current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

380646
Query: NS12732A NP_247230.1 380646 Purified-2007-08-29, from JCSG1009

Results of FFAS03 search in JCSG1009
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst MVFFMLIIDVNHGALTLAEEYLNLGYEVDVWDIYQKIKKSEDFKVKYQKLKEKFGNKLNLFFEQPNFEKYDRVIAPIHCPIDVDFIPFTDAVSKILKEKFGNIHKKIINVTGVKGKTTTTSLINHILKDKYSTYLHNSNFGSIAPPTILKVLNSLDIDKYDFFIFETSLGLIKCKYGAITNVLENYKIAGGRKDALTAKFSSLKNAELSFINKRDINRYDLNINHKCLNVVDVDRAKILDKYPLKFKYFDEIFEFSKNIFGLHFVENSLFAIEICKNLVDMEEIRYRLKTFTIKNRMEIKEINKKILVKNINPGLDVKAISYAIKDFLEVFGGDIYIGGDFGIVCEEIDVKKLSEVLKRFNCRYIFVGEIGKELLNYLNGGYIKSYDENKIKRDSLVILREKIKLast
1 -90.600NS12732A NP_247230.1 380646 Purified-2007-08-29  ali  100  1MVFFMLIIDVNHGALTLAEEYLNLGYEVDVWDIYQKIKKSEDFKVKYQKLKEKFGNKLNLFFEQPNFEKYDRVIAPIHCPIDVDFIPFTDAVSKILKEKFGNIHKKIINVTGVKGKTTTTSLINHILKDKYSTYLHNSNFGSIAPPTILKVLNSLDIDKYDFFIFETSLGLIKCKYGAITNVLENYKIAGGRKDALTAKFSSLKNAELSFINKRDINRYDLNINHKCLNVVDVDRAKILDKYPLKFKYFDEIFEFSKNIFGLHFVENSLFAIEICKNLVDMEEIRYRLKTFTIKNRMEIKEINKKILVKNINPGLDVKAISYAIKDFLEVFGGDIYIGGDFGIVCEEIDVKKLSEVLKRFNCRYIFVGEIGKELLNYLNGGYIKSYDENKIKRDSLVILREKIK 404
2 -65.600NS12732B NP_987293.1 380649 Selected-2007-07-05  ali follow..  44  1....MLIVDINHGALDLALEYEKSGKVPVIWDIYGKLERDKNFKEENKNILSKFKIISK--KETPEFSNYNEVIAPVHCPIDVKFKTFHDAVSEIISKKYPKTVEKMITVTGVKGKTTTTELLKHILSEKYSVFCHNSSDGSITPVTVLNILNKKKLQIYDFLIFEISLGIVSSNYSILTNILENYSIAGGKRQAS-IKIYSLKNSKIAFVNEDLKNRFEIYHKNLKIVK----NAKIISKYPLKFNYLKNDFEFNESVFGSHFIENSVFAIELCSYFMSFGEIKNSLKSFEIKNRMNVETKNNYAIVKNINPGLDLKAIDYAIFDFLNLFETGTIIVGGDLGCTEEINIKKLADLIKKDGVKFLLSGSVGKSLKEIINLEFVDINNYAVE-ENTLVIYRSNL. 399
3 -55.300NS12721A NP_895261.1 380588 Purified-2007-09-18  ali follow..  16  1.MARTVVVGLGRSGIGAARLLQAEGHQVTVLERSIEPHLQSLAALRLQGIAVELGKPLELNSFIPLLDQLDAVVISPGIAWDHPTLTALRQDGEMAVAWRSLSHLPWIAITGTNGKTTVTHLLNHVLESNGLRAPMGGNVGHAAAEVALKWRQDWLVMELSSYQIE-AAPEIAPRMGIWTNLTPDHLERHGTDAYRTIKRGLLERSEIRIFNGDDPDLRSQRSSWDKGLWVSSEGPGIDAEGLVREPQGALFAASALAMPGQHNLQNLLLVTAAARTGLPAKAIEASLRSFGVPHRLEQLGHIQQMSVYNDSKATNYDAACVGLKAV---PPPAVVLAGGQ---TKQGDASGWLKQLDQNACAVILFGAGASELQELIKTSGFSELHCCSNLNAAVTLAIPLGV 421
4 -53.400MJ14505A NP_604352.1 402911 Selected-2009-06-20  ali follow..  18  24..KKAMIYGLGISGTGAKELLEKEGYKIIVVDDKKAMTSEE---------------------ALNHLEGLEFFIKSPGIPYNDFVKEVQKRILDEIEIAYNYMKTKIIAITGTNGKSTTTAKISDMLNHAGYKATYAGNIGRSLSEVLLKEKDDFISLELSSFQLE-NIENFKPCISMIINIGPDHIERYKSDEYYNTKFNITKNDLYFIENIDDEEIEKRAKQIKAKRISVSKFKKAVENDKIYHDKDDIIDVDKLSLKGIHNLENTLFMVATAELKLDREKLKEFLMIAPLEHRTELFFNYGKLKFINDSKATNVDSTKFAIQAN----KNSILICGGY---DKGVDLAPLAEMIKENIKEVYLIGVIADKIENELKKVGYEDIHKLVNIENSLQDMRKRF. 415
5 -50.700TM0234 TM0234 282113 Purified-2001-09-05  ali follow..  14  2...KIGFLGFGKSNRSLLKYLNHQEAKFFVSEAKTLDGET-------KKFLEEHSVEYEEGGHTEKLLDCDVVYVSPGIKPDTSMIELLSSSTELQFFLDNVDPKKVVGITGTDGKSTATALMYHVLSGRGFKTFLGGNFGTPA-VEALEGEYDYYVLEMSSFQLF-WSERPYLSNFLVLNISEDHLDWHSSKEYVDSKLKPAFLGDLFVYNKHIERLRNLEGVRSRKIPFWTDE----NFATEKELIVRGKKYTLPGNYPYQMRENILAVSVLYMMFNELESFLELLRDFPLPHRMEYLGQIDGRHFYNDSKATSTHAVLGALSNF----DKVVLIMCGI---GKKENYSLFVEKASPKLKHLIMFGEISKELAPFVGKI---PHSIVENMEEAFEKAMEVSE 391
6 -49.500MG14505A NP_281622.1 390736 Selected-2008-01-23  ali follow..  15  1..MKISLFGYGKTTRAIAENLVDKFGPFDIYDDHFTETKKDTLGNL------------LLNPNDFDDNLSDIEIPSPGFPPKHKLIQKAKNLQSEYDFFYDIMP-KSVWISGTNGKTTTTQMATHLLSHIG--AVMGGNVG--TPLAELNPYAKLWILETSSFTLH-YTHKAKPEIYALLPISPDHLSWHGSDNYVQDKLSVLKRCDVVILPKIYANTPTKAHKISYEDEKDLAVKFGID----------------TEKISFKSPFLLDAIMALAIKILLDTLSYKLLNSFMEKNKLEELKDSQNRLWVNDTKATNESAVMAALSRYKD--KKIHLIIGGD---DKGVDLSNLFDFMKGFDIELYAIGISTEKMLDYAKKANL-KAYKCEVLSKAVNEISNHLR 368
7 -48.300MJ14505B NP_908137.1 403759 Purified-2009-08-20  ali follow..  15  2...KLSLFGYGKTNRAIAERFAPCDIYDDSFEESGVDS----------------LGNRLLPPRLFDPESSDVEVTTPGIPPHHPLIQRARHLQSEYDFFADSIP-YSIWISGTNGKTTTTEMIQHLLA--PKDSECGGNIG--TPLAKLNPKAPIWVLETSSFTLH-YTQKAKPNLYLLLPISEDHISWHGSEAYIKAKLKPLGAKEVAIIPKRFLGTPTRGTLIGYEDTAELIDYFGME----------------REKIGFLEPFLMDAVMALAVKILFDEIPYERLNEFIGAHKIEEFTDGLGRLWVDDSKATNVDAANEAVKRYEG--RFVHLILGGD---DKGADLTPLFELLEGRSLQIYAIGSNALKIERLAKERGI-ACKVCERLEKAVEAIRQNLK 364
8 -45.700TM0236 TM0236 282115 Structure-2006-06-28  ali follow..  14  1....................MKDLLTRRFVLNSKEVREGDVFVAVKGKRFDGHDFI------DEALRNGAYAIIAERKTVNSDRIFSSVDTLAKLAREKLGNFSGTVVGVTGSSGKTTTKEILYNLLKNKRSVFKTPGNMNTGLPLSILNDYKGLEMAASRPGDIAHLCKIAPPDVAVLLNVGSAHLEFFGTERIMETKMEISKENAIAVTLFDDPDLRKEVPRYRNTLFFGKEGGDSVYEGSTIAEFEAFDSLFTVKLSGYWNLLNIAASLCVMRLGETVDIF--DLASLTVPGRFNVREK-KGVLIVDDTYNASPEAFQTSIEALLRFPGKKFAVVGAMKELGERSKHEELGERLNVLGVYVFLSEPEAEWIKSKKI------ILKSDDPEKIAKDLATRVK 397
