTLILTGNPIQSLALFSGLSSLQKLVAVETNLASLENIGHLKTLKELNVAHNLIQSFKYFSNLTNLEHLDLSSNKIQSIYCLRVLHQMPLLNLSNPMNFIQPAFKEIRLHKLTLRNNFDSL-TCIQGLAGLEVHRLVLGEFRNEGNLNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPT-LKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGSDFGTTSLKYLDLSFNGVITMSSFLGLEQLEHLDFQHSNLKQMSEFLSLRNLIYLDISHTHTRVAFNFNGLSSLEVLKMAGNSFQENPDIFTELRNLTFLDLSQCQLEQLSPTFNSLSSLQVLNMASNQLKSVPDGIFRLTSLQKIWLHTNPWD......... 531
22 -46.0003oja_A mol:protein length:487 Leucine-rich Immune Molecule 1  ali model follow..  13  6...................KQNGNRYKIEKVTDSSLKQALARQSAWNVKELDLSGNPLSQISALAPFTKLELLNLSSNVLYETLDLESLSTLRTLDLNNNYVQE---LLVGPSIETLHAANNNISRV-SCSRGQGKKNIYLANNKITMLRDEGCRSRVQYLDLKNEIDTVN-AASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPFQSAAGVTWISLRNNKLVLIEKLRFSQNLEHFDLRGNGFHCGTRDFFSKNQRVQTVAKQTVKKLTGQNEEETVPTLGHYGAYCCEDLPAPFADRLIALKRKEHALLSGQGTERLECERENQARQREIDALKERTVIDQVTLRKQAKITLEQKKKHAELDGTLQQAVGQIELQHATEEQSPLQLLRAIVKRYEEMYVEQ-QSVQNNAIRDWDMYQHKETQLAEENARLKKLNGEADLALASANATLQELVV 477
23 -45.7005ijb_A mol:protein length:594 Toll-like receptor 4, Variable lymphocyte rec  ali model follow..  19  29.STKNIDLSFNPLKILKSYFSNFSELQWLDLSRCEIETIEDWHGLHHLSNLILTGNPIQSFSPFSGLTSLENLVAVETKLASLESIGQLITLKKLNVAHNFIHSCKLFSNLTNLVHVDLSYNYIQTITV-ENPQVNLSLDMSLNPIDFIQDLQNLAGLHVHRLIGEFKDERNLEIFETIDEFRLTYTNDFSDDIFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFP-TLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGSDLGTNSLRHLDLSFNGAIIMSAFMGLEELQHLDFQHSTLKRVTEFLSLEKLLYLDISYTNTKIDFDFLGLTSLNTLKMAGNSFKDNTLFANTTNLTFLDLSKCQLEQISWGVFDTLRLQLLNMSHNNLLFLDSSYNQLYSLKELALDTNQLKSVPDIFDRLTSLQKIWLHTNPWD......... 554
24 -45.2004u09_A mol:protein length:401 LIC12759  ali model follow..  26  2......EEIQKPYKNLAKALQNPADVRNLDLSFQGLKTLPNIGQLKNLQKLDLGGNEPTILSEIWQLKDLQKLNLNNNKLTVLPKIGQLQNLQELSLHSNELVNLPEIGQFKNLQKLNLDNNKLTVLPEIGQLQNLQELSLLSNKLISLPEIEQLKSLKNLDLNNEFTTVSEVMLLETLENLDLRSNKLKTIPEIRQLKSLKVLMLTGNQLTSLPEIEQLQNLKTLNLGENRFQIFPEILELKNLLELNLYYNQLVEFPEVGQLKSLKYLSLYHNQITTLPVVTQLPDLQELHLSGNKITILPEILQLKNLEWLSLSNNKLNALPKIGQLKKLQRLELGNNQLTTLPEIEQLKNLQRLELDSNPISPKEKIRKLLPKCEIDFEGGGGE.............................................................................. 401
25 -44.9004cc4_A mol:protein length:266 INLC PROTEIN  ali model follow..  22  2................................................SESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSA----------------------CLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKCVNEP---------------KYQPELYITNTVKDPDGRWISPAAISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKN...................................................................................................................... 265
26 -44.2004li1_B mol:protein length:432 Leucine-rich repeat-containing G-protein coup  ali model follow..  23  17.LDGGADCSGKGLVTVPDGL--SVFTHSLDLSMNNITKLPEFKGFPYLEELRLAGNDLSIIHPLSGLKELKVLTLQNNQLKTVPSLKGLVSLQSLRLDANHIVTVPEFEGLVQLRHLWLDDNSLTEVPILSNLPSLQALTLALNKISHIPDFSNLSSLVVLHLHNKIRTLGPFHGLDNLEALDLNYNNLIDFPDIRSLPNLKELGFHSNSITIIPDFVKNPLLRTIHLYDNPLSFVGNFQNLSDLHFLIIRGASNVQWFPLTGTNNLESLTLTGTKIRSIPICQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEVQNFQGLAALRMLDLSRNRIHTIHKFVTLKALTNLDLSFNDLTAFPT-AGLHGLNQLKLTGNPNFKETLT......................................................................... 432
27 -44.0003vq1_A mol:protein length:606 Toll-like receptor 4  ali model follow..  19  33.STKNIDLSFNPLKIKSYSFSNFSELQWLDLSRCEIETIEDWHGLHHLSNLILTGNPIQSFSPFSGLTSLENLVAVETKLASLESIGQLITLKKLNVAHNFIHSCKYFSNLTNLVHVDLSYNYIQTITVLQFLRENPSLDMSLNPIDFIQDLQNLAGLHVHRLIGEFKDERNLEIFETIDEFRLTYTNDFSDDIFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTL-DLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSGTNSLRHLDLSFNGAIIMSAFMGLEELQHLDFQHSTLKRVTEFLSLEKLLYLDISYTNTKIDFDFLGLTSLNTLKMAGNSFKDNTLFANTTNLTFLDLSKCQLEQISWGVFDTLRLQLLNMSHNNLLFLDSSYNQLYSLSTLDCSFNRIETSKGILQHPKSLAFFNLTNNSVA......... 558
