current user: public




Query: PU2862F NP_293819.1 380979 Selected-2007-07-06, from JCSG1009

Results of FFAS03 search in JCSG1009
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510
# Score Template Links and tools%idFirst MPDYDLIVMGAGHNALVTAAYAARAGLKVGVFERRHLVGGAVSTEEVVPGYRFDYGGSAHILIRMTPIVRELELTRHGLHYLEVDPMFHASDGETPWFIHRDAGRTIRELDEKFPGQGDAYGRFLDDWTPFARAVADLFNSAPGPLDLGKMVMRSGQGKDWNEQLPRILRPYGDVAREYFSEERVRAPLTWMAAQSGPPPSDPLSAPFLLWHPLYHEGGVARPKGGSGGLTKALRRATEAEGGEVFTDAPVKEILVKDGKAQGIRLESGETYTARAVVSGVHILTTANALPAEYVPSAARNVRVGNGFGMILRLALSEKVKYRHHTEPDSRIGLGLLIKNERQIMQGYGEYLAGQPTTDPPLVAMSFSAVDDSLAPPNGDVLWLWAQYYPFELATGSWETRTAEARENILRAFEHYAPGTRDTIVGELVQTPQWLETNLGLHRGNVMHLEMSFDQMFSFRPWLKASQYRWPGVQGLYLTGASTHPGGGIMGASGRNAARVIVKDLTRRRWKLast
1 -125.000PU2862F NP_293819.1 380979 Selected-2007-07-06  ali  100  1MPDYDLIVMGAGHNALVTAAYAARAGLKVGVFERRHLVGGAVSTEEVVPGYRFDYGGSAHILIRMTPIVRELELTRHGLHYLEVDPMFHASDGETPWFIHRDAGRTIRELDEKFPGQGDAYGRFLDDWTPFARAVADLFNSAPGPLDLGKMVMRSGQGKDWNEQLPRILRPYGDVAREYFSEERVRAPLTWMAAQSGPPPSDPLSAPFLLWHPLYHEGGVARPKGGSGGLTKALRRATEAEGGEVFTDAPVKEILVKDGKAQGIRLESGETYTARAVVSGVHILTTANALPAEYVPSAARNVRVGNGFGMILRLALSEKVKYRHHTEPDSRIGLGLLIKNERQIMQGYGEYLAGQPTTDPPLVAMSFSAVDDSLAPPNGDVLWLWAQYYPFELATGSWETRTAEARENILRAFEHYAPGTRDTIVGELVQTPQWLETNLGLHRGNVMHLEMSFDQMFSFRPWLKASQYRWPGVQGLYLTGASTHPGGGIMGASGRNAARVIVKDLTRRRWK 511
2 -122.000FP2862A YP_605771.1 381970 Selected-2007-08-07  ali follow..  84  4MPDFDVVVMGAGHNALVTAAYAAKAGLKVGVFERRHLVGGAVSTEELVPGYRFDYGGSAHILIRMTPVVRELELSRHGLHYLEVDPMFHASDGETPWFVWRDAERTARELEALFPGQGEAYRRFLEDWTPFARSVADLFNSAPGPLELGRMALRGGQGRAWQAQLPRILRPYGDVAREYFSEERVRAPLVWMAAQSGPPPTDPLSAPFLLWHPLYHVGGVARPKGGSGGLTQALRRAVEAGGGQVLTNAPVKRILVKGGRAQGIELAGGERYTARAVVSGTHILATAGALPPEHVPEAARRVRVGDGFGMVLRLALSERVRYRQHREPESRVGLGLLIKHERQLLRGYGEYLAGEPTRDPPLVAMSFSAVDDSLAPPGGEVLWLWAQYYPFELASGTWESRQAEARENILRAFEHYAPGTRDSIVGELVQTPQWLERELGLLRGNVMHLEMSFDQMFAFRPWLGASQYRWPGVRGLYLTGASTHPGGGIMGASGRNAARVLLRDLTRRR.. 512
3 -109.000PU2862B NP_104734.1 380950 Selected-2007-07-06  ali follow..  29  1MKAWDAIVIGGGHNGLVNACYLQRAGLDVLVVEKNDWVGGAATSRELTPGFVYSNCSYVCSLFR-PEIMRDLELPRFGLQVISYEGGAVFTRDGDYLANYRDHDAHRREFARFSRRDAEAYDRYARDVTRQCRFIQPLLMRTAPDPTSFKPKFAGLSAEEMALTLRFWTMSISDFLDEYFETDVIKANFALSGIIGTALGPMSPGTAYVLLHHYGSVGAWGYARGGMGAVTKALAASFKASGGTIRTGAEVDHVLVSRGKAKGVVLAGGEEVYGKLVVSNADVKRTFLKLVEEKELPRRVKNFKIRGSSGKVNIALDSLPEFPALADSPVYRGDMHFTDSIERMERAYDDWKAGRWSADPFLDMVIPTTLDPTMAPPGKHFMSCFVQYAPPKVNGRWTDADRDGFAESVVAQIAEYSPGFRDRIVHMEVRTPREIEAEVGLTEGNIFQGELTFDQLLFNRPVPGYAQYR-SPVGGLYMCGSSTHPGGGVMGAPGRNAAAEILRDLAKST.. 529
4 -108.000PU2862C YP_496947.1 380954 Selected-2007-07-06  ali follow..  25  2SNRYDALIIGGGHNGLVCAFYLAKAGMKVRVLERRDVVGGAAVTEEF-HPGFRNSTASYTVSLLRPKVIADMKLHDYGYRVIERTISNFFPFPDTYLKLGGGPGRTEAEFARFSKKDAESYPRYDAALEKVANVLRDISLQTPPNAATQGWPIAKLDIATQRDLLDIFTKSARDFLDGWFEDDHVKSAFGFDAVVGNFAGVSTPGSAYVLLHHVGKLGAWGHSVGGMGAITQAMAKACVDAGVEISLEAPVSRVLVNNGKAAGVKLEGGEELYAPIVAANVGPAMLYRQMVDASDLDRRMKNYKTGSGTFRMNVALSELPDFKVLPGKQLHTAGIIIAPGMDYMDQAFIDAQQFGWSKKPIVEIKIPSTVDDSLAPPGQHVASLFCQQFAPQLPDGSWDDCREEVADLIIDTVNDHAPNFKASVIARQIHSPLDLERKFGLIGGDIFHGTMGLDQLWAARPVLGNGDYR-SPIKGLYMCGSGTHPGGGVTGAPGHNAAHEIIRDRSLL... 530
5 -108.000PU2862D YP_552801.1 380958 Purified-2007-10-11  ali follow..  28  2TNRYDAVIIGAGHNGLVCGAYLARKGFKVCLLERRELAGGAAVSEAVWPGYRVSTASYTMALLQ-PRIIDELELAKYGYEIVVPPPMLHLYGDGRSLLFRPEGERLSADIARFSEADADAYGKYRAHMARLGKMVAGMLWETPPDRLLGFAWRFRDMGEQFYDLYDVLTLSARDYLARWFESDEMIAALGFYASCGGAATSICSPLRGFIRDHTTSAGPAGFVRGGMGSISEAIAASGKAYGMEVRCNAPVASVEISGERATGVRLSSGELIEAGCVISNVATKVLFQQLVGAQNVPARVRQIRDRSTAFKVNLALRRLPTFKDFDARSAYPAQVRLAPSVEYLERAWDAAKYGEISPRPPLVVLTPSAVDPGVAPKGKHLMSIFGQHAPYALRDGWDDAQRERLYQITLDTLAAYAPDIRECIDDAQVLSPADLERIFALPGGHVHHGELSADQIFFRRPVQGAADYC-TPVKGLYQCGASVHPGGGVTGVPGYNAAHVVVRRERH.... 530
6 -106.000PU2862E NP_343776.1 380971 Purified-2007-09-29  ali follow..  28  1M--IDVAIIGGGHNGLVTAAYLAKAGLKVAVFERREIVGGASVTEELWPSIKVSTGAYVLSLL-RPKIIEELKLREFGLKVYLKDPGLFLFENGKKLYIWSSLEKTKKEIEKFSKNDAKNYKKWVKFWDLFAEMADFFMLNPPPHINLINIFRGNVNEELALSFLRTFMQDAKSLLDEYFETDEVKSALAEDSVVGTFASPSTPGTAYVLAHHVGVKGAWGYVEGGMGEVTQALKRSAEHLGVEIYTNAEVDEVLVKNGRVEGIKLKNGKTINAKIIVSNADPKTTFFKLLRNAELERRVRALKNVGVSFKIVGYLEELPDFGNKSLSPEHIASELIMPNMEYIEKAYDDARALGYSREPWLSINIQSSVDPTVAPPGKFSFSIFGQYLVYD--SKRNDEMKEKIAEITFEKIKEFAPNFKPIK--YEVLTPLDIERRFGINGGNIFHLDMTPDQLYFFRPLIGYSDYT-TPIRGLYLCGSGTHPGGGVTGAPGYNAHVKILEDLRKGIYK 518
7 -106.000PU12785B NP_106108.1 380965 Purified-2007-08-29  ali follow..  29  1MSEFDAIFVGAGHNSLACAAHLALKGWKTGIFERSSTIGGAVQTREFLPGFRHDFGAMNLSLFAGSAFHRKYELKTQGLEFAPVADCFASFPDGRWFGVSNDLEKTASRMAAFSAADAATWRKLVAAFPGEAEHLFRLLGSPMSARALAGTLWRKKGVAGALDTGRLLLSSPRTWLEETFESPYVRATLATWGMHLDFAPDIAGGAVFPLESMANQSFGMVLGKGGADTIIRALAGMVTSAGGKIVTGAEVSEITVSNGKATGVRLTSGETHTATAVIAGVAPKALTGTLLPGGSGNTAMKKFRYAPGTMMIHLALDELPGWRAGS-ELRQFAYVHLSPSLDAMSRTYQQAMAGMLPDEPVLVVGQPTAIDPSRAPQGKHVLWVQVRMLPAEIAPAHWDQVKDAYAERVLDIIETYAPGLRSKILGRSVFSPIDLERENNLVGGDQVCGSHHLAQNFLFRPARGYAGWN-TPVGNLHLTGAATWPGAGTGAASGFMLAQQLGGR....... 524
8 -105.000PE00370E NP_421915.1 367874 Selected-2006-05-02  ali follow..  27  4TQTRDAVIIGGGHNGLVCAFYLAKAGLKVTVCEARGVVGGAAVTEEFHPGFRNSVASYTVSLL-NPRVIADMGLRELGLTFLERPISNFLISDDKYIKLGGGLERTQEEFRKYSRRDAEVLPAYYAMLDEIGDILRDLAQETPPNLGDGLGRLAFLSRQRKRDLLDLFTKSARDVLDGWFESEPVKAAFGFDAVVGNFASPDTPGSAYVLLHHTGKKGAWGHAVGGMGAITQAMAKACEAAGVEILLDAPVEAVHIDGGKAAGVQLVDGRQIMAPIVSANVNPALLYKKLVPPSALTKAVDGYKNGSGTFRMNVALSELPSFTCLPGKETAEHHQVIAPSLDYMDAAYRDAKGQGISKAPIVEMLIPSSLDTSLAPPGQHVASLFCQQFAPELPDGSWDDAREAAADLIIDTVDQWAPGFKASVLGRMILSPLDLERKFGLIGGDIMHGHMSLDQLWATRPLLGHASHR-APIAGLYMCGAGTHPGGGVSGNPGRNAAREILRDKDFAT.. 534