9 -43.400MG14517A NP_294492.1 390780 Purified-2008-03-28  ali follow..  11  23............................LTWDSREAGPDTAFVALPGEKMHGNRFV------ERALAAGAPFVLTDLDVPRAVRVDDARGALFAWARSERAK-NPLVVGITGSAGKTTAKSYAAAALDAHFM-----PVFNTAIACFLVQYGASVEMGIDHIGEMAELMDLVRPDVGVVTTIGPAHLEQFGMETIAHEKGQILTA---ALVGSQAAAFFPKAQFPHVDSYGFGDVTFRGEGLELSARFRFGGMGVILPLASRVQAEAAVLGMVLARAGIALADAAVRMSAVEPGGRYRLHP--GRFTVIDDAYNASPVAVRAALDALHALKGRRISVLGRMLELGPTERHAEVGSYAREQADLTYGVGEFAQELGERA----------FATVPELLADLLNEVR 393
10 -42.700MG8963A YP_831786.1 390413 Selected-2008-01-23  ali follow..  13  10...................................................................KLVRRVSRLRGGGSALPGLVVEKIDPGFMQRTLSTLPLGVAVVSGTNGKTTTTKMVVELLESQGLKVFTGSNFTRGVAAALLGDVDWRGRLKADIAVLELFVNRVPPRYSLLLNVLRDQLDRFGEDKTAQLLQHIASKTGTVVLNREDPRVARIADTLDGPEVRYFGLDDSLLTDDADFEYDGATVTTGMKLRGVYNIFNAAAALALARTPTDHDGLLKALSQVPAFGRGESLVVDGLPLD--LVLVKNPSGFRLGLKSFPAGGYATMVAINDNYADGRDMSWDVEFDSLREGGV-DQLTGSRAYDMALRLQYDDVAVGAVNPEIAPALAAFIQGAK 399
11 -41.900PX8963D NP_828301.1 395899 Selected-2008-07-14  ali follow..  10  3.............................................................GNSDPLTPRAKLAVTAGKAVAAASRAAGRVIGGRVALKLDAQHLDVILVSATNGKTTTTRLIAEALRAAGPVVSNGANMPAGITSALAGGSDKYAVIEVDEKYLAGVARDTDPKCIALLNLSRDQLDRAAERMLAEHWREGLAGKAVVIANADDPLVVWAASSSANVIWVAAGQMWKDDAWSCVLDPHGSAWPIHLQLPGRANKANAASSAAVAAFGVPPQVALERMYAVAVAGRYDVVQFMQRDLRLLLAK--NPAGWLETFSLIDPPPTPVILSVNARGADGTDTSWLWDVDYTRLTGHPIFVIGDRKLDLAVRLEVANQ-SFQVCENLDQCVQQAPP... 391
12 -41.600MG8963F OOEN_16SEP02_SCAFFOLD10_REVISED_GENE214 391118 Purified-2008-03-28  ali follow..  13  27...........................................................................GTSLPGKIAYRIDPTFLEEFRD------QIETVIVSGTNGKTLTTALCARVLKKTNRVVVTNNSGSNGIVAALLSQKDPIAVLEVDEANVKEVAKILQPTHFVLTNIFRDQMDRYGEYTTYEKITDGIKTKAKVVANGDSPIFARKPYKNQAVYFGKYSVNKINSLTPSKSEFEIAGNKFTLPLGGLYNIYNALAAYSLGRFQISAEDIFNALNEDRIFGRQEQLTIGSHLV--TIVLIKNPVGANSVIDMMMTDPEELVTLLNANYADGIDTSFDAEFEKLHQTLKKIIVGGQRYKDFSVRLKMAGFKNQIVEQDFAKLIDRIKELPT 424
13 -41.500MG8963N YP_753652.1 391556 Purified-2008-04-15  ali follow..  15  37.........................................................................................KIYPRILRTLSTNIRREIVVITGTNGKTTTSNMLAEILQQQGYSLVHGANMLSGITTAFIEKSDDYALLETDEATVPLLLRETRPRLVLITNFFQDQLDRYGEDHTIKLIQEAVKDEIEMLLNADDPLTANFEAETGLKCRYERDFTGQELEMSPDIELKVDGMALKSPYQGFHNAYNILAAVSLARLGVEEENIKKAIASFPQAGRMEAFFINGKRVVLA--LVKNPAALNQTLASLIYDPSNLFFALNDNAADGRDISW-ELLEYENVMVEQIVCSGQRSGDIALRFKYAGFERIRIEAELPRAIELAVQGSA 424
14 -41.300PX8963E NP_765132.1 395923 Purified-2008-10-09  ali follow..  16  24...........................................................................GTDLPGQIARRVDHNILRKLAKQVD-----DIVFISGTNGKTTTSNLIGHTLKKNQINIIHGANMAAGITSAFIMQSSNIAIIEIDEGSIPRVLNEVTPSMMVFTNFFRDQMDRFGEDIMVDNIAKSISNGIKLLLNADDPFVSRLKIASHSIVYYGMKKFAHDFDASPFLKMIINQSEFNMKIAGDFNSYNAIAAYTVLRLGLNDDAIRKGFETYSDNGRMQYFSKNKKEAMIN--LAKNPAGMNASLSVGEQIDDKKVISLNDNAADGRDISYDADFEKLATQIEAIIVSGTRAEELQLRLKLAEVEPIKVEKDIYKATALTMK... 407
15 -41.100MG8963I NP_721787.1 391393 Purified-2008-04-01  ali follow..  15  28..............................................................................LPGKIALKCDKDILDTLAK------DYDIVVVTGTNGKTLTTALTVGILKEAYGQVLTGANMITGITSTFLTAKKKIAVLEIDEASLPKITDYLKPSLFVFTNIFRDQMDRYGEYTTYQMILDGAAKKATILANGDSPLFNAKTVVNPVRYYGDYSLTQLTKISNTQAEFIIDGQDYKINVGGLYNIYNALAAVAVAELGVTPEQIKAGFDKSAVFGRQETFKIGDKSCTLVLIK--NPVGASQALEMIKLAPYPLSVLLNANYADGIDTS-ANFESILDMNIPQIFTGGVRHSEIARRLRVTGYTKIEQAEKLEDILSMIEKQEA 417
16 -41.100MG8963P YP_795428.1 391729 Purified-2008-03-28  ali follow..  13  26...........................................................................GSSLPGKITLKLDPNILRTLGA------KYDVIVITGTNGKTLTTALTVSVLHEKYPAILTGSNMEQGIVTTFLNAKNPLAVLEVDEANVIKVTHYIEPKAFVFTNIFRDQMDRYGEYTTYQKILDGVALKATIIANGDSPIFNSKELPNPIQYYLTYRLTALGEQTPTSSHFDVDGHPFTIQVGGTYNIYNALAAYAVGRMGVAPEQIAHAFTANRVFGRQEVINVGDKRVTII--LVKNPVGLDQVLHMIGTDKEQFVALLNANYADGIDTSWDGDFEQLTALIPTFITGGERYKDITFRLKVAGVPQHIVEPDLEKVVDRITDLPT 418
17 -41.000PX8963C NP_372416.1 395891 Purified-2008-10-09  ali follow..  13  24...........................................................................GTDLPGQIARKVDTDVLRKLAEQVD-----DIVFISGTNGKTTTSNLIGHTLKANNQIIHNNEGANMGITSAFIMQSTKIAVIEIDEGSIPRVLKEVTPSMMVFTNFFRDQMDRFGEDIMVNNIAETISNGIKLLLNADDPFVSRLKIASDTIVYYGMKAHAHEFDVAPFLYLNINDEKYDMKIAGDFNAYNALAAYTVLRLGLNEQTIKNGFETYSDNGRMQYFKKERKEAMINLAK--NPAGMNASLSVGEQLEGEKVISLNDNAADGRDTS-ADFEKLSKQQIEAIIVTGTRAEELQLRLKLAEV-EVPIIVERDIYKATAKTMDY 408
18 -40.100PX8963A NP_938653.1 395722 Selected-2008-07-14  ali follow..  11  32..............................................................................IGGLIAEKIDPNIMQSLAK------TRPTALVTGTNGKSTTTRMLASAVRAQHTVATNGDNMDAGIISALMAGQSSHVVLEVDELHVPSAADRLHPQCLILLNLTRDQLDRVGINKIERALRDCVTADMTVIANCDDVLVTSVAYDAPNVVWVSAGAGWTGDPDGILTPGHAEPVPLSLALPGNANRGNATQAIAAAVFNVPLDDAVRAVETVDVAGRYSTITLGEHQIHLLLAK--NPAGWQEALSMVDRTAEGLVIAVNGQVADGEDLSWLWDVKFEELEELSVKAAGERGTDLSVRLTYASV-DHELVRDPLAAIKACPA... 394