28 -44.0003b2d_A mol:protein length:603 CD180 antigen  ali model follow..  17  31.TTEFLEFSFNFLPTIHNTFSRLMNLTFLDLTRCQINWIHEFQSHHQLSTLVLTGNPLIFMAELNGPKSLKHLFLIQTGISNLEPVHNLENLESLYLGSNHISSIKFDFPARNLKVLDFQNNAIHYISRMRSLEQAINLSLNFNGNNDSTIFQSLMSVESLNLQHRFSDISSFQCFTQLQELDLTATHLKGLPSMKGLNLLKKLVLSVNHFDQLCQAANFPSLTHLYIRGNVKKGVGCLEKLGNLQTLDLSHNDIEASDQLKNLSHLQTLNLSHNEPLGLQSFKECPQLELLDLAFTRLHINAPFQNLHFLQVLNLTYCFLDTSNQLAGLPVLRHLNLKGNHFQDGNLLQTVGSLEVLILSSCGLLSIDQFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGIYLNLAANSINIIPRLLPILSQQSTINLSHNPLDC---TCSNIHFLTWYKENLHKLEGSEETTCAN 586
29 -44.0003wpf_A mol:protein length:803 Toll-like receptor 9  ali model follow..  19  43.NITRLSLISNRIHHLHNSFVHLSNLRQLNLKWNCPPTGLSFLAMRTLEELNLSYNGITTVPR--LPSSLVNLSLSHTNILVLDALAGLYSLRVLFMDGNCYYKNPALLGLSQLTHLSLKYNNLTKVPR-QLPPSLEYLLVSYNLIVKLGPLAQLTSLRVLDVGGNCRRCDTFHHLSHLEGLVLKDSSLHTLNSFQGLVQLSVLDLSENFLYESITFQNLTRLRKLNLSFNYRKKVSSFKNLVSLQELNMNGIFFRLLNKLADLPKLHTLHLQMNFINQAQLFGTFRALRFVDLSDNRISGPSTFVQLSRLQCLSLSHNSIAQAVNFLPLTNLQVLDLSHNKLDLYKSFSELPQLQALDLSYNSQPFSMKVTHLSMLQSLSLAHNDIHTRVSSHLNSNSVRFLDFSGNGMGRMWDEFQGLSGLLKLDLSQNNLHILRPQNLD-KSLKLLSLRDNYLSFFNWTSLSF 655
30 -43.8004kt1_A mol:protein length:504 Leucine-rich repeat-containing G-protein coup  ali model follow..  21  5.................AAPCSCDGDRRVDCSGKGLTAVPE-GLSAFTQALDISMNNITQLPEFKNFPFLEELQLAGNDLSFIHPLSGLKELKVLTLQNNQLKTVPSIRGLSALQSLRLDANHITSVPEFEGLVQLRHLWLDDNSLTEVPVLSNLPTLQALTLANKISSIPDFTNLSSLVVLHLHNNKIRSLSQFDGLDNLETLDLNYNNLGEFPAIKALPSLKELGFHSNSISVIPDFDGNPLLRTIHLYDNPLSFVGNFHNLSDLHSLVIRGASMVQQFPLTGTVHLESLTLTGTKISSIPNCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEFQGLISLRILDLSRNLIHEIHSFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKFWGCDSYANLNTEDNSLQDHSVAQEKTADAANVTSTLENEE......... 489
31 -43.6001m9s_A mol:protein length:605 Internalin B  ali model follow..  20  1.........................MGETITVSTPIKQIFPDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLNNKITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLNINHQSNLVVPNTVKNTDGSLVTPEIISDDGDYEKPNVKWHLPEFTNEVSFIFYQPVTIGKAKARFHGRVTQPLKEVYTVSYDVDGTVIKTKVEAGTRITAPKPPTKQGYVFKGWYTEKNGGHEWNFNTDYMSGNDFTLYAVFKAETTEKT................................................................................. 363
32 -43.5003rg1_A mol:protein length:612 CD180 molecule  ali model follow..  17  12.GNRTYNCENLGLREIPDTL--PNTTEVLEFSFNFLPTIQNFSRLINLIFLDLTRCQINWVHEFQSHHQLNTIVLTGNPLIFMAELTGPKFLKHLFLTQTGISNLEPVHNLENLESLHLGSNHISSINENFPTQNLKVLDFQNNAIHYISRTNSLEQATNLSLNFNGNDIKGISTLQSLWLGTFEDTDDQYLTS--CDMSVESINLQKHRFSDLSSFRCFTRVQELDLTAAHLNGLPSIEGMNSLKKLVLNANSFDQLCQAASFPSLRDLYIKGNMRKGTRCLEKLENLQKLDLSHSDIEASDQLKNLRHLQYLNLSYNEPLGLEDFKECPQLELLDVAFTHLHVKSPFQNLHLLRVLNLSHCLLDTSNQLAGLQDLRHLNLQGNSFQDGSISLQMVGSLEILILSSCNLLSIDQQFHGLRNVNHLDLSHNSLTGDSMDALSHLKGLYLNMASNNIR......... 535
33 -43.5004kng_A mol:protein length:531 Leucine-rich repeat-containing G-protein coup  ali model follow..  21  39..TSYLDLSMNNISQLLPPLPSLRFLEELRLAGNALTYIPKFTGLYSLKVLMLQNNQLRHVPTLQNLRSLQSLRLDANHISYVPPFSGLHSLRHLWLDDNALTEIPVFRSLSALQAMTLALNKIHHIPDFGNLSSLVVLHLHNNRIHSLGKFDGLHSLETLDLNNNLDEFPTIRTLSNLKELGFHSNNIRSIPEFVGNPSLITIHFYDNPIQFVGRFQHLPELRTLTLNGASQITEPDLTGTANLESLTLTGAQISSLPQCNQLPNLQVLDLSYNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVFQQLLSLRSLNLAWNKIAIIHPFSTLPSLIKLDLSSNLLSSFP-ITGLHGLTHLKLTGNHALQSLNFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEED............................ 503
34 -43.3004z5w_A mol:protein length:642 Phytosulfokine receptor 1  ali model follow..  21  63GRVVELELGRRKLSGKLSEVAKLDQLKVLNLTHNSLSGSIALLNLSNLEVLDLSSNDFSGFPSLINLPSLRVLNVYENSFHGLIPCNNLPRIREIDLAMNYFDGSIPIGNCSSVEYLGLASNNLSGSIPLFQLSNLSVLALQNNRLSGSSKLGKLSNLGRLDISNKFSGKIPFLELNKLWYFSAQSNLFNGPRSLSNSRSISLLSLRNNTLSGQIYCSAMTNLTSLDLASNSFSGPSNLPNCLRLKTINFAKIKFIAQIPFKNFQSLTSLSFSNSSIQNISSLQHCQNLKTLVLTLNFQKEELPLSNSPSLQLLDLSWNQLSGTIPLGSLNSLFYLDLSNNTFIGPHSLTSLQSLVSKENAVEEPSPDFPFFKKKNTNAGGLQYNQPSSIWPEFGDLRQLHVLNLKNNNLSNIPANLSGMTSLEVLDLSHNNLSGIPPSLVKLSFLSTFSVAYNKLSGPIPT.... 600