9 -105.000PU2862A YP_555885.1 380943 Selected-2007-07-06  ali follow..  23  4SQTHDVVIVGGGHNGLSAGCYLAAAGKKVLVLEALEKVGGMASSGYLLPAPEHLIHPCALDMMSMSRVPRELELERHGFRQVEMTPGYVYLHDGTSLVFWRDPGKTAQEIRRYSPKDAESFLAFIKVVFAFLDLALPMMRVDPAERNLGALRAALRNRKLKPELMALLTGSAYQAALEHFEHPVTISAMCSLTGLAGPITADGS-GIYYALLGFLHRFGVGRVVGGMQALSNAMAARLRELGGEVLTSARVEEIVADERALRGVRLADGRTFGARAVIASCHPQVALELVSPGRIDQRHAPANAHGASPLKLDMALRGQISLARFGDGLDLRKTCLLIGTAEAVLENFRASARGEVPTLPYLSLAAPGAIDPSQAPAGQDTVYIYPPAMPAH-PREGWDAIRERVAQQVIDQASEYVDGLKEFEIARRMEAAPDFTRRLNTVNGCVVHIDTTTMRSSKLRPAYGLGGAT-LPVPGLYFGGAGIHPGGGVNGMPGRIAAHRVQRWLGRNE.. 528
10 -104.000PK2862A NP_147877.1 389256 Selected-2007-11-16  ali follow..  26  4ERVFDVVVVGGGHNGLTAASVLARRGLRVALLEARERLGGLAASYSPWPGFTAPFGAYVLGLYP-RWLMREAGIEGR-VRLLPKDPGMTVLGEGRALRVYGDARRTSREFSRVSPADGEAYLRWARLWSALGVLLEEVYSHPPLSRAARTPLVGRIVEEALEAAQWMLTAPAARILGEWFESWEARAALVEDALVGEMAAPSTPGTGIVLAHHYGRRGEWAYVKGGMGRLIHALAEAAREAGASIETGARVSEVLVESGRAVGVRTWDGRVYRARKAVLWAASIKTLPSVVEDRGLARRIRTLESSGASSKIVLAAREPLKPAEEYREDLYTSSVITMPGMEYAEKAYGEAVSRGVSREPWLSVNVLNRVDPGLAPEGWILASIFLQY-TWRPARSWGEEDKSEVAERGLGVLESVFT-LPREGVRVEVLTPRDYEG-LGNPGGSIFHISMRLDQLYSSRPLPEASGYTLPGVDRLYLASASSHPGGGVSGLPGWLASRRLLEDLGVEK.. 526
11 -104.000PU12785A YP_297669.1 380956 Purified-2007-09-18  ali follow..  25  1MPTYDAVIVGSGINSLVCAAVLARSGKRVCVLERNSTLGGCIRTEALAPGYLHDTLSTAHPLFVTSPGYAELDLHQAGLSYANNDTPTGVLPGNRSLILATSRERNVSAFNALASGDGDAYLAAMQEVEQNAGLVFSLLGNELWSADVAKTRLWKQGVHDTVAFFSPALMSCRSWLETRIRSDLVRALLAPWVLHTGLGPESAMSALMKVVAFSLEAVGLPIVQGGNARTVEAFRQIVESHGGAFHVNADVEDVLVENGSARGVRTRDDRVFMGKEIICNVTPGQLYGKLLAPAHVPPALRQQRYGKGNMQIHLSLSAPPDWPHAH--LRNVIYLHLTSGLDGVSRAVSEAERGLLPAEGTICVAQPCAVDPSRSPAGGWVLWIQVPECPRTIDGRWTPEIRERYADRIIDRIARQVPNLKASIVGRTVLSPADLEANINLVGGDPYSGECSIDQFMVWRPLRGARNHA-TPVKHLHHIGASTHPGPGLGGTSGYHVANALARKRAKSN.. 531
12 -103.000PL8204B NP_946860.1 401868 Selected-2009-04-08  ali follow..  21  15DRAPHAVVIGSGFGGLAAAVRLGAKGYRVTVLEKLDKAGGRAYVHKQ-DGFSFDAGPTIVTAPYLFEELWKLCGKRMSITLKPMSPFYRIFDDGTHFDYSDDRDAVLDQIAKFCPDDVPAYDRFMAASHEIFKVGFEQLGDQPFSHFTDML------KIAPAMIKLESYRSVYGLVAKHFKDPKLRQVFSFHPLLIGGNPFMSSSV-YCLITYLEKQWGVHSAMGGTGALVTGLVNLIEGQGNTIRYNQDVRQIVVENGTACGVKLADGEVIKADIVVSNADSASTYRYLLPPETRKRWTDAKIEK-----SRYSMSLFVWYFGTKRRYEDVKHHTILLGPRYKELISDIFSRKVVAEDFSLYLHRPTATDPSLAPQGCDTFYVLSPV-PNLLGDTDWHTKAETYRASIAKMLATVLPDLENQIATSKITTPIDFQDRLSSFRGAAFGLEPVLWQSAWFRPHN-----QSEDVKRLYLVGAGTHPGAGLPGVSARVLDALVPEADSLVT.. 510
13 -102.000PU8204D YP_497090.1 381001 Purified-2007-10-11  ali follow..  20  1MK--RACVIGAGFGGLALAIRLQSGGVQTTLIEARDKPGGRAYFWEK-DGFTFDGGPTVITDPACLEELWALKGHADDVELMPVMPFYRLWADGTNFDYSNDDASLRAEIAKLEPADVAGYDDFLRYSAGVFEEGYVKLGAVPFLDFASMI------KAAPALARYQAWRSVYSMVSSFVRNEKLREAFSFHTLLVGGNPMTTSAI-YALIHKLEKDGGVWWAKGGTNRLIEGMVTHFRRIGGEVRIGDPVTRVETLGTRVTGVETRSGWSGKFDAVASNADVMHSYRDLLSDNSHAKRRAKSLGK-----KRFSPSLFVVHFGIEGTWPGIPHHMILFGPRYKGLLDDIYTHGVLPQDFSIYLHHPTVTDPSVAPEGMSTFYALVPVANMGKLPVNWDEVGPILEKRILDEVRRLIPDIHTRIVTKFHYAPSDFSTDLSAHLGSAFSLEPLLTQSAWFRAHN-----RDDAISNFYLVGAGTHPGAGIPGVSAKATARLMLEDLS..... 492
14 -102.000PK8204A YP_425585.1 389648 Selected-2007-11-16  ali follow..  22  13DRRPHAVVIGSGFGGLAAAVRLGARGYRVTVLEKLGGPGGRGGVFKQ-DGFTFDAGPTIVTLPSLFEELWTLCGRSDDVDLRPLTPFYTIFNDGETFRAQSDPEAMRAEVARLSPGDVEGYERFIAESEDIYKVGFEQMADKPFSSITDML------KVVPQMLKLGALRSVWGHVAKHVADPRLRIALSFHPLFIGGNPLSVT-SIYSMIAFLERRWGVHFAMGGTHSLVKGLVGLIEGQGNHLRYNAGVAEILVKNDRACGVRLETGEEIAADIVVSNADSAATYKNLLPAAHRRWWSDRRLAW-----SRYSMSLFIWHFGTKGTYPDVAHHTILMGPRYHTLIADIFQAKTLAKDFSLYLYRPTATDPSMAPEGCDSFYVLSPV-PHLGGGQDWALEAEPYRKAILAELERVLPGLGAKIVTSKVVTPVDFRDGLSSLNGAAFGLEPAFTQSAWFRPHN-----KSEEIDRLYLVGAGTHPGAGLPGVSAKILDTVVPDASV..... 505
15 -101.000PE00370G NP_280502.1 368005 Selected-2006-05-02  ali follow..  19  24PGERDVTVVGGGFGGLAAAAYLARAGASVTLLEQHDTVGGRAGVLER-DGFRFDTGPSWYLMPDVFERFFDHHDPHDFYELTRLDPQYRVWTDGDSATIEPNRRNAHELFESYEEGAGDALATYLDRAATNYDLAMNRVVYPDRTA----FRDYASTDMLPLASRLRLFGNMDDYVSRFFDHPKLRQLLEYTLVFLGGAPHNTP-ALYSIMSHVDLNGNVFYPEGGIAGVVDALAELAVEQGATIETGVGVNAISGRRGEFTLA--TDDGTRTTDLVVNNANPAYAERELLDTGGRDHAPDYWD------DQTYAPSALMFYLGVEGDVEPLAHHSLVLPPDWDGHFAQLFDDPGWPDDPAFYLSVASKTDDTVAPDGHEAVVILLPIAP---GLDDTPEIRAQYRDRLLGTLAQTGVDLRDRIVVEESACVSEFSEQFGDPGGTALGLAHTLFQTGPLRPGKR------DGPDGHYYVGAYTNPGIGMPMCSGEHVTKAVIDDDPAAS.. 515
16 -100.000PE00370F NP_294585.1 367940 Selected-2006-05-02  ali follow..  20  14ARRKTALVIGAGFGGLALGIRLQSLGFDTTILERLDGPGGRAYQKRTPDGYVFDMGPTVLTVPHFIEELFALERDRAGVTLVPILPFYRIFHDGTYFDYDGDPESTRRQIAELAPGDLAGYERFHADAEAIFRRGFLELGYTHFGDVPTML------RVVPDLLKLDAVRTLFSFTSKYFQSDKLRQVFSFETLLVGGNPLSVP-AIYAMIHFVEKTWGIHYAMGGTGALVRGLVQKFEELGGAIRYGAGVDEVLVDGNLPGKVRLESGEELRADLVASNGDWANTYLKRVRPSARLVNSDLRSESMSLLVVYFGFRGGDDL--------PLKHHNILLGPRYEALLSEIFGTKRLGEDFSQYLHVPTLTDPALAPAGHHAAYTLVPV-PHNGSGIDWDVEGPKLAEAALADIERRGPGLRERLTHFEFITPDYFAGTLDSYLGNAFGPEPRLVQSAFFRPHN-----RSEDLHNFYLVGAGAQPGAGTPSVSAKMTARLIAEDFGIHA.. 544
17 -99.700PU8204A NP_786524.1 380992 Purified-2007-10-11  ali follow..  19  2...KQVSIIGAGIGGLTAAVRLQKLGYNVTIYEQNAQPGGKMNQIVS-QGFTFDVGPTIVMMKDIYEEVFRFVDPHNYLPFEEVQPLMHLFGDQSSLDLSRDLPTLIAEINRIAPDDVNGMLNFLADIYHRYTIAKPNFLERSFRNWRDFY----NLPALYAGLQLRTFNNAYKNIAKFIKNENLRNSLAFQTLYIGISPYQGP-SLYNIIPMIELFYGVYFLKGGMYTVVNSLVKLFKEQGGTLKLATPVQEIIIKDKVAVGIRVNNHPIHSDYVLCNADFPTAMTTLIPNEQDRGQYTDQKIAK-----MDYSCSCLVLYLGLDKKYPTEALHTIHFAQDFSKNVADLFDNGKLPEDPSYYVYVPSKMDPSLAPENSEALYVLVPVPELSKFNDWSPTTLKNYRQLIINKLRQTFSDIEQHIVVEKQFTPVDFKEQFGAYNGATFGLRPTLKQSNYYRPHN-----KFDYADHLYFCGSSTHPGAGVPIVSAKLAVEELIKDDQTNA.. 498
18 -99.700FP8204A NP_280452.1 381978 Selected-2007-08-07  ali follow..  21  4LAGTSVAVIGAGFGGLSTACYLADAGADVTVVEKTDQIGGRASTLER-DGFRFDMGPSWYLMPDVFEEFFASSHPSDYYGLTRLDPHYRIFFDGDTIDVTPDREQVKQVFDAYEPGAGDVLDDYLAQAKENYEVGMEHFVKTDRPR----VRDWMDPKLAEYARGLTLLGSMQDHVEQYFDHPKLQQVMQYTLVFLGGSPDTTPAL-YNLMSHVDFGLGVYYPEGGMGGVVDGITALARELGVEFRTGHPVSAIKGRRGGFKLD-TEPGDAVLADVVVSDADYAHTEQALLPAQKRQYDADYWD------ARTYAPSAFLLYLGVEGDVEPLAHHTLVLPSDWDTHFAQIFDDPAWPDDPAYYLCVPSKTDDTVAPDGHSNLFALVPVAP---GLDDTPAVRESYRDLVLDDIENTGVDLRDRIVVEERFSVSEFADRYNSHQGTALGLAHTLRQTALFRPPH-----RSTALDGLYFTGANTTPGIGVPMCSGEVTANNVLADAR..... 512
