current user: public




380475
Query: NS0103K NP_744603.1 380475 Selected-2007-07-05, from JCSG1009

Results of FFAS03 search in JCSG1009
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520
# Score Template Links and tools%idFirst MLPGESAMPALANEVVLAASGLGKTYAQPVLGEVSLSLRAGEVLALTGENGAGKSTLSKLISGLEVPTTGHMTYRGQAYAPGSRGEAERLGVRMVMQELNLLPTLTVAENLFLDNLPSRFGWISHKRLRQLATAAMARVGLDAIDPDTPVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVALLFTQIERLRARGVAIVYISHRLEELQRVAQRIVVLRDGKLVCDEPIQRYSSAELVNLMVGRELGEHIDLGRRQLGAPLLKVDKLCRGDKVREVSFEVRAGEIFGISGLIGAGRTELLRLIYGADRADSGGIALGQPPQAVSIDSPKAAVRAGIALITEDRKGEGLLLTQSISANIALGNLGAVSRAGVLDSEAEKALAERQIQAMRIRSAGAQQVVGELSGGNQQKVVIGRWLERDCQVLLFDEPTRGIDVGAKFDIYGLLAELARQGKALVVVSSDLRELMLICDRIAVLSAGRLIDTFARDHWSQDQLLAAAFAGYQKRDALLHDAAPRMDALast
1 -133.000NS0103K NP_744603.1 380475 Selected-2007-07-05  ali  100  1MLPGESAMPALANEVVLAASGLGKTYAQPVLGEVSLSLRAGEVLALTGENGAGKSTLSKLISGLEVPTTGHMTYRGQAYAPGSRGEAERLGVRMVMQELNLLPTLTVAENLFLDNLPSRFGWISHKRLRQLATAAMARVGLDAIDPDTPVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVALLFTQIERLRARGVAIVYISHRLEELQRVAQRIVVLRDGKLVCDEPIQRYSSAELVNLMVGRELGEHIDLGRRQLGAPLLKVDKLCRGDKVREVSFEVRAGEIFGISGLIGAGRTELLRLIYGADRADSGGIALGQPPQAVSIDSPKAAVRAGIALITEDRKGEGLLLTQSISANIALGNLGAVSRAGVLDSEAEKALAERQIQAMRIRSAGAQQVVGELSGGNQQKVVIGRWLERDCQVLLFDEPTRGIDVGAKFDIYGLLAELARQGKALVVVSSDLRELMLICDRIAVLSAGRLIDTFARDHWSQDQLLAAAFAGYQKRDALLHDAAPRMDA 524
2 -129.000MJ0103G NP_792184.1 403259 Selected-2009-06-20  ali follow..  76  1.......MSASAQTAVLSVSGIGKTYAQPVLGDVDLTLMRGEVLALTGENGAGKSTLSKIIGGLVTPTTGRMEFQGQPYEPASRTQAEKLGIRMVMQELNLLPTLTVAENLFLDDLPRRAGWIDRKRLRENAIKAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLVGDCHVLILDEPTAMLTSREVEMLFEQITRLQARGVSIIYISHRLEELARVSQRIAVLRDGKLVCVEPIARYNSEQLVTLMVGRELGEHMDMGARQIGEVALSVKGLSRTGKVQDVSFDVRRGEIFGISGLIGAGRTELLRLIYGADIADSGAIEVGQPLQAVTIRSPADAVAHGIALITEDRKSEGLLMSQSISANIALGNMHSISRAGMVNADEELKLAQRQVAAMRIRSSSPTQLVSELSGGNQQKVVIGRWLERDCPVMLFDEPTRGIDVGAKFDIYTLLAELTRQGRALVVVSSDLRELMLICDRIGVLSAGRLIDTFERDSWTQDQLLAAAFAGYQKRNALLNDAAPRNDS 517