35 -43.3004mn8_A mol:protein length:782 LRR receptor-like serine/threonine-protein ki  ali model follow..  26  73.YLQVLDLTSNSFTGKIPEIGKLTELNQLILYLNYFSGSIPIWELKNIFYLDLRNNLLSGPEEICKTSSLVLIGFDYNNLTGKIPLGDLVHLQMFVAAGNHLTGSIPIGTLANLTDLDLSGNQLTGKIPFGNLLNLQSLVLTENLLEGPAEIGNCSSLVQLELDNQLTGKIPLGNLVQLQALRIYKNKLTSPSSLFRLTQLTHLGLSENHLVGPISIGFLESLEVLTLHSNNFTGPQSITNLRNLTVLTVGFNNISGELPLGLLTNLRNLSAHDNLLTGPIPISNCTGLKLLDLSHNQMTGEIPIFNCSNLETLSVADNNLTGTLKIGKLQKLRILQVSYNSLTGPREIGNLKDLNILYLHSNGFTGRIPMSNLTLLQGLRMYSNDLEGIPEEMFDMKLLSVLDLSNNKFSQIPALFSKLESLTYLSLQGNKFNGIPASLKSLSLLNTFDISDNLLTGTIPGEL.. 595
36 -43.3004l3a_A mol:protein length:590 Internalin K  ali model follow..  15  1............MGSSSSGLVPRGSHMASMTGGQQMGRDPVFAAEQPGLKASQDNVNIPD----STFKAYLNGLLGQASTANITE-AQMDSLTYITLANINVTDLTGIEYAHNIKDLTINNIHATNYNQISGLSNLERLRIMGADVTSIPNLSGLTNLTLLDLSHS-SILTKINTLPKVTSIDLSYNAITDIMPLKTMPELKSLNIQFDGVHDYRGIEDFPKLNTLLAYSQTIGGKKLINSDIKSSKLTYNAENQTLYVPFSLMTEVNYDGYVPDFVKSTASSDTYFTMNEQQVNGNRLT--------ITSDGLTVSDVSKTDFDNLEKMEYNARIDLSYQSYNTPEQFQNGGSYTISMPIYDHYFTVDHSLNITADSEKTYIENQLVT............................................................................. 372
37 -43.2003t6q_A mol:protein length:606 CD180 antigen  ali model follow..  18  34.STECLEFSFNVLPTQNTTFSRLINLTFLDLTRCQIYWIHEFQSQHRLDTLVLTANPLIFMAELSGPKALKHLFFIQTGISSIDPLHNQKTLESLYLGSNHISSIKKGFPTEKLKVLDFQNNAIHYLSKMSSLQQATSLNLNGNDIAGIEPNSTIQSLWLGTFEDMDDEDISPAVFESVESINLQKHYFFNISSFHCFSGLQELDLTATHLSELPSLVGLSTLKKLVLSANKFENLCQASNFPSLTHLSIKGNTKRGTGCLENLENLRELDLSHDDIETSDQLRNLSHLQSLNLSYNEPLSLKTFKECPQLELLDLAFTRLKVKDAFQNLHLLKVLNLSHSLLDISSEFDGLPALQHLNLQGNHFPKGNSLQTLGRLEILVLSFCDLSSIDQHAFTSLMMNHVDLSHNRLTSSSIEALSHLKGIYLNLASNHISIILPSLLPLSQQRTINLRQNPLD......... 560
38 -43.1003wpb_A mol:protein length:802 Toll-like receptor 9  ali model follow..  21  43.NVTSLSLLSNRIHHLHDSFAQLSNLQKLNLKWNCPPAGLSFLAVPTLEELNLSYNGITTVP--ALPSSLVSLILSRTNILQLDPLTGLHALRFLYMDGNCYYKNPALLGLGNLTHLSLKYNNLTTVPR-SLPPSLEYLLLSYNHIVTLAPLANLTALRVLDVGGNCRRCDTFSHLSRLEGLVLKDSSLYQLNPFRGLGNLTVLDLSENFLYDCITFQGLAQLRRLNLSFNYHKKVPSFGSLLSLQELDMHGIFFRSLSPLARLPMLQRLYLQMNFINQAQLFKDFPGLRYIDLSDNRISGAVEFAQLSRLQCLRLSHNSISQAVNFVPLTSLQVLDLSHNKLDLYRSFTELPRLEALDLSYNSQPFSMRVAQLPTLRYLSLAHNGIHSRVSQQLCSTSLWALDFSGNSLSQMWAEFQGLRSLIRLDLSQNRLHTLLPCTLG-KSLQLLRLRNNYLAFFNWSSLTL 654
39 -43.1004bsr_A mol:protein length:539 LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUP  ali model follow..  21  54.FTSYLDLSMNNISQLLPPLPSLRFLEELRLAGNALTYIPKFTGLYSLKVLMLQNNQLRHVPTLQNLRSLQSLRLDANHISYVPPFSGLHSLRHLWLDDNALTEIPVFRSLSALQAMTLALNKIHHIPDFGNLSSLVVLHLHNNRIHSLGKFDGLHSLETLDLNNNLDEFPTIRTLSNLKELGFHSNNIRSIPEFVGNPSLITIHFYDNPIQFVGRFQHLPELRTLTLNGASQITEPDLTGTANLESLTLTGAQISSLPQCNQLPNLQVLDLSYNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVFQQLLSLRSLNLAWNKIAIIHPFSTLPSLIKLDLSSNLLSSFP-ITGLHGLTHLKLTGNHALQSLNFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEED............................ 519
40 -43.1004ufr_A mol:protein length:484 LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUP  ali model follow..  20  14....................PDGRMLLRVDCSDLGLSEL-PSNLSVFTSYLDLSMNNISQLLPLPSLRFLEELRLAGNALTYIPKFTGLYSLKVLMLQNNQLRHVPTLQNLRSLQSLRLDANHISYVPPFSGLHSLRHLWLDDNALTEIPVFRSLSALQAMTLANKIHHIPDFGNLSSLVVLHLHNNRIHSLGKFDGLHSLETLDLNYNNLDEFPTIRTLSNLKELGFHSNNIRSIPEFVGNPSLITIHFYDNPIQFVGRFQHLPELRTLTLNGASQITEFPLTGTANLESLTLTGAQISSLPQCNQLPNLQVLDLSYNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVFQQLLSLRSLNLAWNKIAIIHPFSTLPSLIKLDLSSNLLSSFPITGLH--GLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGV........................... 456
41 -42.9004eco_A mol:protein length:636 Uncharacterized protein  ali model follow..  15  57GANWNFNKELDMWGAQPGSLNSNGRVTGLSLEGFGASGRVPIGQLTELEVLALGSHGEKVPKGISANMSDEQKQKMRMHYQKTKSSRITLKDTQIGQLSNNITFVSKVMRLTKLRQFYMGNSPFVA-ENICEAWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNNLTKLPFLKALPEMQLINVACNRGISGEQLKDGEKIQIIYIGYNNLKTFPSLQKMKKLGMLECLYNQLEGKPAFGSEIKLASLNLAYNQITEIPACGFTEQVENLSFAHNKLKYIPDAKSVSVMSAIDFSYNEIGSVDGPFKGINVSSINLSNNQISKFPKFSTGSPLSSINLMGNMLTEIPKFKNTYLLTSIDLRFNKLTKLSDATTLPYLVGIDLSYNSFSKFPTQPLNSSTLKGFAQGNRTLREWPEGITLCPSLTQLQIGSNDIRKVNEKI--TPNISVLDIKDNPNISIDLSYVCP 609