19 -99.300PL8204A YP_136483.1 401524 Selected-2009-04-08  ali follow..  20  6PRDLTVTVVGGGFGGLSAACYLANAGADVQLLERYDRLGGHAGVLER-DGFRFDTGPSWYLMPDVFERFFKHREPADYYELERLDPQYRVWKDGDRVTMRPNRENAREVFESYEEGAGDALAEYLDRAEQNYDLAMDRVVYEGRERLRDYV----DPDLLPLAPRARLFGSMDDYVSRYIDHPKLRQLLEYTLVFLGGAPHNTP-ALYSIMSHVDLNMNVFYPEGGIAGVVDGLGSLARELGVDIQTGTEVQHIAGEAGAFELT--TEDGVVASDVVVSNANPAYTEQHLLDPAARDHDPDHWD------EQTYAPSAFMLYLGVEGDVDPLAHHSLVLPTDWDGHFEQIFDRPGWPDDPAYYLSVASKTDETVAPDGHHAIVVLVPIAP---GLDDGPAIREEYRAFVLDDLEQTGVDLRDRIVVEETACVSEFAERYGDPQGTALGLAHTLFQTGPLRPSHR------AGLEGLYYTGAYTTPGIGMPMCSGEHTARDIVEDSPFET.. 497
20 -98.800PU8204C EXIG_01APR05_CONTIG283_REVISED_GENE2090 380998 Purified-2007-10-11  ali follow..  18  1L-KKQAVVIGAGLAGMSAAIRLAGDGYEVTMLEQNGNVGGKLNQRSG-QGFTFDTGPSILTMPWVLEQLFTSVHRDDYLEIERIEPQWRTFEDGTQLDVKGDLPGMLEEFKKVSDQAD--FVELFSYSKKMYDLCLDSFYKYSLEDLKDLK----KYHTMSELLKMDPLNTVASGTKKHLNNKYLEQLFNYMVMYVGSNPYEAP-AVFNQMIYVQMGLGIYYVKGGMYNIARAMKTVLDELRVTIHVNTPVARVVTEGKRAIGVETTDGTFYPADVVVSNLEVIPTYQHLISEKKGPKQAKKLNQS-----FVPSVSGLVLLLGVNREYKDLKHHNFFFSDDPEREFAQMFKDGVPPEDPTIYVGVSSKSDASQAPEGKDNLFVLTHVPP--LTKQDGKTDWDAYREVVLDKLERMGTDLRESIEFEYRFTPEDLKSLYGPNGGSIYGVAADRKKNGGFKIPS-----KSDLYEGLYFVGGSTHPGGGVPMVSGQLTADLIQKHEKVKA.. 494
21 -98.500FP8204B CAUR_25MAY01_CONTIG1103_REVISED_GENE1831 382002 Purified-2007-10-18  ali follow..  20  2..SPRIVIVGAGPGGMATAIRLAGQGYQVEIFEAVDRPGGRMRGFSL-GDYHFDTGPTILQVPRVYDELFSSAGLSDYVTLIRLDPNTRIFWDGEYLDLTSNIAAFKAQLARFDPALPAEFERWYIEHIRKNVVGYEPYLGTPVRSPLVYL----KPREIAAALAFRPWESLYDHFKRFFRDERVVYALSYQAKYLGMHPTACS-SVFSLVTFLEFADGIWHPRGGFRALAAGLAKAATDLGVVIHYNSPVKQVLVEEGRACGVELVGGERIKADAVVVNADFGHALTHIIPPHARGTYTDQKLNS-----MEFSCSTFMLYLGVNRRWDHLPHHQLYLSANIRRNDPLWAKAVLDEDDPSFYVCNPTIVDPTNAPPGHSTLFVLVPV-PNLRYPVDWAAVEQRYRDLIIRQMAKLGEDVERHIVVERRYTAETWRDEHHTYLGAVFNLIHSWSQLGPFRPHI-----RHNGARNLYWIGGAVHPGSGLMTIAAKSAVHFIGEDLPLHQ.. 498
22 -97.900PE00370J NP_373085.1 368292 Selected-2006-05-02  ali follow..  18  2....KIAVIGAGVTGLAAAARIASQGHEVTIFEKNNNVGGRMNQLKK-DGFTFDMGPTIVMMPDVYKDVFTACGKEDYIELRQLRYIYDVFDHDDRITVPTDLAELQQMLESIEPGSTHGFMSFLTDVYKKYEIARRYFLERTYRKPSDFY----NMTSLVQGAKLKTLNHADQLIEHYIDNEKIQKLLAFQTLYIGIDPKRGP-SLYSIIPMIEMMFGVHFIKGGMYGMAQGLAQLNKDLGVNIELNAEIEQIIIDPKFRADAIKVNGDIRKFDKILCTADFPSVAESLMPDFAPIKKYPPHKIA----DLDYSCSAFLMYIGIDIDVTDQVRLHNVIFSDDFRGNIEEIFEGRLSYDPSIYVYVPAVADKSLAPEGKTGIYVLMPTPELKTGSGSDEALTQQIKEIIYRKLATIFEDIKSHIVSETIFTPNDFEQTYHAKFGSAFGLMPTLAQSNYYRPQN-----VSRDYKDLYFAGASTHPGAGVPIVSAKITVDEMIKDIERG... 501
23 -97.600FP8204C YP_001813236.1 382052 Purified-2007-10-20  ali follow..  17  1MK--HIAVIGAGLGGLSAAISLASKGFKVTVIERNEHIGGKMMPITS-EGHRFDFGPNTITMPEIFQSVILESGADDYFTFEKLTRHTVNFPDGRSLTFASGREAMRTEVDRFTKGQLADITGYQDEVRELYNIAKQQFFINIDSYFNFSLLR--------DMTKVHPFKTLHGLHKKYFKDPQLIQALDRYATYIGSSPFQAPAT-FGLIAHLELNDGVYFTRGGNTAIAEGFARRARELGVTFRLGDEVTQIEVTNQLATEIELNHVDYLSVDFIVLNGDLLTQYPRLISETVRPDFKNPTPAQ-----MEPSISAYVRCIGLGRRIAGLAHHNVFFSSDYEAEFEALFNQHRYAEEPTIYISNSSVTAPEMGEAGDNLFVLV----NAPATHKGSAVDFDTYDKIIDQRLQQFGIDITSDVLFEQRITPQDIEQKFSAYHGSLYGLSSNGTRGAFMRPSN-----RSKNVHNLFFAGGSTHPGGGSPMVSGKLASERIVSAVAAT... 489
24 -97.200FP10387A NP_894882.1 381955 Selected-2007-08-07  ali follow..  20  11TQPWDAVVIGSGIGGLVTASQLAVKGAKVLVLESYTIPGGSSGSFQR-EGYTFDVGASMIFGFGTNLLTRALADVGEHCDTLPDPAQLAYLPGGLELAVDRKYEQFIADLTARFPHEAKGIRHFYDICWQVFNCLDAMPLLSIED-PTYLAKVFFKSPLACLGLARWLPVNVGDVARRHIKDPELLRFIDIECFCWSVMPADLTPMINGMVFSDRHAGGINYPRGGVGVIAQKLVKGMQRHGGEIRYKARVTRVVLKDNRAVGVQLANGEIIHARRVISNATRWDTFSGEGSKQALDAEHTPAAEQTWRRRYVPSPSFLSLHLGVRNEAIPANSHC--------HHLLLESWDEMESEQGVAFVSMPTLLDPSLAPEGHHIVHAFTPSSMQDLSPATYNSKKQADADRLIRKLEKILPGLSQAIVHREVGTPRSHRRFLGRFQGSYGPIPSSRLPGLLTMPFNR------TGLKGLYCVGDSCFPGQGLNAVSGFACSHLIGADLGINPW. 516
25 -97.000TT8204B NP_822198.1 404387 Selected-2009-08-14  ali follow..  19  7GRTDHVVVVGAGLAGLSAALHLLGAGRRVTVVERDLLPGGRAGRLVR-GGYLIDTGPTVLTMPDLADEAFAAVGDRDRVDLIPLHPAYRAFADGSTLDVHTGAEAMEAEIERFAGAREAAGYRLRDWLERLYRAQMRRFIDSNFDSPLQLLTPDLA-----RLAALGGFGRLDARIGRHLRDERLRRVFSFQALYAGVPPARALAA-YAVIAYMDTVAGVYFPRGGMHALPRAMADAAAQAGAELRFGQDVTRLERAGDRITAVVT-AYDRIPCDAVVLTPDLPVTYRLLGRAPRRPL------------RIRNSPSAVVLHAGTDRTWPGLAHHTLSFGAAWGRTFDELTRTGGLMSDPSLLITRPTATDPGLAPPGRHLHYILAPCPNTGPSAAAWGDLAPRYRDSLLTELEAGLDGIGSAVEEECLVTPADWAAQGHA-AGTPFSAAHTFAQTGPFRPRN-----LVRGTANAVLAGCGTTPGVGVPTVSGKLAAARVTGGTRRTP.. 498
26 -96.800PU8204B EXIG_01APR05_CONTIG281_REVISED_GENE1694 380995 Crystal|NMR-2009-06-13  ali follow..  23  2..KQRVAVIGAGPGGLACAMLLAGRGIDVTVYEKQPIVGGRTSRVQV-GDYQFDRGPTFLNMPHILENLFTSIDLDDYLDLKALDPMYTLYFGKDHFTMTTDRDRMKQTIEQHFPGNGEGYDRFMAEQALKLAKLMPILQTKHDK-----LTDYLSPRVITALPRLSLGRSLYDVLSDYFTSEELKYAFTFQAKYLGMSAWECPGG-FSILSYMEHAYGVHHPIGGMNQIPEAMKRAVEELGGTVHLNTGISQLILDGTTATGVILESGEHVLYDDVVVGADFAHAMNHLVPEGVLKKWSRPKKFSCSTFMLYLGVNKSF----------DAPHHTIYFADDYEKNVREMTQTLELSDDFSFYVQNPSIIDSTLAPEGKSSLYVLVPV-PNNYSELDWAIEGPKLRRRVLDALEHRSPGVEAAIEVEEMFTPDDWEA-MGVHQGATFNLGHQLTQMMYFRPHN-----RFEELEHVYLVGGGTHPGSGLPTISARITADLLTSEVGVGK.. 496
27 -95.900FP10387C YP_400263.1 382003 Selected-2007-08-07  ali follow..  22  7APAYDAIVIGSGIGGLVTATQLAAKGAKVLVLERYLIPGGSAGWFER-QGYRFDVGASMIFGFGTNLLTRALADVGQALETIPDPVQIHYLPNQLDLKVHRDYEAFLQELIAQFPQEAEGIRRFYDECWQVFNCLNAMPLLSL-EEPKYLFNVFLQHPLACLGLVKYLPQNVGDIARRYIRNPDLLKFIDMECYCWSVVPATMTPMINGMVFSDRHYGGINYPKGGVGRIAEKLVAGLEAKGSSIRYKARVTRILTEKGRAIGVELADGEKLYAKRIISNATRWNTFGELLPPQQEPAQEQRWRQSPSFLSLHLGVKADLLPAGTE-----------------CHHILLENWDELEVEQGTIFVSIPTLLDPSLAPPDRHIIHTFTPSWLGNLSPSEYRDRKAAAAAKLIQRLEAIFPGLSSAIDYQEVGTPRTHRRFLGRQNGTYGPIPRRKLAGLLGMPFNR------TAIPGLYCVGDSTFPGQGLNAVSGYACGHRVAADLGLV... 504
28 -95.800PU10387D YP_323615.1 380981 Purified-2007-08-29  ali follow..  21  10NSLFDVIVIGSGIGGLVTATQLAAKGAKVLVLESYIIPGGSAGYFER-QGYRFDVGASMIFGLGTNLLTRALQAVNSSVEAIADPVQIHYLPSNLNLKVDRVYDKFLQNLAAYFPHETKGIRRFYDECWQVFKCLNRMDLLSL-EEPRYLLRTFLQHPLACLGLLKYLPQNVGDIARRYIRDPELLKFIDIECYCWSVVPAAMTPMINGMVFSDRHYGGVNYPKGGVGQIAQKLAEGLEKVGGEIRYQAKVAKIITEKYRAVGVQLTNGEIYRSKRIVSNATRWDTFEKLLPVDKMPSNEKDWKKSPSFLSLHMGVKESVLPQG-----------------TECHHIILEDWQNMTQAEGTLFVSIPTLLDPELAPEGCHIIHAFTPHWINGFSVSDYEAKKEETAWRIIDRLEKIFPGLDAGLDYLEVGTPRTHRRFLGREDGTYGPIPRRKLRGLLSMPFNR------TAIKGLYCVGDSTFPGQGLNAVSGFACAHRIAVDLG..... 505