19 -39.800FJ8963A YP_290770.1 369644 Selected-2006-06-19  ali follow..  33..............................................................................IGGRIALKVEPNLLAELAR------GRRIALISATNGKTTTTRLIAAALREIGEIATNEHGANMHITALANNPKALIGVLETDEKYLPQVLRETNAVVVVLMNLSRDQMDRASENLLAKKWREALAAQAHVVANADDPLVAWAGLAAPHATWVAAGQRWKEDSTDTVTDPEGKTHRLQLRLPGDANRSNAVIALATAAYGLRPEQALPRMREISVAGRYTSIVTKGVEVRLLLAK--NPAGWLESFAILDPPRVPVILSVNAQVADGRDTSWLWDVDYTVLRGRRVFVMGERRTDLALRLETDEV-PFEIADSVDQALTRLKTEQP 393
20 -39.100MG8963L SSUI_28JUL04_CONTIG252_REVISED_GENE1183 391488 Purified-2008-04-15  ali follow..  13  28..............................................................................LPGKIALKFDKHILDSLAK------DYEVVVITGTNGKTLTTALTVGILQEAFGEITTGANMITGITATFLSAKKKIAVLEIDEASLARVTDFIKPSLIVFTNIFRDQMDRYGEYTTYQMILDGAAKQATILANGDSPLFNSTNVINPVKYYLDYKLTDLKEITNTSSTFAIDGQDYKINIGGLYNIYNALAAVSVAAFGVTPEKIKAGFDKSAVFGRQETFKLGDKDCTLV--LIKNPVGATQAIEMMKLAPYDLSVLLNANYADGIDTS-ADFEQITQMDIPQVFAGGVRSSEIARRLRVTGYNQITETPKLEDIMALIEQSSS 417
21 -38.600MG8963E NPUN_22DEC03_CONTIG1_REVISED_GENENPR3559 391109 Selected-2008-01-23  ali follow..  16  16..............................................................AVSVAKSVTFIVRSLRLGAASVLPIARRIEPRLLQLLSQQVKNGVILIAGTNGKTTTALLLCTILEHKGFRVTHGANLENGLMTALLESTNLLGTLNTDYAILEVVLKPLQPRIILCLNLFRDQLDRYGEVDTISKRISTLPTETVVIPNADDPTLSNLGQQLPQRVLFHLGDFTCPKCGFTKSKPTLESSEWSQILVGLYNKYNTLAAATAAILGVDEVTIRDTINTFAAFGRAEDLVINGKRVRIL--LSKNPVGTNETIRVVTQSDKITLLVLNDRTPDGTDVSWDVDTEKLVERGGTLVVSGDRVYDMASQKSPESSINLIVEEDLRQAIATALEHTP 418
22 -38.600FK8963A NP_785844.1 370842 Selected-2006-07-12  ali follow..  14  26...........................................................................GSSLPGKLALKLDPTILKHLAKNY------DVIVITGTNGKTLTTALTVKVLREQYPDILTGSNMKQGIVTTFLRAPKPLAVLEVDEANVIMVTKYITPKAFVFTNIFRDQMDRYGEYTTYQKILDGVALEATIIANGDLPLFNAKQLPNPILYYLTYKLNALTAMTPTSSDFEINGQAMHLNIGGQYNIYNALAAYAVGRMDVTPAKIAHALSDNQVFGRQETFHVGEKDV--TLILVKNPVGLNQVLQTISTDDRSFAALLNANYADGIDTSWDGNFEKLPALIPAYISGGERYRDITFRLKVAGVDQLTIIPDLTNMTTAIQKLPT 418
23 -38.300MG8963J NP_346035.1 391413 Purified-2008-04-01  ali follow..  16  25...........................................................................GSTLPGKVALQFDKDILQNLAKNY------EIVVVTGTNGKTLTTALTVGILKEVYGQVLTGANMITGIATTFLTAKSNIAVLEIDEASLSRICDYIQPSLFVITNIFRDQMDRFGEYTTYNMILDAIRKTATVLLNGDSPLFYKPTIPNPIEYFGDYRLTKLVELTNNRSRFVIDGQEYGIQIGGLYNIYNALAAVAIARLGADSQLIKQGFDKSAVFGRQETFHIGDKECTLV--LIKNPVGATQAIEMIKLAPYSLSVLLNANYADGIDTSWDADFEQITDMIPEINAGGVRHSEIARRLRVTGYEKITETSNLEQVLKTIENQDC 417
24 -38.200MG8963C YP_324779.1 390457 Purified-2008-03-07  ali follow..  16  40..................................................................................LPGSIARRIEPRLLQLLSQQVQNGVIIIAGTNGKTTTALLLCTILENKGYRVCHGANLENGLMTALLDSTNDYAILEVDENIVPRVLKPLQPRIILCLNLFRDQLDRYGEVDTISKRISTLPRETVVIPNADDPTLSLLGQQLPQKVLFHLGDFTCPSCGFTKSQPTLASREWSQILVGLYNKYNTLAATTAAILGVDETTIRDTINNFAAFGRAEDLVIDGKRVRIL--LSKNPVGTNETIRVVTQSDKTTLLVLNDRTPDGTDVSWDVDTEKLVERGGTLVVSGDRVYDMALRLRYSEKSNLIVEADLRQAIATALEHTP 420
25 -38.100MG8963K NP_269206.1 391477 Purified-2008-04-01  ali follow..  14  26..............................................................................YPGRLALACDKDILKDLSKDY------DIVVVTGTNGKTLTTALTVGILKEAFGEIITGANMITGITSTFLAAKRQIAVLEIDEASLPRITTYLKPSLFVYTNIFRDQMDRYGEYTTYQMIVDGARNKATILANGDSPIFSSKDIVNPVQYYLDYQLTELTAITHQSSEFVIDGQNYKINVGGLYNIYNALAAVSVAEFGVSPEKIKAGFNKSAVFGRQETFTVGDKSCTLILIK--NPVGASQALEMIQLADYPFSLSVLLNANYADGIDTSWIWDANFELITEINAGGVRHSEIARRLRVTGFDKIKQAEKLEQIIETIEKQEA 415
26 -37.500MG8963O YP_193663.1 391728 Selected-2008-01-23  ali follow..  14  26...........................................................................GTSFPGKFAMKIDPNVLNSLAKGY------ETVIVTGTNGKTMTTALIVEALKKKYGDVLTGSNMQQGIVTAFLAHKNKIAVLEVDEANVKMVTKLLHPSVFVLTNIFRDQMDRYGEYTTYEKIVDGIKLDATIIANGDASIFSSVDLPNKKIFYLTFTVNKILEQTPNSVKFQMGNKDYSINIGGTYNIYNALAAYSVARFGLTEAEVAQAFAENRIFGRQELIHYGGKDIDLI--LVKNPVGLDEVLHMLNTEKDSLVALLNANHADGIDTS-ADFEGLDRSKIKKVLVGGQRWHDMGFRLEIAGFGKMSTNPDDDSLIEEIKKLPT 421
27 -36.900PX8963B NP_599499.1 395723 Crystal|NMR-2009-06-04  ali follow..  13  38.............................................................................MIGGLVASKVDPDIMSNLIN------NRPTVLVTGTNGKSTTTRMLAAAMRSTYTTNEGGDNMDAGIISALLAGRNSHVVLEVDELHVPAAIERLKPDALVLLNLSRDQLDRVGEINKIERVLRDAVREMTVIANCDDVLVTSVAFDAENVIWVGAGTGWQGESATCTIHSPSGDLTLDLNLPGQANRGNAAQAIAASTFNVPVSSALPAVNSVNVAGRYSTITVGEHKVHLL--LAKNPAGWQEALSMVDRTADGLVIVVNGQVADGEDLSWDVRFEDFEN--LSVKASGERGTDLAVRLTYAEI-DHELISNPVDAIA....... 394