42 -42.9003wpe_A mol:protein length:801 Toll-like receptor 9  ali model follow..  20  43.NVTSLSLISNRIHHLHDSFVHLSNLRVLNLKWNCPPAGLSFLAVPTLEELNLSYNGITTVP--ALPSSLVSLSLSHTSILVLGPFTGLHALRFLYMDGNCYYMNPCLLGLGNLTHLSLKYNNLTEVPR-RLPPSLDTLLLSYNHIVTLAPLANLTALRVLDVGGNCRR-DTFSHLSRLEGLVLKDSSLYKLEKFRGLGRLQVLDLSENFLYDYITFNDLTQLRRLNLSFNYHKKVSSFGSLVSLEKLDMHGIFFRSLTSLTRLPKLQSLHLQLNFINQAQLFGAFPSLLFVDLSDNRISGAATFTRLSRLQCLRLSHNSISQAVNFVPLTSLRVLDLSHNKLDLYRSFTELPQLEALDLSYNSQPFSMQVAQLPSLRYLSLAHNGIHSRVSQKLSSASLRALDFSGNSLSQMWAEFKGLRNLVQLDLSENHLHTLLPRHLD-KSLRQLRLRDNNLAFFNWSSLTV 653
43 -42.8002z7x_A mol:protein length:549 Toll-like receptor 2, Variable lymphocyte rec  ali model follow..  13  6.RNGICKGSSGSLNSIPSGL--TEAVKSLDLSNNRITYISNLQRCVNLQALVLTSNGINTIEEFSSLGSLEHLDLSYNYLSNLSSFKPLSSLTFLNLLGNPYKTLGEFSHLTKLQILRVGNMDTFTKIQFAGLTFLEELEIDASDLQSYEPLKSIQNVSHLILHKQHILLLEVDVTSSVECLELRDTDLDTFHSLIKKFTFRNVKITDESLFQVMEFDDCTLNGVGNFRASDNDRVIDKVETLTIRRLHIPRFYLFYDLSYSLTERVKRITVENSKVFLVPCSQHLKSLEYLDLSENLMVEEY-EDAWPSLQTLILRQNHLASLEKLLTLKNLTNIDISKNSFHSMPECQWPEKMKYLNLSSTRIHSVTG-CIPKTLEILDVSNNNLNLFSLNL---PQLKELYISRNKLMTLPDA-SLLPMLLVLKISRNQLKSVPDIFDRLTSLQKIWLHTNPWD......... 510
44 -42.7003rgx_A mol:protein length:768 Protein BRASSINOSTEROID INSENSITIVE 1  ali model follow..  21  152.SLEVLDLSANSISGANVVSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTIPFLGDCSALQHLDISGNKLSGDFSISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPSGACDTLTGLDLSGNHFYGPPFFGSCSLLESLALSNNFSGELPLLKMRGLKVLDLSFNEFSGPESLTNLSSLLTLDLSSNNFSGPILPNPKNTLQELYLQNNGFTGPPTLSNCSELVSLHLSFNYLSGTIPLGSLSKLRDLKLWLNMLEGPQELMYVKTLETLILDFNDLTGEIPLSNCTNLNWISLSNNRLTGEIPIGRLENLAILKLSNNSFSGPAELGDCRSLIWLDLNTNLFNGTIPLNRLSTRNPCNITSRVYGGTSPTFDNNGSMMFLDMSYNMLSYIPKEIGSMPYLFILNLGHNDISGIPDEVGDLRGLNILDLSSNKLDGRIPQAMSA 702
45 -42.7004lsa_A mol:protein length:774 Protein BRASSINOSTEROID INSENSITIVE 1  ali model follow..  21  151.SLEVLDLSANSISGANVVSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTIPFLGDCSALQHLDISGNKLSGDFSISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPSGACDTLTGLDLSGNHFYGPPFFGSCSLLESLALSNNFSGELPLLKMRGLKVLDLSFNEFSGPESLTNLSSLLTLDLSSNNFSGPILPNPKNTLQELYLQNNGFTGPPTLSNCSELVSLHLSFNYLSGTIPLGSLSKLRDLKLWLNMLEGPQELMYVKTLETLILDFNDLTGEIPLSNCTNLNWISLSNNRLTGEIPIGRLENLAILKLSNNSFSGPAELGDCRSLIWLDLNTNLFNGTIPLNRLSTRNPCNITSRVYEGTSPTFDNNGSMMFLDMSYNMLSYIPKEIGSMPYLFILNLGHNDISGIPDEVGDLRGLNILDLSSNKLDGRIPQAMSA 701
46 -42.6004mna_A mol:protein length:662 LRR receptor-like serine/threonine-protein ki  ali model follow..  23  48GHVVSVSLLEKQLEGVLSPIANLTYLQVLDLTSNSFTGKIPIGKLTELQSLVLTENLLEGPAEIGNCSSLVQLELYDNQLTGKIPLGNLVQLQALRIYKNKLTSSIPLFRLTQLTHLGLSENHLVGPISIGFLESLEVLTLHSNNFTGPQSITNLRNLTVLTVFNNISGELPLGLLTNLRNLSAHDNLLTGPSSISNCTGLKLLDLSHNQMTGEIPRGGRMNLTFISIGRNHFTGPDDIFNCSNLETLSVADNNLTGTLKIGKLQKLRILQVSYNSLTGPIPIGNLKDLNILYLHSNGFTGRIPMSNLTLLQGLRMYSNDLEGPIPMFDMKLLSVLDLSNNKFSGPALFSKLESLTYLSLQGNKFNGSIPLKSLSLLNTFDISDNLLTGIPGELLASLKNMQLYLNFSNNLLIPKELGKLEMVQEIDLSNNLFSGIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQ 551
47 -42.6003a79_A mol:protein length:580 Toll-like receptor 2, Variable lymphocyte rec  ali model follow..  15  53.AMKSLDLSFNKITYIGHGLRACANLQVLILKSSRINTIEGFYSLGSLEHLDLSDNHLSSLSSFGPLSSLKYLNLMGNPYQTLGVFPNLTNLQTLRIGNVETFSEIRFAGLTSLNELEIKALSLRNYQSLKSIRDIHHLTLHLSESAFLLEADILSSVRYLELRDTLKLLRYILELSEVEFDDCTLNGLGDFNP--ETVTIRRLHIPQFYLFYDLSYSLLEKVKRITVENSKVFLVPCSQHLKSLEFLDLSENLMVEEY-KGAWPSLQTLVLSQNHLRSMQKLLTLKNLTSLDISRNTFHPMPDCQWPEKMRFLNLSSTGIRVVKT-CIPQTLEVLDVSNNNLDSFSL--FLPRLQELYISRNKLKTLPDASLFPVLLVMKIASNQLKSVPDG----------------------IFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQK............. 555