29 -95.800PE00370B YP_323180.1 367692 Selected-2006-05-02  ali follow..  21  9QSPLDIIVIGSGIGGLCAAGLLARYGKRVIVCESHTIPGGAAHSFKR-RGFEFDSGPSFYCGLSLNPIKQVLDALGESLPVVPYDPLGKYHFPEGTVAVYSNTERYLHEVEKITPQGANELQQFTKRLLGLYDAMKGIPTLALRSDILILLQHYLMSLGQMLPYLPLVQSSVGDVMDRTVNDPWVRRLIDLECFLLSGLKAHGTAPEVAFMLGERSRVGVEYPIGGSATIVNALVRGLERWGGQLRLGCHVEQILLEAGKVVGVKLRNGEILNAPIVISNATIWDTYNHLLRPEDLPTAYRQEALQ-----TLAVKSFMHLHLGIRADGLENLTGHHV--------VVNDSGVDITTPGNTCMISIPSVWDAALAPEGHHVVHAYTLESYTGWERNGYAVKKREKAESLYRALERIIPDIRERVVLELIGTPLTHAHYLRRYQGT-YGPAIAAGQGMFPST--------HTPIQGLYRVGDSTTPGIGVPAVSGILCANTLVERSQTTDL. 506
30 -95.500PU0787A YP_677189.1 381015 Purified-2007-08-29  ali follow..  21  2SNIYDAVVVGSGPNGLAAAITLQRKGFAVLVLEAKDTIGGGLRTKELTPGFKHDVCSAIHPMAVASPFFADIPLDKFGLRFTHAPIAAAHFDHGGAAILSRSLKDTIALLGK----DADNYKRLIEPVIESWPDIAADAMGPL----------RFPKHPLKMAAFGLNAIRSADCISKRFETEEAKGLWAGMAAHSIQPLTNWASAIGLVLSAVGHLHGWPIPIGGSQAIADALGSYFISLGGTIQTNVEVTSL--------------NQLPAARAVLFDVTPKQLLKITGDEFSGLYKKQLTNYRYGMGVFKVDWALSEPVPFTSDHCRQAGTVHLGNTFNEIALSEQETSSGKHPEKPFVLFAQQSKFDITRAPQGKHTAWAYCHVPN---------GSATDMTAAIENQLERFAPGFKDTILAKNTMNTVEIQAYNPNYIGGDINGGIIDIRQLYTRPAVKISPYR-TPKKGIYICSSSTPPGGGVHGMCGFHAAQAVIQDLKKQY.. 475
31 -95.200PU0787B NP_823112.1 381018 Selected-2007-07-06  ali follow..  23  2PSMLDVVVVGAGPNGLTAAVELARRGFSVAVFEARDTVGGGARTQELTPGFRHDPCSAAHPLGINSPAFRAMPLERYGLQWLHAERPMAHFTDGTAAVLSRSVAETAASF---GPRDAGTYRRLVEPFLSRWDTLAQDFMSLPLTALPRDPVT--------LARFGLVGLPPSTWLTRRFRDERAKALFAGLVAHVIAPLDGIATGVGLVFALAAHARGWPVARGGSQSISDALTAYLKDLGGTVHTDYEVKRLDDLPP--------------ARAYVFDTSPTALARIAGFGRYYEG----YRYGASVFKIDYALDGPVPWTAKEARTA-GTVQIGASSAEIGTALRAASREGRAPDPPFLITVQPSVVDPSRAPDGKQVFWAYGHVP---------NGWTGDLTDAMERQLERFAPGFRDRVLARATAGPPELAAHNANYVGGDIACGAASGLQLLLRPRLSLFPYS-TPHPAVFICSSATPPGPGVHGMSGHNAAKAVWRRLRSS... 472
32 -95.200PK10387A NP_661546.1 389442 Selected-2007-11-16  ali follow..  21  2...VDVIVIGAGIGGLTAAALLQERGFSTVVFEKNRFPGGSCSSFEK-GGYTFDAGASVFYGFCDDDAMGTLNLHSRAVETIPDPVQIHYMPGGFDVPAWFDRDRFLESLCRRFPHERTGIRKFYDELESVYEILNSLPAGSLEDV-IHLGVVGARHPLKVMALGVKTLFSMGNVARRYISDKELLRFIDLEAYSWAVQDAVSTPLVAGICLADRHHGGINYPVGGSGTIPAALVKGFEKFGGSIRFGSEVSKVIVKNGSAVGVRLSDGTEVSAKAVVSNATVWDTFSKLVDDPRLRIPDDRFIKAPSWFQIWLGVDG-----------------SIVPPGFHMHHIIVDDWSKYDELGGTIYFSAPSVLDPSLAPPGKHALHLFVTAETWEYRSQEYKAAKEAFAKSLIARAERLLPGIQDATELMVTATPQSHARYLNRRDGS-YGPLLKPGQNILLKPQNR------TPIKNLFAAGDSTFPGQGVIAVSGVSCASYIARQLGKA... 496
33 -95.100PE00370A YP_833628.1 367655 Selected-2006-05-02  ali follow..  23  2...PEVTVVGSGPNGLAAAVTMARAGLKVHVFEAAETAGGGLRTSELQPGHLHDICSAVQPMALVSPFFQAFELSRR-IDLVTPELSFGSLDGGRAALAYRSLDRTAAGLGPDGPAYKRLMAPLVRRADGIADFTLNQLLRIPRD------------PVAAVLFGVRTLEQGSAAWNARFSDELVPALLTGVAAHSVGRLPSLAAGAGLMLGTLAHAQGWPIPVGGSASIARAMVRDIEAHGGTVETGRRIESLAELPP--------------ARATLLDIAPPALVRLAGDPAGYRRSLESFRFGNAACKVDFILSGPVPWEAAG--LADAGTVHVGGTRAEMAEAENQVASGKHPERPYVLVSQPSRFDDSRAPYGRHILWTYCHVPS---------GSTVNMAEAVTAQLERFAPGFRDLVVQVHVTTAAGLAEYNQNYVGGDFAAGLMDLRGLIQRPVISPVPWR-TPLAGVYLCSSSTPPGPGVTGMPGFHAARYALKDIFGLK.. 473
34 -94.700FP10387B YP_291830.1 381957 Purified-2007-12-14  ali follow..  17  11SCNWDSIVIGSGLGGLVTASQLASKGAKVLVLEQYKIPGGSGGSFKR-KGFTFDVGASMIFGFGTNLLTRALKDVGQKCETIPDPTQLAYLPNQLEISVDRDYQKFITKLINLFPHEEKGIKHFYETCWDVFNCLDSMPLLSI-EDPAYLMKVFFKSPLSCLGLARWLPVNAGDVAMRYIKDPDLLRFIDIECFCWSVMPANLTPMINGMVFSDRHYGGINYPKGGVGVIAEKLVKGIKNLGGEIRYKSRVKKIIFEKGNAIGVSLENDEEIFSKTVVSNATRWDTFGGQGIKSPLATENKPTSEKKWENRYIPSPSFLSLHLGVNVDSIPANTHC--------HHLLLDKWEEMDKEQGVTFVSIPTLLDPTLAPSGSHIVHAFTPSSIDGLSNKEYLAKKKEDGDKLISKLERLFPNLSQNILHKEIGSPRTHKRFLARNKGS-YGPIPSMRLPGLLPM-----PFNTTKINGLYCVGDSCFPGQGLNAVSGYACAHKIGTKLGMNKWE 517
35 -94.200PU10387E NPUN_22DEC03_CONTIG1_REVISED_GENENPR4225 380996 Purified-2007-10-11  ali follow..  22  1MT-NDAIVIGSGIGGLVTATQLAAKGAKVLVLERYLIPGGSAGYFER-QGYRFDVGASMIFGLGTNLLTRALTAVNVSQDAIADPVQIHYLPQGLDLKVDRVYEKFLQNLIAHFPHEEKGIRRFYDECQKVFKCLNSMDLLSL-EEPWYLLRVFFQHPLACLGLVKYLPQNAGDFARRYIKDPKLLKFIDMECYCWSVVPSDMTPMINGMVFSDRHYGGVNYPKGGVGQIAQKLVEGLEKAGGKIQYKARVTKILTEKGKAVGVQLANGKVYRGKRIVSNATRWDTFEQLLPAEEMPLNEKKWQKSPSFLSLHIGVKESVLPVG-----------------TECHHILLEGWEKMTAVEGTIFVSIPTLLDPDLAPSGYHIIHAFTPHWIDELSPSEYKAKKEEAAGRIIDRLEKIFPGLDAGLDYLEVGTPRTHRRFLGRQDGSYGPIPRRKLRGLLKMPFNR------TAIPGLYCVGDSTFPGQGLNAVSGFACAHRIAVDLG..... 495
36 -93.900FP8204D YP_001813234.1 382053 Purified-2007-10-20  ali follow..  17  1MK---IGFVGAGVGTLHAALLLTKPEVEITIFEKESRAGGRLASVDFETGGRIDQGPTIVLMPGKLQEQLR-EAGLEGVELERIDPLYDLFDDGTIVTKQADVVDQTIAIERQ-FGEGRGFQEFMQQKAKDYDVSVSKFLERTYSRKRDLL----HPDMLAPLVKMHAMETAHDHLKRFFKSKHLRMAYSFPTFYIGGNPYTTP-SIYGLIPYREQEEGVWYVKGGYFSLAERMYEALVERGVTFKFNQPVDRVLIQQGQTKGLVAAGQE-YVYDTVVLNGEFPLMEYLVEGKQP-----KKYVPSGGTLLLYFKIDGKVDL----------PVHRFLMPSDLKPLMTSIFKKNELPENPAVYLFNPSKIDDALTASGTSVVYALVPSPR---GFDQANYEAHGFIDQILDKIEQHLPGFQSQVTEMKIRTPQDAQD-FGLYEGGSFGIAPTIRQSAALKTQAKPY----ADIERLYAVGASVHPCGGVPIVGATLLVNRMEQEMRWKN.. 480
37 -93.800PE00370C NP_242714.1 367739 Purified-2006-06-16  ali follow..  20  7KSSYDVVVIGAGMGGLSAATFLAQEGYSVLVLERHYRAGGYAHSFRR-RKFIFDSAVRIAAGAMDGGLLEEL-GVSQDVEFLHLEDIYTAYYPNRKITVKGSVEGLIEAYCEEFPHECHNIRALVQEMEKLYEVTLMLLHSGDPLKVLSNPL-----------MLKYRDKSFHDLTSSFLQDPQAIHSFAALWAYYGTPPTQGSAMFFAYAIMSYFKEDIYYAKGSFQSLADAFVKRIESLGGEVCLRNEVQRVEVEDRQIKGVHLQTGEYVEAEKVVCNGDFLKLVQHLVGEEHFPARYLKRKPSISAFEVFLGVDLPLEKQGLSHE----TFIYNDYDYDLFMEKHQSLGEIGASGLSGLAISIPSLVDSSLAPEGMHTAILTTLVPYDI--GCDWKEKKEDYQDQLIKMAERAIPNLGRHAVHVESGTPLTMERYTNNSFGSIYGWEQTKNQMT-GRPQHE------TPIKGLYLSGQWTDPGGGIVSASGYKLRKKIMKEQVV.... 497