28 -36.700MG8963B NP_816226.1 390816 Purified-2008-03-28  ali follow..  14  29..............................................................................YPGKLALKIDPKILDTLAKDY------EIVVVTGTNGKTLTTALTVNILRQEFDEVLTGANMEQGIVSTFLNAKAKFAVLEIDEASLSRVTKYIQPKLFVFTNIFRDQMDRYGEYTTYRLIMEGAAAEATILCNGDSPIFNSKETVNPRKYYLDVQLTEMVRMDNTSADFVIDGEEYGIAVGGMYNVYNALAATAVAEYQVAPDKIRAGLAYDKVFGRQETIKVGDKECTLV--LVKNPVGLNQVIDMMGLASFSLVSLLNANYADGIDVS-GNHEAFADMDIPKVIAGGDRHEDMALRLKVAGIPKLLEIADLEQVISEIKTLPT 418
29 -36.700MG8963Q NP_267262.1 391741 Purified-2008-04-01  ali follow..  15  29..............................................................................LPGKIALKFDPEILKSLTK------NYEIIVVTGTNGKTLTTALTVGILEKAFGPVVTGANMITGIVSTFLKAPKKFAVLEIDEASLPKITEYIKPSLFVFTNIFRDQMDRYGEYTTYDFIVKGAANKGTVLLNGDSPLFNSKKLVNPVKYYLDYQLTELSEITNTSSKFVIDGTDYKINVGGLYNIYNALAAVSVAEFNVPKETIAAGFELSAVFGRQETLEIDGKKVTIV--LIKNPVGANQALEMMKLANYPFVSLLNANYADGIDTS-ANFELINDMEIDQIITGGVRSSEMARRMRVTGFENISERKELSEVLEAIKESPK 419
30 -36.600MG8963H NP_687898.1 391271 Selected-2008-01-23  ali follow..  14  24..........................................................................RGSTYPGSLALKFDKDILDTIAKDY------EIVVVTGTNGKTLTTALTVGILKEAFGQVVTGANMITGIVSTFLTAKKKIAVLEIDEASLPRITQYIKPSLFVFTNIFRDQMDRYGEYTTYQMILDGAANQATILANGDSPLFNSKSVTNPVQFYLDYALTRLTHLTNTSSGFVIDGQQYNINVGGLYNIYNALAAVSVAEFGVEPSQIKDGFDKSAVFGRQETFTIGNKKCTLV--LIKNPVGASQALDMIKLAPYPFSVLLNANYADGIDTS-ANFETILTMNIPEIFAGGVRHSEIARRLRVTGYKRIKQADKLQDIMTMIEQQET 417
31 -36.500MG8963M YP_056346.1 391546 Selected-2008-01-23  ali follow..  11  50..............................................................................IRGRVTMKLAPRALPELLA------GRRIASVTGTNGKTTTTHFLTAAVRAGTPTNADGANLYHGIVSALGQAPNTIAVLETDERVVADVVAMGSPEVLVLLNFSRDQLDRNHELTFLGRDWRAAEHGPTVVANACDPLIVWVCQKARHVIWVDTKPRWTADATLCAVEASGRRFHLDVQVPGSFNLTNATCALAAAIMGIQPEDALRGIATVSPAGRYATCTISGTRCRLLLSK--NPAGWTESLPLTTS--NPLVLAIDAVAADGKDVSWLWDVDYEQLAGRTVICAGPRALDLAVRLQYAEV-EHIVIEDLSQALSPPLLAGK 413
32 -35.900MG8963G YP_804815.1 391178 Purified-2008-05-17  ali follow..  16  29..............................................................................LPGKITTKIDPTILKDLGKDY------DVIVITGTNGKTLTTALTVKVLRQKFDHVLTGSNMEQGIVTTFLTDHKNIAILEVDEANVIKVTQYIKPLAFVFTNIFRDQMDRYGEYTTYRKILDGVKLEATIIANGDMPIFNSVDLPNPVVYYLTYQLTQITKLTPNLSKFFIDASNFTLHIGGLYNVYNALAAYSVGKMGVPTSSIQKALNDPDVFGRQEQINVDGKEITIV--LVKNPVGLNQVIDMVGTESEPFVGLLNANYADGIDTS-GNFEKLTQMPIQQYMTGGERYKDITFRLKVAGINQLWTYDNLKDAVSNIKNLPT 419
33 -35.700MG8963D LCAS_20SEP02_SCAFFOLD162_REVISED_GENE1365 390890 Purified-2008-03-28  ali follow..  15  31..............................................................................LPGQIANRIDPQVLRTLGQNY------DVIVVTGTNGKTLTTSLIVKVLKKKYKEVLTNPTGSNMLQGITRGHGRGIAVLEVDEANVAPVAAQLKPKAFVLTNIFRDQMDRYGEFYTTYQKILDGVTEAMVIANGDAPIFSSRKLPNPVTYYLTHQITEVTQMTPQSSDFMIDDQPCHIDIGGMYNIYNALAAFAVGRFGVTPTEISQAFAYDKVFGRQEVIQLGKKKLTLI--LVKNPVGLNQVLSMIETAKQGFAMLLNANYADGIDGNFEELVASQK--AASYLVGGERYKDIGLRLTVAGVKALVSKPALDDVISTLKRSQQ 421
34 -35.000MG8963R YP_535480.1 391750 Selected-2008-01-23  ali follow..  14  29..............................................................................LPGKITLAIDPDVLKSLAKDY------EIVIITGTNGKTLTTALTVKVLGEKYSNILTGSNMKQGIVSAFLTAQKKLAVLETDEANVPIISQYISPSIYVMTNLFRDQMDRYGEYTTYDKILKGINPDALVIANGDAPIFNSRELKNKVIYYLSYRMNRILSQSPQSSTFEIDNTTISLHIGGTYNIYNALAAYAVGNLGVSPQQIAHALSSNEKVFGRQEVIKIGDKELTLV-LIKNPVGLDQVLDMIKTDTEPLAVLLNANYADGIDTS-GSFESLPFDKIPAILTGGERYRDITFRLRVAGVENFSQEEKLPDVLENIKKMPT 419
35 -34.400FK8963B NP_347598.1 370851 Selected-2006-07-12  ali follow..  16  13...........................................................................GTNFPGRVALKIDKNILSTVTK------NYNIVFITGTNGKTTTTNLIYSILKSSGKEVITGANLKPGITSCFIKNFEKYAVIEIDEANLKFLTEYTKPKAIIITNLFRDQLDRYGEVYTTLLKIMEGVNEATLILNGDESLLGNLDVPNKIMYYGFDCPINEENKISINSSISINGTDFYLNQPGVYNIYNALCAYSVAKLGIEDDTIFDSLKNSSSFGRQETIDIAGKNVKIILVK--NPAGYDEAIKTISLDKRELAVLLNDNYADGRDVS-VDFEKLSNLNINKVMVSGIRLYDMAIRLKVAGLDNFELENNFEELLNSMKNCDG 406
36 -33.800GS8963A YP_877656.1 384033 Selected-2007-09-11  ali follow..  17  1.................MNKFNKLVHNSLIGWRCLTINIKATLGIISSKFIMKLSSLLYKG--------------GTNFPGKVALKFDKDILSKISK------NYKVILVTGTNGKTTTTNMIYSVLKNAKFDVITGANMYTGIISCFIKNFKFLNTSKTRYCVLEVITDHIHPEIITITNLFRDQLDRYGEVYSTLDKILEGIKKSTLILNGDESLLGNLDVPNKILYYGFNTPITKTDKPPLNSTVEINKENYYINQCGTYNIYNALCAFSIGKLGIENSVIRYTLKNISSFGRQETIKINNKNLKIILVK--NPAGFDEALKSINLDSENKALLLNDNYADGKDVS-VDFEDLNDNNIHNIMVSGIRLYDMSIRLKVAGFDLFCICHNYDALLNSIENCND 439
37 -33.700MG14496A YP_677960.1 390720 Selected-2008-01-23  ali follow..  14  3.NNKVHFIAIGGAVMHLALALHHKGYLVSGSDDEIFEP------SRTRLAAYNLLPAEMGWFPEKITTDLDAVILGMHARNDIKIYSFPEYIYEQSKDKQR------IVIAGSHGKTTITAMIMHVLKTHKFDYLVGAKLDGFETMVQITDDAPIIIIEGDEYLTSPLDL-YHHHIGLISGVAWDHINVYPTFEEYVKQFDSTPKGGILIYSESDDLATLVADKPRPDVQAIGYSAPKHEIVNGITYLLTDKGKIELEVFGKHNLKNINAAKNVCLIGITEAMFYDAIKTFGAANRLEILGRGKHNVVFKD-FAHAPSKLKATSKAVKKQFSDRKLIA-HTFSSLNKEFLSQYKDTYKAPDEPIVYFEITEADIIEAFDNPKLNVFTDSKKLEEFLF....... 424