48 -42.6003oja_B mol:protein length:597 Anopheles Plasmodium-responsive Leucine-rich  ali model follow..  18  49.....................TLNNQKIVTFKNSTMRKLPALDSFRQVELLNLNDLQIEEIDTFAYAHTIQKLYMGFNAIRYLPPFQNVPLLTVLVLERNDLSSLPRFHNTPKLTTLSMSNNNLERIEDFQATTSLQNLQLSSNRLTHVD-LSLIPSLFHANVSYN--LLSTLAIPIAVEELDASHNSINVVRG-PVNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYFVKMQRLERLYISNNRLVALNLGQPIPTLKVLDLSHNHLLHVERQPQFDRLENLYLDHNSIVTL-KLSTHHTLKNLTLSHNDWDCNSLRALFRNVARPAVDDADQH--RAQGRCSATDTINSVQSLSHYITQGVPLQGNEQLEAEVNELRAEVQQLTNEQIQQEQLLQGLHAEIDTNLRRYRLPKDGLARSSDNLNKVFTHLKERQAFKLRETQAR............ 528
49 -42.5004z63_A mol:protein length:631 Phytosulfokine receptor 1  ali model follow..  20  53GRVIRLELGNKKLSGKLSELGKLDEIRVLNLSRNFIKDSIPIFNLKNLQTLDLSSNDLSGIPTSINLPALQSFDLSSNKFNGSLP-HNSTQIRVVKLAVNYFAGNFTFGKCVLLEHLCLGMNDLTGNIPLFHLKRLNLLGIQENRLSGSREIRNLSSLVRLDVSNLFSGEIPFDELPQLKFFLGQTNGFIGPKSLANSPSLNLLNLRNNSLSGRLMCTAMIALNSLDLGTNRFNGPENLPDCKRLKNVNLARNTFHGQVPFKNFESLSYFSLSNSSLANISSLQHCKNLTTLVLTLNFHGEALP-LHFEKLKVLVVANCRLTGSMPLSSSNELQLLDLSWNRLTGPSWIGDFKALFYLDLSNNSFTGEIPLTKLESLTSRNISVNEPSDFPFFMKRNESARALLGHNNLSGPIWEEFGNLKKLHVFDLKWNALSGIPSSLSGMTSLEALDLSNNRLSGSIPVSLQQ 570
50 -42.4004u08_A mol:protein length:398 LIC11098  ali model follow..  26  1....QSNEAQTYYRNITEALKNPQNVRILNLSGSKLTTLPEIGKLQNLQLLNLDDNQLIALPEIGKLQNLQQLHLSKNQLMALPEIGQLQNLQKLKLYENQLTAIPEIGQLQNLQELNLAHNQLATLPEIEQLQRLQTLYLGHNQFNSILEIGQLQNLESLGLDNQLNVLPEIGQLRNLESLGLDHNQLNVLPEIGQLQNLQILHLRNNQLTTLPKIGQLQNLQKLLLNKNKLTTLPEIGQLQNLQKLKLYENQLTTLPEIGQLQNLQELDLDGNQLTTLPNIGQLQRLQTLYLGNNQLNFLPKIGQLRNLESLDLEHNQLNALPKIGKLQKLQTLNLKYNQLATLPEIKQLKNLKKLYLHNNPLPSEKIIRKLLPQCIIYFEE.................................................................................. 398
51 -41.8004qxe_A mol:protein length:443 Leucine-rich repeat-containing G-protein coup  ali model follow..  21  10.....................SCDGDRRVDCSGKGLTAVPE-GLSAFTQALDISMNNITQLPEFKNFPFLEELQLAGNDLSFIHPLSGLKELKVLTLQNNQLKTVPSIRGLSALQSLRLDANHITSVPEFEGLVQLRHLWLDDNSLTEVPVLSNLPTLQALTLANKISSIPDFTNLSSLVVLHLHNNKIRSLSQFDGLDNLETLDLNYNNLGEFPQIKALPSLKELGFHSNSISVIPDFDGNPLLRTIHLYDNPLSFVGNFHNLSDLHSLVIRGASMVQQFPLTGTVHLESLTLTGTKISSIPNCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEFQGLISLRILDLASNQLKSVPDFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLN--KNSQKEQGSAKCSGSGKPVRSIIC...................................... 440
52 -41.8003cig_A mol:protein length:697 Toll-like receptor 3  ali model follow..  19  26.NITVLNLTHNQLRRPPTNFTRYSQLAILDAGFNSISKLEPCQILPLLKVLNLQHNELSQISDFVFCTNLTELDLMSNSIHKIKSFKNQKNLIKLDLSHNGLSSTKLGVQLENLQELLLAKNKILALRSFLGNSSLRKLDLSSNPLKEFSPFQTIGKLFALLLNNATEKLCWELSNTSIQNLSLANNQLLATSE--KWTNLTQLDLSYNNLHDVGNFSYLPSLRYLSLEYNNIQRLSPFYGLSNLRYLSLKRAFTKQSVSFQWLKYLEYLNMDDNNIPSTKSLVSLKPLLTLNLTKNHISKIANFSWLGQLRILDLGLNEIEQKLSWRGLRNIFEIYLSYNKYLQLSTFALVPSLQRLMLRRVALKNVDPFRPLRNLTILDLSNNNIANINEDLLEGLNLEILDFQHNNLARLWKRLKGLSHLHILNLESNGLDEIPVGVFKLFELKSINLGLNNLN......... 573
53 -41.4003ulu_A mol:protein length:694 Toll-like receptor 3  ali model follow..  18  36.NITVLNLTHNQLRRPAANFTRYSQLTSLDVGFNTISKLEPCQKLPMLKVLNLQHNELSQLSDFAFCTNLTELHLMSNSIQKIKNFVKQKNLITLDLSHNGLSSTKLQVQLENLQELLLSNNKIQALKS--ANSSLKKLELSSNQIKEFSPFHAIGRLFGLFLNNV-EKLCLELANTSIRNLSLSNSQLSTTSN--KWTNLTMLDLSYNNLNVVGNFAWLPQLEYFFLEYNNIQHLFSFQWLKCLEHLNMEDNDIPGIKSFTGLINLKYLSLSNSFTSETFVSLAHSPLHILNLTKNKISKIESFSWLGHLEVLDLGLNEIGQELTWRGLENIFEIYLSYNKYLQLTRFALVPSLQRLMLRRVALKNVDPFQPLRNLTILDLSNNNIANINDDMLEGLKLEILDLQHNNLARLWKHLKGLSHLHILNLESNGFDEIPVEVFKLFELKIIDLGLNNLN......... 583
54 -41.3004j0m_A mol:protein length:740 Serine/threonine-protein kinase BRI1-like 1  ali model follow..  19  53GRIVGLDLRNSGLTGTLNNLTALPNLQNLYLQGNYFSSGDSSGSDCYLQVLDLSSNSISDDYVFSKCSNLVSVNISNNKLVGKLGPSSLQSLTTVDLSYNILSDKIP-DFPASLKYLDLTHNNLSGDFSFGICGNLTFFSLSQNNLSGPITLPNCKFLETLNISRNIPNGEYWGSFQNLKQLSLAHNRLSGPPELSLLKTLVILDLSGNTFSGELPFTACVWLQNLNLGNNYLSGNTVVSKITGITYLYVAYNNISGSVPLTNCSNLRVLDLSSNGFTGNVPLQSSPVLEKILIANNYLSGTVPLGKCKSLKTIDLSFNELTGPIPIWMLPNLSDLVMWANNLTGEGVCVKGGNLETLILNNNLLTGSIPISRCTNMIWISLSSNRLTGIPSGIGNLSKLAILQLGNNSLSNVPRQLGNCKSLIWLDLNSNNLTGLPGELASQAGLVMPGSVSGKQFAFVRNEGGT 569