38 -93.500TT0787A NP_630534.1 404511 Selected-2009-08-14  ali follow..  22  2PSMLDAVVVGAGPNGLTAAVELARRGFSVAVFEAQGTVGGGARTEELTPGFRHDPCSAAHPLGINSPAFRGLPLERYGLEWLHPGLPMAHFPDGSAAVLSRSVGETAASFG---ARDAGPYRRLVERFLPRWDTLARDFMSLPLTALPRDPVT--------LARFGLVGLPPSTWLMRRFRDEKAKTLFAGLVAHVMAPLGGFATGIGLVFALAAHARGWPVARGGSQSISDALTAYLKDLGGAVHTDYEVKRL-DDLPPARAYVFDTSPTALARIAGLGSHYANY-----------------RYGPSVFKIDYALDGPVPWTAEEPRSAGT-VQIGADSTEIGAALHAASGTDRAPERPFLITVQPSVADPTRAPAGKHVFWAYGHVP---------NGWNGDLTDAMERQLERFAPGFRDRVLARATAGPAELAARNANYVGGDISSGAVSGLQLLLRPKISLFPYS-TPHPAVFICSSATPPGPGVHGMSGHNAAKAVWRRLRQT... 472
39 -92.700PU10387A NPUN_22DEC03_CONTIG1_REVISED_GENENPR2646 380977 Purified-2007-08-29  ali follow..  20  1MQNTDIVVIGSGIGGLSCAALLARYGFDVIVCESHSIAGGAAHGFER-NGFKFDSGPSLYSGLSYSPSANPLDAIGSELPCVTYDTWGCCLPEGD-FDTAVGAEQFCEVLMKFCGDDAVAEWQELQRVMEPFARAATSIPPAALRFDFGAARTVGPSLTKNVANIIKLTGPFSRIMDGVVKDSFTRNWLNLLCFLLSGLPADGTSAAFMFADWYRPDAILEYPIGGSSALVDSLVQGLERHGGKLMLGAHVEEVLVEGNRAVGVRLRDRSEIRAKLAVISNASVWDTLKLLPEKAIPKQYRSKPECDSFMHLHLGIDAQGLQSNL----------------RCHYIVVNNWELGVTAPQNVVVISIPSVLDPSLAPAGKHVIHVYTPGNEMDRRSQEYAEQKRSRAEVMWQALERIIPDIRSRCEVTLVGTPLTHERYLRRHQGS-YGPAIQAGSGMFPSP--------STPLPGLMCCGDSTFPGIGLPAVSGLIAANTLAPVNKHLA.. 505
40 -92.300PE00370H NPUN_22DEC03_CONTIG1_REVISED_GENENPR6433 368191 Purified-2006-06-21  ali follow..  14  1MEIFDYVILGAGLGGLSAAACLTRQGYRVVVLEQHYLPGGCCHTFDY-GEYHFCADVHYISQCGSGQTITQLDYIHQNVPFNSLDSDCRVITPEADFKIPLGWENLRSRLLSTFPEEAGAINHYCNEIQQLHQEIRNLVQEVRWY---DQKLSDWLKLPKYLNLFWKRNWTLQDLYNHVGLSPKLQAVLAGQSGDYALPPQEIALLTHTSL-VWDYSEGAYYPKHHFKHLVDTIADVITAGGGVIKYSTPVSHIQVSNHSVHSVLADGNSYRASKAYISDLDPKLTVELMHDITALSQKEYKRQYSASAFNIYLGLDSRFDPQRYG-----IGNWNVWYYPTGDLNREYQQQLEGDFSQPWIFLSCMKSSEPGMGPEGHHVLEIATVCSYYKSNPKAYKAKKREFYQQIMTSVRDLIPDVDKYARMKVYGTPTTSEFYLGQPQGNIYGAKLVPKQVGLNRLGYM------TELPNLFLVGASA-GYPSVPGVNGMQVVELLTGQSVWHK.. 509
41 -91.900PU10387B YP_321390.1 380978 Purified-2007-08-29  ali follow..  20  1MKQTDVVVIGSGVGGLSCAALLARYGFDVTVCESHSIPGGAAHGFER-QGFKFDSGPSLYSGLSYSPSVNPLRLDAVGVDLPCVTYDTGCCLPEGDFDAAVGAEQFCEVLGRLRGEAAVAWRRLQQVMTPLAQAAIALPPAALRWDAALTIGRFAPTLAKQSANFFKLTGPFSRIMDGVVHDPFISNWLNLLCFLLSGLPASGTNVAFMFADWYRPGVALDYPIGGSGALVNALVEGFKKHGGELLLHTHVEQVLVEGNKAAGVRLGDGQEIRARRAVVSNASVWDTLKLLPEGAVSQKFRSQRQADSFMHLHLGINAQGLPPDLA----------------CHYIVVNDWELEITAPQNVILVSIPSILDPSLAPQGKHVIHVYTPGNEMDRRSQEYEQQKRSRAEVMWQAVERIIPDIRSRCEIQLVGTPLTHERFLRRYRGSYGPAIS---AASGLFPGHG------TPLPGLMCCGDSTFPGIGLPAVSGMIVANTLAPVSQHLA.. 505
42 -91.800PU0787C NP_599728.1 381019 Purified-2007-08-29  ali follow..  21  8TGAKHAVVVGSGPNGLTTAAVLAKAGWQVDVYEAAPTPGGAARSESVLEGTISDLGAAGHPFGVASPAFHYLGLEDHGLEWAYSPFAMAHLDYGRAGLLETSLPETAKKLGPDARRWKNLHQGLTKNIDKHLANLLGPVLKWPAH------------PIRMAKFGPFALLPAKRLASAAFETEEARSLFIGSAMHSVTPPHKPMTALGLLFGALGMSRGWPVAVGGSGRIVDALVNVINHHGGTIHCDSQIDSLSQFRD--------------TDAIILNQTPSQVLKLKGTNAGLPQRMSTWKHGPSSYKVDYLLDGPIPWSNPQ--VGQATTVHVGGSSEEIAFAEAEVAAGRMPERPFIILCQQQVADPSRAREGRHVVWAYAHVP--------RGFVDKRAALLITAQIERFAPGFRDRIVHSVDTNAEDLEAWNNLVGGDITAGSALLRRM------------PTKIGEKTYMASASNAPGGGVHGMPGWWAAQAVLADHR..... 471
43 -90.900FL8204A YP_292330.1 375375 Purified-2007-05-09  ali follow..  16  1MSEESIIVVGGGIAGLTGAALLSKEGYQVTLVEAHSQLGGCAGTFKR-GSYTFDVGATQVAGLEHHRLFNYLDIPLPDAKILDPGCSVTLGDGSRPINLWHDPLRWQKERQEQFPGSEIFWSLCSKIHESNWEFVERDPILPVRNFDLSQLIRAIRPSNLLTGFLSKLTIADLLTITGCHKDRRLRSFLDLQLKLYSQEPASRTAALYGVLQMAQSPRGLWHLHGSMQILSDLLKDSFLRDGGSLLIGHRVTKIIRENSNVFDVKVLDRRKMKASDIVFSLPPQSLLDLIPIDGGLSTTYRESPKPSGAVVFYGALRRVDLPVDCPGHIQ-------------------------FDEHFGSLFISISLENDQRAPIGMATLIASVFVDIDNLDSQAYTRKKSVVSKQIRAILDHKFDLLETSWDHQELSTPRSFERWTGRPSGIVGGLGQHPDQFGPFGLSSR------TPLKGLWLCGDSIYPGEGTAGVSALMVVRQLLESKGRH... 498
44 -90.900PU10387C YP_291683.1 380980 Purified-2007-09-18  ali follow..  19  1MRNPEVIVIGSGIGGLCCGGLLAKAGKRVLILEAHSKPGGAAHGFEK-NGYKFESGPSLWSGITTNPLGQVLKALNQKVDLIKYQDWNVQIPEGDYTIGVGDRRFLDQINSISGKDAMKEWENFIQVIKPIGAAANAIPLLALNQNTVLQLLKRSKTLLTHLKSFKYLGGAFGNLVDDHLKDPFLRNWVELLCFLISGLSKDETNAAAMFDDWFNPDAYLEYPKGGSESIVKALLDGIYSFGGDLQLNSKVSQIIIKRNKAIGIELKNGERIFADHIVSNADIWNTIELIPKEISQKWRGKRSKTPKCKSFLHLHLGF---------------NAEGLKDIPLHSIWVNDWSKGITAERNVVVLSIPSALDPTMSPPNKHILHGYTPANELKIGSKEYERTKEERCSVFWEPIKKLVPDIEERIEVKMLGTPLTHQRFLNTKNGSYGP---ALSAAEGLFPGNK------TPIKNLLLCGSSTFPGIGIPPVSGAMAANTILGSKFQRD.. 502
45 -90.500FP0787A NP_285686.1 382055 Selected-2007-08-07  ali follow..  28  17SSLLDAVVVGAGPNGLAAAVTLARAGLRVQVLEAHERVGGGLSSAELTPGFVHDVGSAIHPLAAASPAFREWPLHAFGLRWIHPPPLGQTLAGGGSVTLERDLSATAAVLGADGPAWERLFAPLVQEWEELLDDILRPLPHVPRH------------PFTLARFGLRALPPADLLGRTLFRTPQARALWXGIAAHTGLPLTTPGTSMTLVLALTAHAVGWPFPAGGAQALADALRRYLEYLGGEVITGVRVS---------------QPRDLPPARVTLVDSSPAVLLRLLGDRAPAAALSRYRYGAGMQKFDYALSGPLPWQ--DERLRRAATVHIAGSAAEIVASE----ASLQSERPYLLAAQHSLFDPSRAPAGGHTLWVYAHVPN---------GSDADLRPRVEAQLERFAPGFHERVLACRVTTASQLERFSPVFVGGDVAGGAVTLPQLVARPVLSAAPYR-TPVRGVYLCSSSTPPGGGIHGMCGVNAARTALADEFGFR.. 488
46 -73.400FN2862A CAUR_25MAY01_CONTIG978_REVISED_GENE4609 379178 Purified-2007-10-11  ali follow..  43  4TSDYDVIVVGGGHNGLTCAGYLARAGKRVLVLERRPIVGGAVCTEEVIPGYKIDVGSSAHIMIHLTPIVRDLELERHGLEYIDMDPFYPLPDGSGAIYFYRDVERTCQSIATVSPRDAEAYRRFLDFWTPLNEAVFDVFLNPPSVTVASSIPRLPKAEQKVLEVTRRLFTSYAQLIEETFESEAMRAAMTWLAAQSGPPPDEIGAGDFFGWHAMLHYSGAKHPRGGSGMLTQAMARSLKAMGGEVILDAPVRRILVQNGRVQAWKRQTVSAIRPRLLFPTLTC.................................................................................................................................................................................................................................... 293
47 -63.000FL8204B NP_987266.1 375430 Purified-2007-04-13  ali follow..  16  1...MDIIVVGGGTSGLLSALALEKEGHNVIVFEKESYVGGLCRSEKI-DGYSVDIGVHAITMLDNGPLIRLLNFRNYGDYYIRTDKLHRIPVSMTPVIPNKDKVLITSKIMDLMTTKDASVYDFVKEMGLSSTSVDEDLENTPLWRFFTGAGYIPEDDILPFIYKDMKINPLKSTLVKKFGTERIINILNDGFI---SSIKNGSKKYINKFMTEHRYSTQGYPVGGVQSICNCITYSLRNTQI---KNEEVKKI-TKNGKKYTVKTSEGE-YTSDIIVYSAPA-ITLPKVAKINKIQKNKEKLSNIKFTKSTTVWIG--------------------------DEKNYFPYLGSEIWIDNPCWASTVSNYDESLAPKGKHLMGFSFVNSKKEDALKTIESKLNLNTDKVMLYVQETVPEQASCSIGQFFVYPKIDDT-FFVVGTDSDPRSMGITRAAY------SVEVMLSEFKNIYDTQKET............................ 465