38 -33.000MG14496B YP_001303855.1 391768 Selected-2008-01-23  ali follow..  12  1.MRKVHLISVTEPLVLLALALREKGYEVSASGCGLTEEMIGRLHNAGCTC------YGDGWFPEKLIKDIHSVVLGAKVKQDMLIQSIPEFIFQRTRSKTR------VVVAGSRGKKTIISMMVCALRRQKFDYALTSSLPNRIHLSYEARIALIEGDEHITSALDKRFQLYRPHIAILTNLSWSTETDHATPEAYLSTYVSIEREGKLIYFGGDDTVSQLAGDVRSDITAIPFEEHPVVEKDGQTFLHTRYGDYPVRIPNRYFLINLNAARLACRLGVKDADFYQALSEYS................................................................................................................ 303
39 -32.900MG14569B SSUI_28JUL04_CONTIG215_REVISED_GENE688 391484 Crystal|NMR-2008-10-02  ali follow..  12  1MTKTYHFIGIKGSGMSLALMLHQMGHKVQGSDVEKYYFTQRGLEQAGIQI--------LPFDEKNITADVELIAGNAFRPDNYTYKRYHEFLGEFMKGFT------SLGVAGAHGKTSTTGLLAHVMRNITDTSFLIGDGTG-------RGSANAQYFVFESDEYERHFAPYHPEYSIITNIDFDHPDYFTSLEDVFNAFNDYAKQKALLVFGEDEQLRRITANAPIYYYGFEENNDFVAYD--VRHGEEELGEFQIPTFGKHNVMNATAVIANLYAGFDLQLVAEHLKTFGVKRRFTEKIVNDTVIIDD--FAHHPTEIIATIDAARQKSKELVAIFQPHTFTRTIALLDEFADALNGADAVYLA-SARETDNGQVKVEDLAAKINKKGGLVTVENTSPLLDH 411
40 -32.600MG11396F NMUL_10JAN05_CONTIG15_REVISED_GENE1734 391083 Purified-2008-03-28  ali follow..  15  2...HIHILGICGTFMGIAAIAQEAGHKVTGCDAGVYPP-------MSTQLKSRGIELIEGFSSEQTRLNPDLFVIGNVVSRGLPYISGPQWLSENVLRDKW-----VLAVAGTHGKTTTSSMLAWILEYAGPGFLIGGIPQNFGISARLGNSGVIEADEYDTAFFDKRSKFVHPRTAILNNLEYDHADIFRNLEEIEQQFRVVPGKGLIVSNGQEENLERVLRKGCWTPVERIGVANGWEADVLVSFLGESQGTLLWELLGKHNRMNALAALAAARAGVAVKAGIAALAEFNVKRRMEVKGITRDITVYDD-FAHHPTAIRTTIDGLRSRVKGARIIA-RSNTMKMGVWKESLADSLTGADVVFCYAANLGWDLPQALLPLG-EKAVAFEELDQLIAAITAYAQ 421
41 -32.300MG11396K NP_463277.1 391501 Purified-2008-04-15  ali follow..  13  2...RIHILGICGTFMGLAMLARSLGHEVTGSDANVYPP-------MSTLLEKQGIDLIQGYDASQLDPQPDLVIIGNAMTRGIPFMSGPQWLHDFVLRDRW-----VLAVAGTHGKTTTAGMATWILEACGPGFVIGGVPGNFEVSARLGESPVIEADEYDCAFFDKRSKFVCPRTLILNNLEFDHADIFDDLKAIQKQFRIVPGQGRIIWPENDINLKQTMALGCWSEQELVGEQGHWQAKKLTWLDGEKVGDVKWGLVGEHNMHNGLMAIAAARVGVAPAEAASALGSFNARRRLELRGEANGVTVYDDHHPTAILATLAALRGKVGGTARIIAVLERSNTMKMGLCKDDLAPSLGRADEVFLLQPPHIPWQVAEVAEACVQPAHWSGDVDTLAEMVVKTAQ 425
42 -32.200MG11396D YP_207939.1 391070 Purified-2008-09-02  ali follow..  13  1.MKHIHIIGIGGTFMGIAAIAKEAGFKVSGCDAKMYPPMSTQLEALGIGVHEGFDAAQLEE------FQADIYVIGNVARRGLPYISGPQWLAENVLHHHW-----VLGVAGTHGKTTTASMLAWVLEYAGPGFLIGGVPENFGVSARLPQTPVIEADEYDTAFFDKRSKFVRPRTAVLNNLEFDHADIFADLGAIQTQFRTVPSEGLIVCNGQQQSLQDTLDKGCWTPVEKFGTGHGWQGSFDVLLDGKKAGHVAWDLMGGHNRMNALAVIAAARAGVDVQTACEALGAFNVKRRMEIKGTANGITVYDD-FAHHPTAIETTIQGLRQRGARILAVLEPRSNTMKLGTMKSALPASLKEADQVFCYAGGADWDVAEALAPLGCRLRVGKDFDTFVAEIVKNAR 433
43 -32.100FL11396A NP_842219.1 375439 Purified-2007-04-13  ali follow..  12  2...HIHILGICGTFMGLAVLARAAGHTVTGCDANVYPP-------MSTQLRDQQIELIEGYDADQIKLKPDLFVIGNVVSRGLPYLSGPQWLAQHLLHNRW-----VLAVAGTHGKTTTSSMLAWILEYAGPGFLIGGVPENFGLSARLGIIEVIEADEYDTAFFDKRSKFVQPRTVVLNNLEYDHADIFPDLAAIERQFRIVPRNGLLVVNGQDTALQRVLNQGCWTPVEQFDVDDG-NESLSVRFQGVSQGILHWELLGEHNCMNALAALAAARAGVPAQLGIEALSRFNVKRRMELRGVINDIHVYDD-FAHHPTAIRTTLAGLRAKQARIIAVLEPRSNTMKLGVWQNDLAASLDQADQIFCYAHQIGWNIDSALASLDDKTEIHHDLTTMISAIAATAH 428
44 -32.100PX11396A YP_104043.1 395643 Selected-2008-07-14  ali follow..  12  2...HIHILGICGTFMGLAVLARAAGHTVTGCDAGVYPP-------MSTQLEAQGIQLIEGYGAEQIDLKPDLFVIGNVVSRGLPYVSGPQWLGEHVLAGKW-----VLAVAGTHGKTTTSSMLAWVLEDAGPGFLIGGVPLNFGVSAQLTDSSVIEADEYDTAFFDKRSKFVRPRTAILNNLEFDHADIFPDLAAIETQFRTVPGVGRLVTNGRDDALERVLSRGCWSDVERFGVDGGWQGRFAVYWRSERVGAVDWQVQGEHNRMNALAAIAAARVGVPPAQAAAALAAFNVKRRMEVRGSVDGVTVYDDHHPTAIETTIAGLRTRIGRENTRILAV-RSNTMKLGVMKAQLPASLADADLVFGYGRDALGWSLPDALAPLGGKARAFDDLHALVKAVTASAR 433
45 -31.900MG11396L YP_001338245.1 391694 Selected-2008-01-23  ali follow..  13  3...............GLAMLARSLGHEVTGSDANVYPP-------MSTLLENQGIDLIQDYDPSQLEPRPDLVIIGNAMTRGIPYMSGPQWLHDFVLRDRW-----VLAVAGTHGKTTTAGMATWILEACGPGFVIGGVPGNFDVSARLGDSPVIEADEYDCAFFDKRSKFVCPRTLILNNLEFDHADIFDDLKAIQKQFRIVPGKGKIILPENDINLKQVMAMGCWSEQELVGEQGHWQAKKLNLLDGEKVGEVKWALVGEHNMHNGLMAIAAARVGVLPADAANALGSFNARRRLELRGEANGVTVYDDHHPTAILATLQALRGKVGGTARILAVLEPRSNTMKMGVCDDLAPSLGRADEVFLLQPQHIPWQVAEVAEACVQPAHWSADVDTLAEMVVKTAH 413
46 -31.600MG11396E NP_284099.1 391073 Purified-2008-08-13  ali follow..  14  1.MKHIHIIGIGGTFMGIAAIAKEAGFEVSGCDAKMYPPMSTQLEALGIGVYEGFDTAQLDE------FKADVYVIGNVAKRGLPYISGPQWLAENVLHHHW-----VLGVAGTHGKTTTASMLAWVLEYAGPGFLIGGVPENFSVSARLPQTPVIEADEYDTAFFDKRSKFVRPRTAVLNNLEFDHADIFADLGAIQTQFRTVPSEGLIVCNGRQQSLQDTLDKGCWTPVEKFGTEHGWQGSFDVLLDGKKAGHVAWSLMGGHNRMNALAVIAAARAGVDIQTACEALSTFNVKRRMEIKGTANGITVYDD-FAHHPTAIETTIQGLRQRGARILAVLEPRSNTMKLGTMKAALPASLKEADQVFCYAGGADWDVAEALAPLGGRLHVGKDFDAFVAEIVKNAE 433