55 -41.2004lxr_A mol:protein length:783 Protein toll  ali model follow..  17  124.GLKRFRFTTRRLTHIPANLTDMRNLSHLELRANIEEPSHLFDDLENLESIEFGSNKLRQMPRFGKMPKLKQLNLWSNQLHNLTKFEGATSVLGIDIHDNGIEQLPHFAHLTNVTDINLSANLFRSLPQFDHNKHLNEVRLMNNRVPPSRLFANQPELQILRLRAELQSLPGFEHSTQITNISLGDNLLKTLPALEHQVNLLSLDLSNNRLTHLPDFAHTTNLTDLRLEDNLLTGISGFSNLGNLVTLVMSRNRLRTIDSFVSTNGLRHLHLDHNDIDLQQPFGYMHGLLTLNLRNNSIIFVYNKNTMLQLRELDLSYNNISSLGYAFLSQNRLHVNMTHNKIRRIAGEGYNNNLVHVDLNDNPLVPVRQIEPQTLICPLDFSDDPRERKCPRVRTYDKALVINCHSGNLTHVPRNLHKNMQLMELHLENNTLLRLPSANTPYESVTSLHLAGNNLT......... 678
56 -40.8004ecn_A mol:protein length:876 Leucine-rich repeat protein  ali model follow..  13  318..................DLDNNGRVTGLSLAGFGAKGRVPIGQLTELKVLSFGTHSETVSGRFGDEELTPDMSEERKHRIRMHKKMFLDYDQRLNLSDLLQDAINRNPEMKPITQIGNLTNRITFISKIQRLTKLQIIYFANSPFTYDNSWSNLKDLTDVELCPNMTQLPDLYDLPELQSLNIACNRGISAAQEDTGPKIQIFYMGYNNLEEFPALQKMVKLGLLDCVHNKVRHLEAFGTNVKLTDLKLDYNQIEEIPECAFTDQVEGLGFSHNKLKYIPNAKSVYVMGSVDFSYNKIGSEGDDYKGINASTVTLSYNEIQKFPTFATGSPISTIILSNNLMTSIPEYKNTYLLTTIDLRFNKLTSLSDATTLPYLSNMDVSYNCFSSFPTQPLNSSQLKAFGIRHQRLRQWPTGITTCPSLIQLQIGSNDIRKVDEKL--TPQLYILDIADNPNISIDVTSVCP 849
57 -40.7004r6f_A mol:protein length:331 Leucine rich repeat DLRR_I  ali model follow..  30  13...............................................................FPDDAFAETIKANLKKKSVTDAQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQ-------------------GVFEKLTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNNIANINDLEGLTNLTTLNLSHNNLARLWKLKGLTNLTTLNLSSNGFDEIPRFKDLTSLTTLNLSNNNIANINDLEGLTNLTTLNLSHNNLARLWKLKGLTNLTTLNLSSNGFDEIPRFKDLTSLTTLNLSNNQLTSLPQFERLTNLKTLNLSNNQLQS................................................................................................... 331
58 -40.3002a0z_A mol:protein length:705 Toll-like receptor 3  ali model follow..  18  31.NITVLNLTHNQLRRPAANFTRYSQLTSLDVGFNTISKLEPCQKLPMLKVLNLQHNELSQLSDFAFCTNLTELHLMSNSIQKIKNFVKQKNLITLDLSHNGLSSTKTQVQLENLQELLLSNNKIQALKS--ANSSLKKLELSSNQIKEFSPFHAIGRLFGLFLNNVTEKLCLELANTSIRNLSLSNSQLSTTSN--KWTNLTMLDLSYNNLNVVGNFAWLPQLEYFFLEYNNIQHLFSFQWLKCLEHLNMEDNDIPGIKSFTGLINLKYLSLSNSFTS------AHSPLHILNLTKNKISKIESFSWLGHLEVLDLGLNEIGQELTWRGLENIFEIYLSYNKYLQLTRFALVPSLQRLMLRRVALKNVDPFQPLRNLTILDLSNNNIANINDDMLEGLKLEILDLQHNNLARLWKHLKGLSHLHILNLESNGFDEIPVEVFKLFELKIIDLGLNNLN......... 578
59 -40.2004r6j_A mol:protein length:254 Lucine rich repeats DLRR_H  ali model follow..  29  1...............................................................................................................................................................TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQFEKLTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNNLANLNDFEGLTNLTTLNLSNNNLARLWKLKGLTNLTTLNLSNNGFDEFPKFKDLTSLTTLNLSNNQLTSLPQFERLTNLKTLNLSNNQLQSLP........................................................................... 252
60 -39.8005d3i_A mol:protein length:568 Toll-like receptor 2  ali model follow..  15  10.ASGVCDGRSRSFTSIPSGL--TAAMKSLDLSFNKITYIGHLRACANLQVLILKSSRINTIEGFYSLGSLEHLDLSDNHLSSLSSFGPLSSLKYLNLMGNPYQTLGVFPNLTNLQTLRIGNVETFSEIRFAGLTSLNELEIKALSLRNYQSLKSIRDIHHLTLHLSESAFLLADILSSVRYLELRDTNLARFQGKVETVTIRRLHIPQFYLFYDLSYSLLEKVKRITVENSKVFLVPCSQHLKSLEFLDLSENLMVEEY-KGAWPSLQTLVLSQNHLRSMQKLLTLKNLTSLDISRNTFHPMPDCQWPEKMRFLNLSSTGIRVVKT-CIPQTLEVLDVSNNNLDSFSL--FLPRLQELYISRNKLKTLPDASLFPVLLVMKIRENAVSTFSKD----------------------QLGSFPKLETLEAGDNHFV................................ 514
61 -39.4004ezg_A mol:protein length:197 Putative uncharacterized protein  ali model follow..  19  1......................................................................................................................................................................................................GAAEQTGLKASQDNVNIPDSTFKAYLNGLLGQSSTANITE-AQMNSLTYITLANINVTDLTGIEYAHNIKDLTINNIHATNYNPISGLSNLERLRIMGKDVTSIPNLSGLTSLTLLDISHSAHDDLTKINTLPKVNSIDLSYNGITDIMPLKTLPELKSLNIQFDGVHDYRGIEDFPKLNQLYAFSQTIGGK............................................................................ 196