48 -61.500PE00370D CAUR_25MAY01_CONTIG978_REVISED_GENE4610 367870 Cloned-2006-07-07  ali follow..  44  1.......................................................................................................................................................................................................................................................................VETADGQRYSAPIVVSNAHVLTTFLQLVGPEHLSADNHIRIGNGFGMTVRCAAEELPDYIAARSHESHHGLQLLSPSMNYVRRAYEDYLRGEPSREPAVIAMTFSAIDPDVAPPGKHTVFLWSQYFPYQLSNGHWDDIRESVADSILEVLYRYAPNMRGKIIDRFIQTPLDLERRIGLLRGNVMHVEMSFDQMFFFRPLPELAGYR-TPIRGLYLTGASTHPGGGVFGASGYNTARVVLADTRARRW. 256
49 -54.700PE00370I OOEN_16SEP02_SCAFFOLD26_REVISED_GENE975 368196 Selected-2006-05-02  ali follow..  18  2................................................................................................................................................................................................................................................................................................NASDKEKGRYSKKKIK------KLDYSMSCFMLYLGIDKKYADLKLHTIKMA-DDFERNVNEIDHGIIPKDPSFYVYNPSSIDKTFAPHGESSIYVLVPVPNLKSYDKWSNSIITNFYNLIIDKLEKELKDFKKSIVFKKIFTPNNFREKYNSFFGSTFGLKPTLMQSNYFRPHN-----RHSTIKNLYFAGASVHPGAGVPIVSGQLSAQELERDFK..... 211
50 -54.100CM8204A CHUT_08NOV04_CONTIG199_REVISED_GENE1811 369179 Purified-2006-08-10  ali follow..  16  1..................................................................................................................................................................................................................................................................................................................................MGVNTKLDKLEHHNLFFDGDFPKHAREIYEDPQWPENPLFYVCCPSRTDPSVAPAGKENIFVLMPIAP---GIADEEAIRETYYNLLMKRLAYTGVPVRENIEYVKSYCVKDFVADYNSYKGNAYGLANTLMQTANLKPKI-----KNNSIPNFYYCGQLTVPGPGVPPSSGQVAANELLKTLSVN... 181
51 -46.800FL8204F YP_001814491.1 375498 Selected-2007-03-12  ali follow..  16  1ME--SIAVVGGGLAGLSVAALLAKQGKQVQLYDA-AMLGGRATSQRI-KGYTFNYGAHAIYGRDLKTIIKNLKLEITWLDFSS---------AKAKYEFSGHLTAAPANAIGLLKTEVIGGTDKLRFTWEVVKTVLRLEKGEP--------------------------LSIGQWLIREKTEEDVSRLMLASSNFFTTEPENIPSVVYFYRKLFRTRKPVSYIAGGWQVLIDELERVIQEQGGTIHRKTKITAIEEYEQGYQ-LRDRKKTEWIVNRVVLALPPRDMRKLALPASVQSFIEPFAQYEPEVLVYDVGISPYL----------------------------KTPFSYVYDRTHQLFVTDLSHYDPSIAPKDGQVLQVVAYLAHPEVGN---PDYLAEKVQHIHRLLDQHYPTWQERLVVERTMKRAIVQEIKWKMG------------------SGLPNFMQDGPKETMAFVGDWCGEGQLSELSSALNVAATW.......... 425
52 -46.500PE00357D NP_419917.1 367872 Selected-2006-05-02  ali follow..  15  7GQHVETLVIGAGPAGLTTAYTLAKAGRGVTVLEMDEYVGGISRTVDY-KGFKFDIGGHRFFSQEIVDLWNEILPD----DFIDRPRLSRIYYREKFYAYPLKAFEALANLGVWTAAKCMASFGWAKLTPIAAPTTFHQWVRNQFGEKLFSIF--------FKTYTEKVWGMSCDEISADWASQRIKGLDLGAAIIDGVKRSLGLRGKAAEGGPKTLIESFRYPRKGPGMMWEACADKVMALGGDVRMGRKVDGLHFDKIAKLWTVAGRKEIYTADNVVSSAPIRELMQSISPTPISVFHAGELMYRDFITVVLIGKPQ--------------------------KELPDNWIYIHDPSVKVGRVQNFRSWSPEMIPDGVSTCLGL--EYFCFEGDGLWVTSDEELVAQAKREIGKIGLMAPADVYDACVVQHKAYPVYDDAYAEHV----------------KMIRLDLKMHFPGLHLVGRGMHKYNNQDHATGLLTAENIIAGETLHD.. 470
53 -44.100PE00349I NPUN_22DEC03_CONTIG1_REVISED_GENENPR3653 368186 Cloned-2006-07-07  ali follow..  11  6.QQKRVVVVGAGWAGLGATYHLAKQGYDVTLLEAGPYPGGLVAGWQTAAGKSVEAGIHGFPYKNIFSLINQLEINPF--------------------TTWTRSSQYSPAGLEVESPIFQDLPRLPSPLGTFLYTQFKRLPLIDRLSALPLLYAVVDFDNSDDAWRRYDFVTARELFKNFNVSARLYREAPMLLVGLFAPGEQCSAAATLGMLYFFILAHVWCRGTVGEKIFRPWVEQIEKAGARVLPKRRVTDLIVDSNHRAKGVVCGDEIFDADAVIFAVGITGMKKIVSNSPSLQSHEEFRNLSNL-------------------GGIDVLATRLWFDRKIDIPRPSNACFGFDASTGWTFFDLNALHDEYRDEPGTVIEADFYH------ANQFLSLSDEEILAIVQSYLATCVPAFGEAKIVDSSVIRLSQAVTHFAPG------------------SYRYMLPAKTSFENVFMSGDWVHGSWSQEKATGLEAANLVVSYLGEGQ.. 465
54 -43.000GD3006A YP_910318.1 388062 Selected-2007-09-21  ali follow..  14  1MTKQSVVIIGGGPAGLTAAWELVKDGYDVTVLEATREFGGISRTVKH-DGNRMDIGGHRFFSDRIMDWWKDVLPLQGAPSMLKRHRVSRIYWNRHFLDYPISLSANTLKAMGFKLTMVAGFSYLKSMVHKLPETNLENFYINRFGRKLYSMF--------FEGYTEKLWGRHPSEISADWGAQRVKG-LSIMGVLKNAFQKLLPKKRDNSEVETSLIEEFWYPKLGPGQLWETVESNCEAAGVKVITDANVVEIRQKDGKIASVVYEDSTEMAADDFISSMPVKDLVNAVDASDHPAPKDMTEIANGDFVTVGLLVKH-----------LRLTNTTDIPTLGNPPIVPDCWIYVQDPGYKVGRLQIFNNWSPYLVKDVDNTVWIGLEY-FCEEGDSFWNMTDEEATKFAIQELTRMQV-LDSHRERVKKAYPAYFDTYDRMPE----------------------LVDYLDSFGNLYCVGRGQHRYNNMDHSTAIEAVKDIKSGETSKD.. 514
55 -41.900TT8204A NP_822828.1 404110 Selected-2009-08-14  ali follow..  16  18.PERAAVVVGGGLAGITAALALADAGVRVTLLEGRPRLGGLAFSFQR-GALTVDNGQHVYCCTAYRWFLDRIDAAS-----------LAPLQDRLDVPVLDAGGKPGRRLGRIGRTALPVPLHLAKSLATYPHL--------SLAERARVGRAALALKGLDLADPALDTQNFGSWLAAHGQSARAVEALLVGVATLNAVAGDSSLGLAAMVFKTGLLSDIGWARVPLGELHDRLAKALDSVGVRTEVRTRVTSISLNGNGRWSV-QVPGETLHADAVVLAVPQREAHELLPEGALDAPERLLEIGTAPILNVHVVYDRKV------------------------------LSRPFFAALGSPVQWVFDRTEASGLPEGQYLALSQSA------AQDEIDEPVSVLRERYLPELERLLPATRGAQVKDFFVTRERTATFAPTPG------------------VGRLRPGARTKAPGLCLAGAWTATGATMESASGVSAAGAALNALGRPR.. 464
56 -41.600FP1217D YP_320889.1 382006 Purified-2007-10-18  ali follow..  12  6.QQKRVVVVGAGWAGLGATYHLAKQGYDVTLLEAGPYPGGLVAGWQTTGGKSVEAGIHGFW-RNIFALINELNIHP--------------------FTTWTRSAQYSPAGLEVESPIFQDLPRLPTPLGTFIYTQFQRLPLIDRLSALPLLYAVVDFDNSDAAWRRYDSVTARELFKDFGVSARLYKEAPMLLVGLFAPGEQCSAAATLGMLYFFILAHVWCRGTVGEKIFRPWVERIEKAGAKVLPKHRVTDLIIDSNNQATGVVCGNEVFDADAVIFAVGITGMKKIVSSSPSLQSRAEFRNLHNLGAIDVLAT-------------------RLWFDRKIDIPRPSNACFGFDNTTGWTFFDLNALHDEYKNELGTVIEADFYH------ANQFLNWSDAEIVATVQNYLTTCVPGFAQAKVIDSSVIRLPQAVTHFAPG------------------SYPYMLPAKTSFDNVFMSGDWIHGSWSQEKATGLEAANLVVSHLGEGT.. 465