47 -31.600MG14569A YP_806926.1 390889 Crystal|NMR-2008-08-09  ali follow..  16  3.EATYYFIGIKGSGMSLALVLHDLGHQVLGSDITQYTFTQKGLAAAGIKMLPF---------DPANLKPGYTVIAGNSFTDDLTIYRYHEFLGKLIEGYTS------IGVAGAHGKTSTTGLLAHTLSGVAKTYLIGDGTGKGIPDSKFFVFEA---------EYRRHFLAYHPDYMIMTNIDFDHPDYYTGFEDVYDAFETEANQKAIVAWGDDPWLRKLKAKVPVYYYGISDRDDFQARN--AYFHDQLIGHFFVPLFGEHSVLNALAVVAVAHEKLDAKLIARELGNFGVKRRFAEKDLKDMIIVDD--YAHHPNEIKATLDAARQKDKAIIAVFQPHTFSRTQAYEPQYVQVLSQADQTFLT-KIRSEDITAQIKGAAVIHQEDMKPL............ 406
48 -31.500PX11396C NP_742710.1 395848 Selected-2008-07-14  ali follow..  12  2...HIHILGICGTFMGLAVLAKELGHRVTGSDANVYPP-------MSTQLEAQGIELTQGYDPAQLDPAPDLVVIGNAMSRGLPYVSGPQWLADHVLQGRW-----VLAVAGTHGKTTTSSMLAWVLEHAGPGFLIGGVPQNFSASARLGDTPVVEADEYDSAFFDKRSKFVHPRTAILNNLEFDHADIFPDLASIERQFRTIPSEGLVIHPTTEQALERVIGMGCWTPVQTTGEGGQWQARLLSLFEGEVQGVVDWALTGQHNVANALATLAAARVGVVPAMGIDGLSAFSVKRRMEKVAEVQGVTIYDD-FAHHPTAIATTLDGLRKRVGEAPVIA-RSNSMKLGAHRDGLPESVNDADQVIWYAPANLGWDLAATAAQCKVPSVVADSLEAIIERVKGQAR 424
49 -31.400MG11396A YP_560449.1 390644 Selected-2008-01-23  ali follow..  12  2...HIHILGICGTFMGLAVLARGAGHTVTGCDAGVYPPMSTQLEAQGIGLIEGYDADQLNG------LNADLFVIGNVVSRGLPYTSGPQWLGEHVLNGKW-----VLAVAGTHGKTTTSSMLTWLLEDAGPGFLIGGVPLNFGVSARLTDSSVIEADEYDTAFFDKRSKFVRPKTAVLNNLEFDHADIFPDLAAIETQFRTVPGIGRIVTNGREDALERVLTRQGGWETLPAEDGVPVDERFAVYHNSERVGAVEWQVQGEHNRMNALAAIAAARVGVPPAQAARSLASFNVKRRMEVRGSVDGVTVYDDHHPTAIETTLAGLRARVGRDNTRILAV-RSNTMKLGVMKAQLPASLADADLVFGYGRDALGWNLGEALAPLGGKAQAFDNLDALVKAVVHTAR 434
50 -31.400MG11396B NP_438293.1 390855 Crystal|NMR-2008-11-02  ali follow..  14  1.MKHIHILGICGTFMGVAMIAKQMGYHVTGSDTNVYPP-------MSTFLEEQGIEIIPNYDVAQLQPAPDMVIVGNAMKRGLKYTSGPQWLHDHLLRDRW-----VLAVSGTHGKTTTTGMLTWVLEQNGSGFLIGGIAGNFGISARLGDSPIIEADEYDTAFFDKRSKFVNPRTLIVNNISFDHADIFDDLKAIQRQFRTIPASGLVLSSASEQSAKETLALGCWSQQQFLGKDNEWFAERITFHHGEKVAEVKWNVVGQHNMHNALMAIAAAHTGVAIEDACKALGSFNAKRRLEVKGEVNSITVYDDHHPEAILATLTALRDKVGGGVRILAVLERSNTMKMGVHKDDIAPALGRADAVFMLQPEQLSWEVADIANQCVQPAYWNANLDRLVDMIVAKAQ 426
51 -31.200MG11396G YP_263340.1 391146 PDB-2009-05-29  ali follow..  15  2...HIHILGICGTFMGLALLARALGHTVTGSDANIYPP-------MSTQLEQAGVTIEEGYLIAHLQPAPDLVVVGNAMKRGLRYTSGPQFLSEQVLQSRH-----VIAVAGTHGKTTTTTMLAWILHYAGAGFLIGGVPLVNTTDTNLQQV-VIEADEYDSAFFDKRSKFVRPRTAILNNLEFDHADIFADLDAIQTQFRMIPSTGKIIMPAATISLEDTQAENSSDWQAELISADGSQFTVSFNDNKEATALVNWSMSGLHNVNNALVAIAAAYIGVSVKTACAALSAFGIKRRMELIGDVNDILVFDD-FAHHPTAITTTLDGAKKKLADRRLWA-RSNTMKMGIHQDSLAQSATLADHTLWY-VIDNATIANPSIG----SQQVLSSVDDIIKHICTHAK 474
52 -31.000MG11396C YP_546614.1 390946 Purified-2008-04-01  ali follow..  12  2...HIHILGICGTFMGIAVLAKAAGHHVTGCDANVYPP-------MSTQLEAQGIALIEGFGPEQVSLNPDMFVVGNVVARGLPYMSGPQWLAEHLLYAKQGEPEKVLAVAGTHGKTTTTSMLAWILEYGGPGFLIGGVPENFGVSARLPGVPVIEADEYDTAFFDKRSKFVRPRTVILNNLEFDHADIFPDLEAIETQFRTVPSNGLVVANGKEGSLRRVIKRGCWTPVEYFGTDWQATDVD-VRFQGKAYGRVQWQLLGEHNRMNALAALAAARAGVAIDAGIVALSQFSVKRRMEVRGTANGITVYDD-FAHHPTAIATTVAGLRDKKARILAVLEPRSNTMKLGVMKDALPGSLADADLVFCYGEHLGWDAASALQPIQHKAAAFDSMSVLIEAIAAEAQ 435
53 -31.000MG11396I YP_926646.1 391278 Selected-2008-01-23  ali follow..  12  2...HVHILGICGTFMGLALLARAMGHKVTGSDANVYPP-------MSTQLEEQGIELIQGFDPVQLESEPDLVVIGNAMSRGMAYTSGPQFLRDHILPGRW-----VLAVAGTHGKTSTSSMLAWVLEHCGPGFLIGGVPQNFGVSARLGNSPVVEADEYDSAFFDKRSKFVQPKTLVINNLEFDHADIFDSLADIQRQFRTVPGCGKVIWPKGSKAVAEVIEKGLWSEQETFSHQADADWSVRPLAADGHKFELDWQLIGNHNMENAVMAIAAARVGVAPAAAIEALSGFPPKRRLELIGEVGGVSLYDD-FAHHPTAIETTLKGLRAKVGNARIFV-RSNTMKRGVHKDTLALSMALADEAFLYQADNIGWDIRDAMAQAPLPVDVDYDIDSIVAKVTAKVQ 426
54 -30.900MG14570D NP_345979.1 391412 Purified-2008-04-01  ali follow..  13  10ILKKDGLFREIIDQGHYHYNYSKVIFDSISYDSRKVTEDTLFFAKGAAFKKEY--------LLSAITQGLAWYVAEKDYEVGIPVIDIKKAMSLIAMEFYGN-KLKLLAFTGTKGKTTAAYFAYNILSQGHRPAMLSSALTTPESIDLFDMMNQAVQNDRTHLIMEVSSQAYL-DVGVFLNISPDHIGHPSFEDYFYHKRLLMEKSRAVIINSDMDHFSVLKEQVEDQDGSQFDNQIENSKAFSFSATGKLAGDYDIQLIGNFNQENAVAAGLACRLGASLEDIKKGIAATRVPGRMEVLTQKNGAKVFID-YAHNGDSLKKLINVVETHQTGKIALVLGSTGNKGESRRKDFGLLLNQHPEIQVFLYEDPMAIADEISSYINHPVEKIADRQEAIKAAMAITN 444
55 -30.900PX11396F NP_719341.1 395961 Purified-2008-09-26  ali follow..  13  2...HVHILGICGTFMGLALLARAKGHRVTGSDANVYPPMSTQLEEQGIELIQGFDPSQL----GDAGSYPDIVVIGNAMSRGIPYTSGPQFLVDHILPERW-----VLAVSGTHGKTSTSSMLAWILEDCGPGFLIGGVPQNFGVSARLGESAVVEADEYDSAFFDKRSKFYHPRTLVINNLEFDHADIFADLAAIQKQFRTVPGQGKVIWPADSHAVKQTIDSSEVTKGWHAKALSDDCHEFEVFFDGQSQGVLDWALIGQHNIENAVMAIAAARVGVAPSAAIDALARFPPKRRLELLDTVNGVSVYDD-FAHHPTAIATTIKGMRAKVGQTKITI-RSNTMKSGVHKDTLAHSMLQADEAFLYQADTIDWNMKEAMEAAVIPVTVLHQIDDVVAKVAASAK 430
56 -30.900MG11396H YP_297066.1 391226 Crystal|NMR-2008-10-05  ali follow..  14  2...HIHILGICGTFMGLAVLAKQAGHRVTGCDANVYPP-------MSTQLEAQGIELIEGFDPAQLSLEPDLFVIGNVVSRGLPYVSGPQWLGEHVLAGKW-----VLAVAGTHGKTTTTSMLAWILEDAGPGFLVGGVPQNFGISARVTESDVIEADEYDTAFFDKRSKFYRPRTAILNNLEYDHADIFPDLDAIETQFRTVPGQGRLVVNGLEASLARVIERGCWSEVEQFGVGDWRESD--VWFGDAVQGRVSWDLQGTHNRMNALAAIAAARVGVPVAQAIESLGRFNVKRRMEVRGVAAGVTVYDD-FAHHPTAIQTTLDGLRRRVGGARILA-RSNTMKLGVMKAQLPASLEQADLVFGY-DALGWDLAGALAPLG-KKAAAFHDLGALVEAVRAAAQ 429