62 -39.3004r5d_A mol:protein length:441 Leucine rich repeat protein  ali model follow..  30  16....................DAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQFEKLTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNQLTSLPQFERLTNLTTLNLSNQLTSLPQFERLTNLTTLNLSNNQLTSLPQFERLTSLTTLNLSNNQLTSLPDFERLTNLKTLNLSNNQLTKENALKQAASLHELHLSNNNIGEE--LHPGSTLETLDLSNCNLTKERALKQATTLHELHLSNNNIGEEG-LHPGSTLETLDLSNCNLTKERALKQATTLHELHLSNNNIGEEGALHPGSTLETLDLSNCNLTKERALKQATSLHELHLSNNNIG.............................................................................. 441
63 -38.7004xgo_A mol:protein length:356 Anopheles Plasmodium-responsive Leucine-rich  ali model follow..  21  3..................................................LSYKSMHLTPFALLASFHKVEVLNLNGLQIEEIDTFAYAHTIQKLYMRFNVIRYLPPFQNVPLLTVLMLDRNDLSSLPPFHNTPKLTMMSMSNNNLERIEDFQATTALQNLQLSSNRLTHVDLALIPSLFHVNVSYNLLS---TLAIPIAVEELDASHNTINVVRG-PVNVELTILKLQHNNLTDTAWLLNYPGLVDVDLSYNQLEKITYFVKMQRLERLYVSNNRLVALDYGRPIPTLKVLDLSHNHLMWVEHQAQFDKLQYLYLDHNSIVTF-KLSTSHTLKNLTLSHNDWDCNSLRALFRNVAQPAVHDADQHCKIDLEHGLCCKESDKPYLD................................................................................ 350
64 -38.7005iyx_A mol:protein length:658 Receptor-like protein kinase 5  ali model follow..  23  76.SLHSLSLYNNSINGSLSAFDTCHNLISLDLSENLLVGSIPKSNLPNLKFLEISGNNLSDPSSFGEFRKLESLNLAGNFLSGTIPLGNVTTLKELKLAYNLFSP-SQLGNLTELQVLWLAGCNLVGPIPLSRLTSLVNLDLTFNQLTGPSWITQLKTVEQIELNNSFSGELPMGNMTTLKRFDASMNKLTGIPDNLNLLNLESLNLFENMLEGPLPITRSKTLSELKLFNNRLTGPSQLGANSPLQYVDLSYNRFSGEIPVCGEGKLEYLILIDNSFSGEISLGKCKSLTRVRLSNNKLSGQIPFWGLPRLSLLELSDNSFTGSIPIIGAKNLSNLRISKNRFSGPNEIGSLNGIIEISGAENDFSGEIPLVKLKQLSRLDLSKNQLSGIPRELRGWKNLNELNLANNHLSEIPKEVGILPVLNYLDLSSNQFSGEIPLELQNLKLNVLNLSYNHLSGKIPPLY.. 576
65 -38.5003j0a_A mol:protein length:844 Toll-like receptor 5  ali model follow..  18  5.DGRIAFYRFCNLTQVP---QVLNTTERLLLSFNYIRTVTAFPFLEQLQLLELGSQYTPDKEAFRNLPNLRILDLGSSKIYFLHPFQGLFHLFELRLYFCGLSDAVYFRNLKALTRLDLSKNQIRSLYLFGKLNSLKSIDFSSNQIFLVCE--QGKTLSFFSLAAN-SQAFSLILAHHIMGAGFGFHNIKDPDQ--ARSSVRHLDLSHGFVFSLNSFETLKDLKVLNLAYNKINKIADFYGLDNLQVLNLSYNLLGELYSFYGLPKVAYIDLQKNHIAIIQDFKFLEKLQTLDLRDNALTTIHFIPSIPTANLIHLSENRLENLDILLRVPHLQILILNQNRFSSCSGPSENPSLEQLFLGENMLQLAWEFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDV--FVSLSVLDITHNKFI......... 560
66 -38.4001g9u_A mol:protein length:454 OUTER PROTEIN YOPM  ali model follow..  17  12.FLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPNGEQREMAVSRLRDCLDR---------QAHELELNNLGLSSLPEL--PPHLESLVASCNSLTELPEPQSLKSLLVDNNNLKALSDLPP-----LLEYLGVSNNQLEKLPELQNSSFLKIIDVDNSLKKLPDL--PPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDL--PLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDL--PPSLEALNVRDNYLTDLPEL--PQSLTFLDVSENIFSGLSEL---PNLYYLNASSNEIRSLCDL--PPSLEELNVSNNKLIELPAL--PPRLERLIASFNHLAEVPEL--PQNLKQLHVEYNPLREFPDIPESVEDLRMN----SHLAEVPELPQN---LKQLHVETNPLREFPDIPESVEDLRMNSERVVDPY......... 432
67 -38.2004psj_A mol:protein length:271 OR464  ali model follow..  28  1.............................................................................................................................................................MGTITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQINANNSDIKSVQGIQYLPNVRQLNLGGNKLHDISALKELTNLGWLNLSSNKIEKLPQFESLTTLTQLNLSNNQITSLPQFESLASLTQLNLSNNQITSLPQFESLTNLTQLNLSNNQITSLPQFESLTNLTQLNLSNNQITSLPQFESLTSLTQLNLSNNQITSLPQFESLTNLKQLNLSGNQIQSLPQGLHESLTQLTG............................................................... 258
68 -38.1004pq8_A mol:protein length:271 DESIGNED PROTEIN OR465  ali model follow..  27  1.............................................................................................................................................................MGTITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQFEKLTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPQFERLTSLTTLNLSNNQLTSLPQFERLTNLKTLNLSNNQLQSLPTGVDEKLTQLTG............................................................... 258