57 -41.300CM8204B NP_601629.1 369430 Purified-2006-08-10  ali follow..  20  1................................................................................................................................................................................................................................................................................................................................................................................................................MVGRIAIAAVAQIGRWADGLESRIVVQRTIGPADFADRYNSWSGGSIGPSHTLAQSAFFRGSN-----KSRKVDGLYDAGDTTVPGVGVSMCSAENVLKRLRGDNSVDR.. 108
58 -34.000FL8204C YP_832983.1 375442 Purified-2007-04-04  ali follow..  16  1MGNYDAVVVGAGFAGLTAARELSRQGLAVHIVEARDRIGGRTWLDHR-LGRDLEIGGTWVTQPHVWAELTRYGLE------------TTPSPEPERAFWWADGCRHEGRPDELLGLIGQTNEEFVRDSRKYFPEPFRPMARDDFKSIDHV--------------------SVQARIREQFPAGAPRDILESFWALNFNGPLDNAALTQAF-AVNFEACATYKIVGGTAALAASM---LADSGAGIQYGFKVEAVAEDADVVE-IRSADGRTVRARTAIVTVPLHALNAVDFEPPLPAAKAEAASLGQVSKGAKVWFRLRGEHAPFVALGGADWPLNFFQV--------------------------------EYALDGDTIAVGFGPDA---------AKIEVEDPVAVQAQLARLVPGAEAVASHNWVDDPLSGETWPMHRTGFLSTHLPAMQA----------------SHGLVLFAGSDIANGGFIDGASGMGAALDAASLLAGGR.. 434
59 -33.400GE8204A EXIG_01APR05_CONTIG281_REVISED_GENE1727 396730 Crystal|NMR-2009-02-12  ali follow..  11  1MSSKRLVIVGGGITGLAAAYYAERADLNITLLEAGERLGGKVATYRE-DGFTIERGPDSYRKHILTDLIEAIGLGE---KLVRNNTSQAFILDTGGLHPIPK-----------------------GAVMGIPTDLDLFRQTTLLTEEEKQEVADLLLHPSDSLRIPEQDIPLGEYLRPRLGDALVEKLIELSGIYAGNIDQMSTFATYPQFVANEQKAGFLSLETGLESLIERLEEVLE--RSEIRLETPLLAISREDGRYR--LKTDHGPEYADYVLLTIPHPQVVQ-LLPDAHLPELEQLTTHSTATVTM------------------------IFDQQQSLPIEGTGFVVNRRAPYSITACTAIDQKWNHSAPDHTVLRAFVG----RPGNDHLVHESDEVLQQAVLQDLEKICGRTLEPKQVIISRLMDGLPAY----------------TVGHADRIQRVREEVLAQYPGIYLAGLAYD-GVGLPDCSAKTMIESIELEQSHTDES 470
60 -32.300XB5422A NP_869436.1 358560 Selected-2005-01-24  ali follow..  11  1...MNIAIIGGGLSGLSTSVHIRLLAPNITLFEASDRLGGVIHTETLGRTFVIDHGADMFAPSAAIDLCEQLGVADQLLRPSPLGRGAMIARGNRLIPIPEGFVLMRP------TKLGSMLTTPLLSLTAKLRLLQERFIARRVESVTD--------------------ESVGSFVRRRLGEECLDNIVAVAGIYTADVDRLSMAATMKPIWDMETSDGFRAFPNGMKQWIDTLADFTGR--ENIRLNTAVQSIVPLPDNRYQLNVDGQSTQEFDQVVVSTPAHVAATLLQPLSEEAASTLRSIPFASTAIVVMAVRR---------------------ECISRLPTTFGFVVPPKENRRVLAGSFASTKFPQRAPDDYVIVRAFV-----VMQPEILDSSDNEIIDIVRAELGELI-GLDQTQSLQDITAMVKVVRWNDAMPQYEVGHLDKVQRI----------RTALASLEGLHLNTNALG-GVGIAPVASKRTAERILK........ 485
61 -31.500FL8204D NPUN_22DEC03_CONTIG1_REVISED_GENENPF6425 375472 Purified-2007-04-13  ali follow..  15  1MR---IAVIGGGASGMVTAYLLDKQGHHITVFERQPMLGGHIRTLNKDCNEMLESGVLEFVFHNFVALMQEL-----GVELEPIRVGSALFPKDGSPFFS----KVTNENNYTGIQRFIEYLRFDTIHTRSLGLWLKTRFAQMEDFYNRPLSQY--------------------VNNQSISNTWLKLLTMYSYSMPFELIDNFPAEMGIPMLRDYLAVKWLRIKGGVYSYIEKI---LERFQGEVLLNVEIVNISRSPDGVI-IQRSHGEIQEFDKVVFATPPDQVIALLADPTEAEIKRFSDWKANYATTTIHT------------------------------------DIFMYDHHHIHHPSEFDFFQTDTQWGYNSCLNQLCGISSPQHYFLSFQLEELIAKDRIIHTQEHHTPLYTTESFRYRDEVVA------------------------------------TNGENNTYYAGAYLGDGGAI--ASAFRVAQLIGSPLA..... 408
62 -31.100FL8204E NP_104729.1 375484 Selected-2007-03-12  ali follow..  14  5LERTDVVIVGAGFTGLSAALELKRAGINFVLLEARDRVGGRVEAVRNGLGERIDSGGQFLDMPELMALARARGKT-----------FVETYVEGDFITHPSMPPKDAKQTYHGAMAIRERMNGIEPDDPSIKGM------------------------------------SVAAWLERQPDPIDARTAFRSMIEGLWCLPMDRVPLWYLIRITNEVPELQYSLRETMQSLAEDISGDL---GDRVRLGEPATRVEHRPQGVR-VVTGKGA-MEARQLLVALPPATAAKLDFAPTLPARLAKALGVWESGAVIKILVRYPRPFWREQGLSGMVMWRD-----------------------------GLFACDASKDAEHAALVVFVGGPLALRWRVLDEAGLRAEVTGRLQEALGPDAGDIIDFSSRDWIKDRWSGGAYSDLIVDVT---------------ARDAERTILSGAPPVHFAASELSPSGYVEGAAGRIAARKIIAELQSPI.. 429
63 -29.000FM12003B JANN_22DEC04_CONTIG27_REVISED_GENE2793 377327 Selected-2007-05-11  ali follow..  13  31.GPQKIAVIGAGISGMAAAYHLAE-DHHVTLIEAQGRLGGHARTVMAGKTQPVDTGFIVFNHVNYPNLV--------------------------RLFEELDVPTVKSDMSFAASIDGGRIEYGLRSVKAVFAQPANLLR----PGFLRMLRDLMRFNAKAETLATDSSITLGQLMDQMNMGDWFRNLTPVSGAIWSTPKEEIMDFPAQALVRFFRNHHLYTVDGGSIQYVTRLEAAMRARGVEIRLGSGVEAVTRDAKGA--QVQQQGHWDSFDEVIFATHSDDTLAMLADPTDAETRALGAVRYQPNEMVLHADARTM-------------------PKRRATWSSWNYTEQPGFTGGPIDLTYWMNCLQPIP--------------------------ESDPMFVTLNSRAPIDDKYDTATFRHPVYDLPALAAQKTIA--------------------------AMNGNNATWFCGAWMKNGDGY--ASAMDVVEGLKARHA..... 447
64 -27.900FM12003A NP_744880.1 377325 Selected-2007-05-11  ali follow..  15  1MR---IAIIGSGIAGLTCAHLLSR-KHEVTVFEAEQWVGGHTHTLDVVWKHAIDTGFIVFNDWTYPNFIRLL--DQLQVPSQPTEMSFSVHDPIAGLEYNG------------------------HDLNTLFAQRSNLLSPGFWGMIRDILRFNRQALADLDNQRIDASTTLGDYLQANYGQRFIDHYIVMGSAIWSMSRADMLHFPLEFFVRFCRNHGLRVIKGGSRSYVAPLC---RPFAERIRLNCKVYRVSRDEGGV--TLVSAAGTERFDNVVFACHSDQALALLENPSNQERAVLSAIDYASNDVV-------------------------------------------------------LHTDTRLLPRRQLAW-----------ASWNYRLGGPERAPAALTYNMNILQGIQAPTTFCVSLNQTALIDPAQVIARFQYAHPQYSVAASAAQACQE----QLQGQQHSYFCGAYWGNGDGV--VSALKVAAHFGEQL...... 415
65 -27.900TT12003A YP_557604.1 404659 Purified-2009-10-20  ali follow..  17  12.RGSRVAVIGAGISGLASAYLLAR-NHRVTLFESAGYLGGHTNTVDVGHRHPVDTGFLVF-NDRTYPNLIAL-FAELGVRSHPSDMTFSVSLDAGRL-------------------------EWAGTSLNTVFAQRRNLFSPTFIGMLRDIVRFNGSAQRNLELAIQTRASMGELLTESGYGGAFQRLLPMAAAIWSSATADILAFPATTFLRFCLNHALRTVAGGGREYVRQIA----GTLDDVRIGTAVRGVRRGADGV--DVYTDGGTERFDALVLATHAPTTLRLLEDVDQDERGVLAAVRYQPNVAVLHTDVNLL-------------------PRRQRVWSAWNYLGSRGVDGTHPVCVSYLVNQ---------------------------PLPFSTPLVVTLNPVAQPAPGLRRFVYDHPLFDLAAIDAQHRLP--------------------------SLQGKRRTWFAGAWTGYGDGL--KSALRVAADFGALP---AWA 431
66 -27.400TT12003B YP_293278.1 404143 Selected-2009-08-14  ali follow..  16  9.KGLRIAVVGAGISGLATAWMLSR-DHAVTLFEAGHYLGGHTNTVDVTLECPVDTGFLVFNDRTYPNLVSMF--EALGVRSHASDMSFAVSLDDGRL-------------------------EWAGSNVSTVFAQRRNAFSPTFLGMLRDIVRFNGAAQTHLAFAEHSGCSLGDLLQAGQYGQPFRQLLPMASAIWSCATADVMRFPAATFLRFCMNHALRTVAGGARHYVNRIA----SHLNDVRLGVAVRAVRRDEASVT--VMTDEGTSRFDTIVFATHAPDTLRMLADASPAERDVLGSVRYASNVAILHTDATLL-------------------PRRQRVWSAWNYLGRQHGDAQRAVCVSYLLNQLQPLPFRSPVVVTL-------------NAFREPAPGTELRRFHYAHPVFDLAAIAAQQRLPA------------------------------------LQGERRTWYAGAWTGYGDGL--KSALRVARDFGALP---AWS 428