57 -30.900PX11396D SBAL_17SEP04_CONTIG244_REVISED_GENE3294 395906 Purified-2008-09-26  ali follow..  13  2...HVHILGICGTFMGLALLARAKGHRVTGSDANVYPPMSTQLEDQGIELIQGFDPSQL----GEAGHYPDLVVIGNAMSRGIPYTSGPQFLADHILPERW-----VLAVSGTHGKTSTSSMLAWILDDCGPGFLIGGVPQNFGVSARLGKTAVVEADEYDSAFFDKRSKFYHPRTLVINNLEFDHADIFADLAAIQKQFRTVPGEGKIVWPADSHAVKQTIDMGCWSEQETYHLAESANGWY-VFFDGESQGILEWDLIGQHNIENAMMAIAAARVGVKPSAAIEALAKFPPKRRLELLGTVNGVSVYDD-FAHHPTAIATTLKGMRAKVGQSKITV-RSNTMKSGVHKDTLAFSMMQADEAFLYQADTIDWNMKEAMEAAVIPVTVLHQIDDVVAKVTATAK 430
58 -30.700MG11396J YP_561669.1 391336 Selected-2008-01-23  ali follow..  13  2...HVHILGICGTFMGLALLARAMGHKVTGSDANVYPPMSTQLLEQGIEL---IQGFDPSQLGDSDENAPDLVVIGNAMSRGLKYTSGPQFLAEHILPGRW-----VLAVSGTHGKTSTSSMLAWILEYSGPGFLIGGVPQNFGVSARLGNSNVVEADEYDSAFFDKRSKFVQPRTLVINNLEFDHADIFDDLTAIQRQFRTVPGQGKIIWPANSEAVQQVIEMGCWSEQETYSAGVHDFNTEKTLGWGHSQGVMSWNLIGQHNVENAVMAIAAARVGVVPAQAMAALSEFPPKRRLELLGTIGGVAVFDD-FAHHPTAIDSTLQGLRAKVGNGKITV-RSNTMKQGVHKDTLAHSLVRADQAYLYQADSISWDLKSSMQTASIPVSVKTDIEQIIDALCHDAK 437
59 -30.700PX11396E SFRI_16AUG04_CONTIG83_REVISED_GENE2253 395927 Purified-2008-09-26  ali follow..  12  2...HVHILGICGTFMGLALLARAMGHKVTGSDANVYPPMSTQLEQQGIEL---IQGFDPAQLGKEGDNQPDLVVIGNAMSRGIKYTSGPQFLSEHILQDRW-----VLAVAGTHGKTSTSSMLAWVLEYCGPGFLIGGVPQNFGVSARLGNSVVVEADEYDSAFFDKRSKFVHPRTLVINNLEFDHADIFADLAAIQRQFRTVPGEGKVIWPSDVEAVQQVIDMGCWSEQEIYSKATSLTTG--VLFKGESQGIVNWSLIGQHNIENAIMAIAAARVGVAPSHAIEALAQFPPKRRLELLATVNGVSVYDD-FAHHPTAIATTLQGLRAKNGNIIVVLERSNTMKSGVHKDTLANSMVLADVGYLYQADNIDWDIKASMANAPIPVTVFNNIEDIINAVAATAN 454
60 -30.400PX11396B NP_662364.1 395732 Crystal|NMR-2009-07-23  ali follow..  18  1.MSSIYFIGIGGSAMAVAVALSHMGHAVTGSDTQLYPPMSTYLENHNIRYFNSFSAENLKSATP------DLVVVGNAISRGMELISMPQLVRRELIGRHT-----SIVVAGTHGKTTTTSLVAWLLEAGGPGFLIGGNFGDGCRPSGLSEPGVTEGDEYDSAFFDKRSKFLRPDIAIINNVEFDHADIFDSLDDIKKSFNLVPSNGLLIVNADDPNSMEVSAKNGNAEWTAADIATDTDGTSFTVVRDSEAIRVKVPLFGNYNVMNALAATAAAIAGVSFESVTRGLCSFRPKRRMELVGEYAGGITLIEDFAHHPTAIRLTLGAIAEHYPGRRIIA-RSNTTSRNIFQHELSECFGDAAIVVLG-RLDAALLCRELKANGKRVFAAENYPEDIVRFIEAEQQ 446
61 -30.200MG14570H YP_534922.1 391745 Selected-2008-01-23  ali follow..  14  1MALEI-ALSLLDEHHLLKEVVNEQKLTFVTYDSRKVSDNTLFFCKGNFKPS----------LTSALEKGATAYVSEQKYAEGIIVTNVQKAMALLGAAFYGF-ELFIIAYTGTKGKTTSAYFAEHILAKADKKVALFSTIDRVLSLDLFHDMRAAVNNGMTHLVMEVSSQAYK-DVGVFLNISPDHIGHPTFDDYLHCKEQLLVNSKRCVINGETAYLRDVYYTAKADFEDLHKSVIEVKGLSDKAQTLHVDGKYELSVPGDYNEGNATSAIIATLAGAKGEDARKTLDRVHIPGRMEIIKTKNNGTIYVD-YAHNYASLKALFAFLKQQAGRVIAVLGSPGDKGIS-RRPGFGKAVSEEVDHVILTTDIAQEIDSYINHDN-VKVEFELDREIAIEKAIKMST 471
62 -30.100TM0231 TM0231 282110 PDB-2002-08-29  ali follow..  16  2...KIHFVGIGGIGMSVALHEFSNGNDVYGSNIEETERTAY----------RKLGIPIFVPHSADNWYDPDLVIKTPAVRDDVPIENRLHYFRDTLKREKKEE----FAVTGTDGKTTTTAMVAHVLKHLRPTVFLGGIMDSLEHGNYEKGNGPVVY---ELDESEEFFSEFSPNYLIITNARGDHLENYGNTRYRSAFEKISRNTDLVVTFAEDELTSHLGDVTFGVKKGTYTLEMRSASRA-VEKNGKRYLELKLKVPGFHNVLNALAVIALFDLGYDLAPVLEALEEFGVHRRFSIAFHDTNIYVIDD-YAHTPDEIRNLLQTAKEVNEKIVVIFQPHRYSRLEREDGNFAKALQLADEVVVT-GISGKMIWDSLKSLG-KEAYFVEKLPELEKVISVS.. 418
63 -30.000NS11465A DHAF_12NOV03_CONTIG1025_REVISED_GENE480 380643 Purified-2007-08-29  ali follow..  14  32..........................................................................................................RVNINGTRGKSTATRLITGILKEAGEKVKTTGTSARII-IEQKTVVRKAARLGASAFVTECMEKLVKANVGVIVNVREDHMDLCGLDFIAESFTATIPRNGTLVVADSRYNDY-------------RREAGKRNSRVLITDEKEIPDGYLEKFGYIVFPENIALALAVARLNIDKDIALRGMLNAPDPGALMILDKQEGSYFVNGFAANDPNSTRLIWDHITAMTANPMVIVNCRPDRVDRT--LQFAGEVLPDIEILVAMGETVGPISEGVHTGKIEPRQYINAEGLSPHEVYHMIK 357
64 -29.100MG14570G NP_267963.1 391736 Selected-2008-01-23  ali follow..  15  1MIRLEQVIEILKKDNNFREISSAGEYYFLSYDSRKSTENTLFFA------KGLNFKKEYLTDLEAAF-----YVSEFDYEVALPAIDVKRAMALIAASFYDF-KLKTLALTGTKGKTTSAYFAKAILDKNGGKTALLSTAQTTLSLDLLEMMAKALTNGMTHLVMEVSSQAYK-DVGVFLNISPDHIGPVTLEDYFYCKRQLLKNSRYFVANSEMNHFAIIKEELKERKIADSENKIIESKGLHFVTDGSVSGAFDIRLLGRFNQENALATALATALGASLENIHDGLALAVVPGRMELLTAKNGAHIYID-YAHNGLSLENLVEVVEEHHAGQLVLVLGSTGNKGESRRKDFGQVIEKHPRLDVILREDPKIIADEIASFVSRTLDFELDRELAIKKAVSKTK 446
65 -29.100TM0237 TM0237 282116 Crystal|NMR-2003-01-20  ali follow..  16  28............................VSNHSSKVKKGDLFICRRGEKFDSHEII------PEVMEKGAVAVVVEREIDLDFPYIDSRYFEAKVASLFFED-DVLTFGVTGTNGKTTTTMMIYHMLTSLGERGSVLTTAVKRIAITILSAMKENREGGGKFFALEVSVEGVRFDVGIFTNISRDHLDFHGTENYLKAKLHLFDLDDGVAVLNESLADAFNRKSSKNADYRLGNIEVSWEGTQFVLETPDGLLKVFTRAIGDFNAYNAAAAIAALQLGYDPKDLASSLETFGVEGRFEVVRGAKKNVVVD--FAHSPDALEKLLKNVRKISQGRVIVVFGAGGNSDRGKRPMMSEVASKLADVVILTTDIMEDLIKGIDKR--KPYLVLFDRREAIETALTIAN 443
66 -28.700FL11465A NP_765648.1 375545 Purified-2007-05-09  ali follow..  14  32..........................................................................................................RININGIRGKSTITRMAYSVLREDKYRVKTTGTDARML-GEQRDIIRKVVKQKANALVNECMNDLVKANIGVIVNVMEDHMDVLGLKDVAQAFTATIPYNGKLVVMKDNYTSF-------------AKEAKKRNSELIVVDKDVIPESYLRKFDYLVFPDNVAIVLGIAQVGVDEETALQGMLNAPDPGAVRIKYNRTKNVFVNAFAANEPQSTKAILNKVESYYDKKIIILNCRSD--RVDRTQLFVDNFLGDYDVLICTGKSTQMVTQFMET........................ 334