69 -37.9003bz5_A mol:protein length:457 Internalin-J  ali model follow..  21  1...NTLKAGQTQSFNDWFPDDNFASEVAAAFEMQATDTI-SEEQLATLTSLDCHNSSITDMTGIEKLTGLTKLICTSNNITTLD-LSQNTNLTYLACDSNKLTNL-DVTPLTKLTYLNCDTNKLTKL-DVSQNPLLTYLNCARNTLTEID-VSHNTQLTELDCHNKKITKLDVTPQTQLTTLDCSFNKITEL-DVSQNKLLNRLNCDTNNITKL-DLNQNIQLTFLDCSSNKLTEI-DVTPLTQLTYFDCSVNPLTEL-DVSTLSKLTTLHCIQTDLLEI-DLTHNTQLIYFQAEGCRKIKELDVTHNTQLYLLDCQAAGITEL-DLSQNPKLVYLYLNNTELTEL-DVSHNTKLKSLSCVNAHIQDFSNNNFEAEGQTITMPKETLTNNSLTIAVSPDLLD................................................................ 396
70 -37.7004ow2_A mol:protein length:448 Yop effector YopM  ali model follow..  21  39.QAHELELNNLGLSSLPELPPHLERL---VASCNSLTELPEL--PQSLKSLEVYENNLKALPDL--PPLLVDLRVFNNQLEELPELQNLPFLTEIYANNNSLKTLPDL--PPSLVDLNVRENYLTALPEL--PQSLIFLDISDNILSGLSEL---PNLSCLDASNGIRSLCDL--PPSLVYLDVRDNQLIELPAL--PSGLERLIASFNHLAELPEL--PPNLYYLDASRNEISSLCDL---PSLVDLNVRKNQLIELPAL--PPDLERLIASFNHLAELPEL--PPNLSYLDASRNEISSLCDL--PPSLVDLNVRKNQLIELPAL--PPDLERLIASFNHLAELPEL--PPNLSYLDASRNEISSLCDL--PPSLVELDVRDNQLIELPALPP---HLERLIASLNHLAEVPELPQN---LKQLHVEHNALREFPDIPESVEDLR................... 446
71 -37.0004u7l_A mol:protein length:456 Leucine-rich repeats and immunoglobulin-like  ali model follow..  20  9.SGDSLDCGGRGLAALPGDL--PSSTRSLNLSYNKLSEIDPFEDLPNLQEVYLNNNELTAVPSGAASSHVVSLFLQHNKIRSVEGLKAYLSLEVLDLSLNNITEVRNFPHGPPIKELNLAGNRIGTLEL-GLSRSLLTLRLSKNRITQLPVAFKLPRLTQLDLNNRIRLIEGFQGLNSLEVLKLQRNNISKLTDFWGLSKMHVLHLEYNSLVEVNSLYGLTALHQLHLSNNSIARIHRWSFCQKLHELVLSFNNLTRLDELAELSSLSVLRLSHNSISHIAEFKGLRSLRVLDLDHNEISGTIEFSGLDSLSKLTLFGNKIKSVAKFSGLEGLEHLNLGGNAIRSVQFFVKMKNLKELHISSDSFLMLQAFVTATCAHPESLKGQSIFSVPPESFVCDDFLK................................................................ 455
72 -37.0004hq1_A mol:protein length:475 Probable receptor protein kinase TMK1  ali model follow..  20  61....................TGTKRVTRIQIGHSGLQGTLSLRNLSELERLELQWNNISGVPSLSGLASLQVLMLSNNNFDSIPSFQGLTSLQSVEIDNNPFKS-ESLRNASALQNFSANSANVSGSLPPDEFPGLSILHLAFNNLEGLPMSLAGSQVQSLWLNGQ--DITVLQNMTGLKEVWLHSNKFSGLPDFSGLKELESLSLRDNSFTGPVPLLSLESLKVVNLTNNHLQGPVPVFKSSVSVDLDKDSNSFCLSSPCDPRVKSLLLIASSFDYPPRLAACSNGNITVISLEKMELTGTISFGAIKSLQRIILGINNLTGMIPLTTLPNLKTLDVSSNKLFG--KVPGFRSNVVVNTNGNPDIGKDKLSSPGSSSPSGGSGSGING............................................................................. 468
73 -36.7004u06_A mol:protein length:344 LIC10831  ali model follow..  27  8........................................ALQNPLEVRVLDLSRQELKTLPEIGKLKNLQRLYLHYNQLTVLPEIEQLKNLQLLYLRSNRLTTLPEIEQLKNLQVLDLGSNQLTVLPEIGQLKNLQLLYLHSNRLTTLSK--------------------DIEQLQNLKSLDLSNNQLTTLPEIEQLKNLKSLYLSENQFATFPEIGQLQNLKVLFLNNNQITILPEIAKLKKLQYLYLSDNQLITLPEIEQLKNLQTLDLSYNQLMILPEVGQLENLQTLDLRNNQLKTLPEIEQLKNLQTLFLSNNQLTILPQIGKLKNLLWLSLVYNQLTTLPEIEQLKNLQTLYLNNNQFSSQEKIRKLLPKCQIYFD................................................................................... 344
74 -36.4003o53_A mol:protein length:317 Protein LRIM1  ali model follow..  17  6............................................................................................................................................................................KQNGNRYKIEKVTDSSLKQALARQSAWNVKELDLSGNPLSQISALAPFTKLELLNLSSNVLYETLDLESLSTLRTLDLNNNYVQE---LLVGPSIETLHAANNNISRV-SCSRGQGKKNIYLANNKITMLRDEGCRSRVQYLDLKLNEIDTVN-AASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPFQSAAGVTWISLRNNKLVLIEKALRFSQNLEHFDLRGNGFHCGTLRDFFSKNQRVQTVAKQTVKKLTGQNEEECTVPTLGHYGAYCCEDLPAPFAD 305
75 -36.3003v47_A mol:protein length:455 Toll-like receptor 5b and variable lymphocyte  ali model follow..  17  13..........................YNAICINRGLHQVPEL---AHVNYVDLSLNSIAELNEFSRLQDLQFLKVEQQTPGLVIRFRGLSSLIILKLDYNQFLQLETFNGLANLEVLTLTQCNLDGAV-FKPLTSLEMLVLRDNNIKKIQPFLNMRRFHVLDLTNKVKSICE--QGKHFTLLRLSSITLQDMNEPFKNTSITTLDLSGNGFKESMAFFDAIAGTKIQSLILSNS---------YNMGSSFGHTNFKDPDN--EASGVKTCDLSKSKIFALLKFSHFTDLEQLTLAQNEINKIDDFWGLTHLLKLNLSQNFLGSIDSFENLDKLEVLDLSYNHIRALGDFLGLPNLKELALDTNQLKSVPDFDRLTSLQKIWLHTNPWD.............................................................................. 408

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.