67 -24.800FP5764A YP_165827.1 382253 Selected-2007-08-07  ali follow..  15  1MNSPDAIIIGTGVIGAAIAFEMAKAGWKTLSLDRNAQVGGSTAGSCAIIRMHYSTFEGTALAWEGYHYWRDW---ADYLGLPEGADLARFRQTGCLVMKTVANDQMVKHIRCSAELGIPF---------------------------------------------------------EEWSAEEVLARLPIYALDSYAPARRLEDPEFGKPNGGRMGGAVFWPNGGYALSAQNLMDAARLHGAALRNRAEVVEILQAGGRVAGVRLASGEEIHAPVVINVAGPGSAIVNRMAGVTGDMTIQTRPLRQEVVHVP--------------------------------------APEGFDFETQGTIVSDSDIACYCRPEQGNHILIGSEDPACDKDDLDFDRNFTDQWTTQAMRYAQRVPSLGIPSRMRGVVDLYDASTDWIPIYDR-------------------------SSLPGFYMACGTSGNQYKNAPIAGKMMAALVRYDHDTAPLE 403
68 -24.100GS13639A YP_794478.1 384043 Selected-2007-09-11  ali follow..  1MVKTKAVMIGAGLANMAAAVYLIQRGDQITFYGIDMHGSNDGGEAHNQTGYVARGGRMLRTYVDLMDLLDRIPSTTE-PGMTAAEDTRDFDAHHRTFDKARLLQGGKGIIDGLNNKDRVLLSKLVLMPDDEETKLDNV--------------------------------TIAEYFKDDPHMFQTNFWYMWETTFAFRVESSAQELRRYMHQMIYEFTQIEHLVNQFESMMLPLINYLKGQGVTFIGNRIVTDWEFADSPMQDEITVTGIHVKNTTLVLIDDDTAVIFTNGSITDSTSMGDYNTPAVENMEYGISAALWKKATERFYNLGTPDKFFNDRKNSEWTSFTLTTKNHLLLN----EITRITTQMPGNALNSFLSMSIVVHHQPHFTTQKP-KMTGKEMAQELIGQLDNIKHKEAEILDSIINNIPVHM-----------YASALFNNRAKTDRPEV-------AHSTNLAFTGEFAEQPYQMAVRSGEIAAYHFAG........ 536
69 -23.500PK0600A YP_009859.1 389228 Selected-2007-11-16  ali follow..  11  1MSAFDVIVVGGGPAGLFASYYLAESGLKVCLIERGQSVRKRGCP------------------------------IAKTQKCMKCEPCHILSGMGGGGLFSDGKLNFIHKLGKTDLTQFLPRSQAEALIDETETIFNR---------------------------------------------------FGMDGPVFPSDMDAARDIRKQAKKHGIDLLLIKQKHLGSDDHIFAMCEHLAAKGVTIRTGEEVRTVTVENGSVRGVVTDKGEYACKSVIVAPGRVGADWVGELARGFGLNMSQRGIEVGVRVETHNDVMRDITDVIYDPTFTNPAGFIALENYQDFVCVNGHAYRNRKSENTNFFLSKVVLTDPVSDNTG-QRLGDLRRGRRSTWQRIKNGYIEPTLMNVVPGDIAMALPNLVDGLEQLNNVIP------IADDGTLLYAPEIK-----FFATQVETDSHLETGIRGLFVAGDGPGVAGNIAAATGIIPAKAIIEREGA.... 462
70 -23.400PK0600B DHAF_12NOV03_CONTIG965_REVISED_GENE4471 389470 Purified-2008-01-26  ali follow..  12  1LKKYNVIIVGAGPAGIFASYELATQAPEVLLIEKGRDIYKRSCP----------ILKKTLSKCPPPNKQREFASCTPACSITNGFGGAGAYSDGKFNITTEFGGWLTEYLPP-------------SEVLSLIHYVDQINLKHGATSSL-----TDPSTPTVKEIERKALGAGLKLLRAQVRH-------------------------------------------GTELNLEILKDIYEKGKIDMVFETEVADIMTAEAEVKGIRTNKGEEYYAPKVVVVPGLDTIMEDINENLYEGKFLYRTSVGTTVRSFCSNPSGHVVIENHTGVMLANGHAYRDKNLGSHNTNFALLVSHNFSYPFNKPTEYAKNISRLANDLSNGSVLLIMKGRRSTEKRVKESFVEPTLKEAVPGNLGLVLPYIIEMIEALDKVTPGIASEHTLLYGVEA-----------FYSSRPKLKNNFETEIAGLYAGGDGAGITRGLAEACGVKIARNIIEENS..... 477
71 -23.400PK0600D YP_460871.1 389164 Selected-2007-11-16  ali follow..  14  12SMEYEVIIVGAGPGGIFAALTLADLGIEVLVIEKGKDLSD--RRRGKSQDMLCGWG---------------------------------------------GAGAYSDGKLTLSPEVGGFLNDYVEPNA--------------------------------------LRELLSHTDAIYVAHGAPDRLYGGSSDAVKDLADRARIADLELVPMQVRHIG-------CSVVLQSLQRSLTG-RVDVRTCTPVEKLLTENGQISGVELASGQRIRSRYVLAAPG-----------------SGSRWMKREAELLGLKNRPSPVDIGVRVELPAIVLKDITDVIYESKLIHYSKTFDDEESGDVAAVNGHSYTEARSENTNFAILVSSIFTEPFDDPIGYGRYIARLANGVIVQRLGDLLSGILEMLQALDRLAPGIYSRHT-LLYG----------EVKFYSHRIDVSPEMEAGVRNLFIVGDGAGVSRGLASASGILAARAIAKRIRDASSQ 464
72 -22.400FP12872A NP_745905.1 382537 Purified-2007-11-03  ali follow..  13  3.KSYTAVVVGLGVVGSATLWRLAQQQQDVLGLEAGAPINLQGSSYGGSRIFRQAYWEGSDYLSLLAEADL--------WRELQATSHRPLLHYSGGLFIGPIRSGVVSGSAASAKAGGIAH--------------------------------------------------------QRLTAAEVEARFS-------------------VFRADENMEAVFEQGAFADDARLQMLNQAVAHGAQMRFGSHVQDITRVESEFL-LRLSDGQSVLAQKVVLATGAGLAGSLIPD-------------SGLLRPRSVPIYWCAFKSGAEQLFANFPAFLYELEDGRLLYGTPQIDNAEPGIKIGFHNHQQSALDPRTQL----------------------EPASDAQIEEISACVSRVFPDLIARPYASRK--------------------------VYTMTPDEAFIIGESKELPSVFYVSACSGHGFKFAPALGSCLARALVPAFSRERFS 381
73 -22.300PK0600C NP_069488.1 388958 Selected-2007-11-16  ali follow..  10  2..KFDVIIVGAGPGGMFAAYKLAG-KLNTAIFEMGRDISKRKCP------------------------------SDLSESYCTKCNPCNITSGVGGAGGLSDGKLNYVHPEYPSSFSVGGDFDFLDP--------------------------------------NYLIEKMNEVDEIFLKHGAPDELYGDDLEKIEDFLKRANAAGIEFVPLRQRHVGSDELP----KVVKSIEDKLKKEGVKIYTRKTVVDIDPERK---VVRTEKGEEFGYDYLIIAVGRSGA-KLRVITKRHDDYMRTFCTCPRGWVIREDYGDFCLVNGHSKEKSSNTNFALLGHYEFTEPFDEPNEWGRDLARITTKLGVQRLKDLRLGRRSTESRIKNNRLVQPTLKTAIPGDISLAYPGRAIDDILDALERLDKVIPGVADDSTLLYAPEVKFYSLKL-----------------KVDEWMKTNIPYIYAIGDGAGVSRGIAAVTGLIAAEGILRERGME... 466
74 -22.000FP11320C DHAF_12NOV03_CONTIG1019_REVISED_GENE377 381931 Purified-2007-10-20  ali follow..  13  96SLKHRPIVVGAGPAGYFAALTLAKGGYAPLVLEQGDDVETRSLKVE----------------------------------------------------FWRTGQLDTESNVQFGEGGAGTF--------------------------------------------------SDGKLTTRIADPRITEVLETFVEQGAPSEILFLAKAHIGTDI-------------LKIVTQRLREKIQSLGGEVRFRAKLTGLRHQNGKLVGVEVNHQEVVPAEAVILAIG-IEHPQKLINTSQYGVEFHPKLGPADYQLTYQDTTTGRGAYAFCMCPGGKVVAAASDLERLVTNGMSEYRRDTGIANSALVVTVGKGDFQREHPLAGVEFQEYWEHQAFLAGDRDYKAPAQSVRDFLAKRVTGDFASYTPGIQPVELHRVLVLDRALLSFERKIQGFAGE-TRTSAPVRITRDKMGEALHIQGLFPAGEGAGYAGGIAAVDGIRSAEGIMAQYNPAD.. 534
75 -21.800XB5745A 6967889 358883 Selected-2005-01-24  ali follow..  11  5LKKVDVVTVGAGWTGGIVAAELTKAGLNVLSLER----GHMQSTENIHDEWRYGINYGLMQDCSKDTVTFRHDPSGLALPYRKMGSFLLGNNVGGAGVHWNGW------TFRFMPYDFEIQTLSYKDMEPYYDRFEKTCGVSGEPNPLAEKMGAFRSS---------------PYPQEPLENTKMLKRFESAAKSSNLHTYRLPASNSKGGYTNPDGQDFGCEYGAKASPLNTVIPKAMSTGKTIRTYSNVTQILKKDGKVTGVKFVDTRIQPADIVVLTSYMFNNAKLLMVSNIGEQYDPKTGKGTLGRNYCYQMNMGTTAFFDEQFNTFMGSGALGTTSDDFNGDNFDHSKEKFLHGAMIYSVQLGGQGASLPHKNNYLSLDPTYKDAFGMPLLRLTYNFTDQDRALHKFITDKTAEVAKRMQGVKSIKKGAYLKDYSVVPYQSTHNTGGTTMGADRETSVVNTYLQHWDADNLFVVGAGNFQHNSTVGALAYRCAEGILKYHKSGK.. 570

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.