67 -28.600MG14570B YP_810479.1 391120 Crystal|NMR-2008-08-26  ali follow..  17  1MREDFTNE-------IVTESLNEAGILVLQFDSRKVTKKNTLFVVKGAF-KIEYLTASLLDKISGIVTSRKEKINIPNLPH-WIVSNSQIALAVLSAEFFGH-KLKILGITGTKGKTSSTYMAYSLLDRTNHQTAMFSTIDTFLSYELFSNMKKALDNGNKYLVMEVSSQSYL-KVGAFLNISPDHIGINEHPTYLAHKKMLAENSDVFVSNIDDAHGQEFIDHAKSFGAKTVIKKADLDESIFYLTEKGNSQEFLLDIPGVFNIYNASVAIAMVEMGFKPEKAKKALAELQIPGRMVKIKTKSHGLIIVD-YAHNGQAVTTLLTFLKSQGGKIIIVLGSPGDKGED-RRSQFGEVISKFVDVAYLTTDINNQIRKAISNPN-VELHEELDRSKAIQEAIKKAN 457
68 -27.900MG14570A YP_805528.1 390894 Purified-2008-04-23  ali follow..  13  34............................IAYDSRKVSGPTLFFC-KGDKFRPIYLSMAKDNGARTYVAEKPYVEGN----NALIVRNITKAMAILSAAFFDY-DLFVIAYTGTKGKTTASYFTEAILNEAPRHIALFSTIDTVVSLDLFRDMREAVENGMTHLVMEVSSQAYL-DVGFFLNITPDHIGHPTFANYLHNKLQLLVNARKVVINAETEHFDQVYAAATTTEADVAESRFTLVPVTEKAAALNIGGHYSLALIGDFNESNATAAIIGALAGVDASAAVPGIAKVKIPGRMEHTKVAGHGAVYVD-YAHNYASMKALLSFLKHADPRLLVVVGSPGD--GVSRRPGFAKVLTEFATEAFLTTDIIEEIDSKIDHSK-VKVHKVLDRKKAIAEAISDSG 475
69 -27.700MG14570C YP_804164.1 391181 Purified-2008-03-28  ali follow..  13  1MDLEIATVKAILTEHDLLKEIKTVANTGISYDSRTVKPGYMFFCKGNFKPE----------LSVARQNGATTYVSENEYPEGIIVTNVTRAMAVLSATYYNF-DLFIIGITGTKGKTSSAYFAHSILNQYPNQVALFSTIDRIVSMNLFHDMRVAVDNGMKYLVMEVSSQAYL-DCGIFLNITPDHIGHKDFEDYLHCKLQLMVNSKADTDRFDDVFGAAKATTDPEQIYLFSSNRFTLVESSSKAEAFHVAGDYDLNVAGDYNQSNATAAIIAALADVTYQDAVLPLKSIVIPGRMEHLNVPGHGVVFVD-YAHNYASLHALLKFLKHQDGKVIVVVGSPGD--GISRRAGFGQALSEQADIAYLTTDIIQQIMDNIKPGT-VEVRQVLDRHDAIEQAIMNSS 467
70 -27.600MG14570F YP_194651.1 391726 Purified-2008-04-15  ali follow..  11  34............................VSYDSRDIQTNTLFFCKGAGFRPTY--------LSMAKSNGANCYVAEQPYPEGLIVRDVSKAMALLSAAFFRF-DLYVVAFTGTKGKTTSAYFLKGMLDQAGGRTALISSVNDVVSLDLFRDMRTAVDNGMTHLVMEVSSQAYK-DLGFFLNISPDHIGHPNFADYLHCKLQLMVNINAETANFNEVYAAATTTTNPDSIYLFAREDFKLFCATDKAKKLPINGDYTLKMLGDFNESNGTAAIIGALAGLNHDQCAKGIRNVTIPGRMQTERTKEHGMVVVD-YAHNKASMMALMRFMQNEDPKIIVVVGAPGDKGVS-RRPGFSESLSAYADKAFLTTDIAEEIDAGIDHSK-CDVTIELDRKKAIHDAIASAG 475
71 -25.700MG14570E YP_909948.1 391635 Purified-2008-03-07  ali follow..  11  1MALTL-AARLLDRHGLLREIIRGDVWTLITYDTRKVEPGTFLCCKGRFKAE----------LQGIDERGLAAYVSENDFSDALIVDDVRKAMALLSAEFYGR-QLKVVGITGTKGKTTTAYLTQAMLNGSGGKCALFSSVDNCLSMDAFRMMREAVDNGMEYLVMEVSSQAYK-DVAAFLNISPDHISHPTFEDYLHCKRQIVKNCRALVLGADCVPVTTFALGGDSMADVMAAPANDDHSRFSIVIDGTSIGELSLTLDGDFNYANAAAAVAIARAGFDFGSAQAEMEPVRIAGRMEHFKDTRSNTIAIVDYAHNYASVTALLDYVDQRKPEITLITGSAGNKAYD-RRAEIVHAAQDRIDHLVLTFEVCADMNDSVTNPQ-LDVKTILDRAEAVETTVSRDR 474
72 -24.700NS11465B NP_391471.1 380656 Purified-2007-08-29  ali follow..  15  32..........................................................................................................RVNINGIRGKSTVTRLTTGILIEAGYKTKTTGTDARPNIGEQKEVMRETVERGANAIVSECMEELLQANIGVIVNVLEDHMDVMGLDEIAEAFTATIPYNGHLVITDSEYTEF-------------KQKAKERNTKVIIADNSKITDEYLRKFEYMVFPDNASLALGVAQLGIDEETAFKGMLNAPDPGAMRILPPSEPGHFVNGFAANDASSTLNIWKRVKEITDDPIIIMNCRADRVDRTQQFANDVLPYIEASELILIGETTEPIVKAYEEGKIPADKLHDLEYKSTDEIMELLK 358
73 -22.500FM12169A YP_001636442.1 377550 Purified-2007-07-05  ali follow..  14  164.........................................................................................RAAPDLQPPWSRLGRILIIAVTGERYRQQAIAEQAARHQG---IILDQANRASVITALADPACTALIVGFDTDSLIREGLPFDRCDLAIITDRAGSRPPTAADDDLRALGLPMLCSVAPTLINLTDPALHPLLSYAPNGVI.............................................................................................................................................................................. 303
74 -20.500TM0166 TM0166 282046 PDB-2003-10-10  ali follow..  12  39.......................................................................................................EYKTIHIGGTNGKGSVANMVSNILVSQGYRVGSYYS-EEIFSPSFFEVVTAMAFLYFAEKNVDIATNVVFPLCSTIVTVDRDHEKTLGIEQIAWEKSGIIKERVPLVTGERKREALKVMEDVARKKSSRMVKSLKLHENRFDYCGENTFEDLVLTMNGPHQIENAGVALKTLEA-LSEKAIREGLKNAKNLGRFEILEKNGKMYILDGAH--NPHGAESLVRSLKLYGEPLSLVIG----ILDDKNREDILRKYTGIFERVIVTMKDMNSLVDMAKKFF-KNVEVIEDPLEAIESTERAT. 403
75 -19.900MJ11465A NP_603834.1 402904 Selected-2009-06-20  ali follow..  14  32.........................................................................................................YIIHINGIRGKSTVSRLIDAGLRAGGYKVFTKTTGTSPGKANIREQISVITWEKAEVLILECMNKILKSDIVAITNVREDHLDEMGLDKIADSLSNTIPKKATFFTADKNYFNF-------------FKNRCEDKNTRAFL-----SKNIKNEYWEIDFPNNIALAMDICKLNVDEKIALEGMRTYH-PGSLKVLTKNFRIFFVNTLAANDPDSTEIILDRVCIKNNERYLLVNNRAD--RLSRLKQFVNFTIKRFDKILISGENKNLFYKYLLKNRIDKNRIIILSDEKYFENIED.. 351

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.