3 -129.000NS0103N YP_442995.1 380478 Selected-2007-07-05  ali follow..  68  1..........MPAAPTLVVTGIGKTYAEPVLADVSLTLYPGEALALTGENGAGKSTLSKIVAGLVAPTTGAMRLAGAEYAPQSRAHAEALGVRMVMQELNLVPTLTVAENLFLDRLPHRFGVIDRRRLAADARTAMARVGLDSLDPDTPVGALGIGHQQMVEIARSLAGDCRVLILDEPTAMLTAREVELLFDQIARLKADGVALVYISHRLEELARVAQRVAVLRDGRLVHVDRIDAQPIDRLVALMAGREIAEQAVHGTRTPGAPRLKVERLSRGGAVRDVSFDVRSGEIFGVSGLIGAGRTELLRLVYGADMADGGTVSVGDPPRPAAIRSPADAVRHGIALVSEDRKGEGLLLSQSIAANLSLGQLARVARGGVVDGERENALAARQIDALRIRARGPAQPVSELSGGNQQKVAIGRWLGRDMGVLLFDEPTRGIDVGAKFDIYALLDALAREGRAIVVVSSDLRELMLICDRIGVMSAGRMHAVFERGAWTQDALLAAAFAGYARRDAALHPPGGARTA 514
4 -127.000NT0103C YP_559020.1 378499 Selected-2007-06-04  ali follow..  73  2.....DSTDHDAVPAVLSVSGIGKTYAEPVLADISLSLRAGEVLALTGENGAGKSTLSKIMGGLVEPTTGTMRLVGEPYAPASRTEAEALGVRMVMQELNLLPTLSVAENLFLNRLPRSFGWIDRRRLREDAREAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCRVLILDEPTAMLTAREVDLLFDQIDRLKARGVALVYISHRLEELARVAERIAVLRDGRLVHVDAMANLTSDEIVTWMVGRELGERIDLGVRDIGAPLLKVERLTRGKVVRDVSFEVRAGEIFGISGLIGAGRTELMRLIYGADQKDSGSVALAGTPTPVQIASPADAVRAGIALITEDRKGEGLLLPQPIAANVSLGNIGSVARHGIVDAKRENALAQTQIAAMRIRTSGPAQIVGELSGGNQQKVVIGRWLARDCRVLLFDEPTRGIDVGAKFDIYGLMGALAREGRALVVVSSDLRELMLICDRIGVMSAGSMTGVFERDNWSQDALLAAAFAGYRSRDALLHAAPDISEA 528
5 -126.000NT0103Z NP_250637.1 378559 Selected-2007-06-04  ali follow..  74  2.........SSDALPLLSIRGVGKTYAQPVLAEIDLQLFGGEVLALTGENGAGKSTLSKIVGGLERPGAGSLELLGRPYAPASRREAEALGVRMVMQELNLLPTLSVAENLFLHDLPRRAGWIDRRRLRAAAREAMAQVGLEAIDPDTLVGDLGIGHQQMVEIARNLIGDCRLLILDEPTAMLTAREVDMLFEQVERLRERGVAIVYISHRLEELARISQRIAVLRDGRLVCVEPIERYDADQLVTLMVGRDLGERFDLGPRQTGAPLLRVERLSRRGKVHEVSFEVRAGEIFGISGLIGSGRTELLRLIYGADRADGGQVLLGDPPQRLSLRSPADSVRQGVALITEDRKGEGLLLDQSISANLALGNLPALARHGVIDRRREEALARRQVEALRVRCADTAQAVGELSGGNQQKVVIGRWLERDCQVLLFDEPTRGIDVGAKFDIYALLAELTRRGKALVVVSSDLRELMLICDRIGVLSAGRMVDTFERDAWTQDALLAAAFAGYKKRDALLATS...... 510
6 -125.000NS0103C YP_554726.1 380462 Purified-2007-10-11  ali follow..  69  2...STPIPSLADAPPVLCVHGIGKTYAEPVLADVSLELRAGEVLALTGENGAGKSTLSKIVGGLVTPTTGSMTLGGAAYAPASRKDAEALGVRMVMQELNLLPTLSVAENLFLNRLPNLVGWIDRARLRENARHAMAQVGLDAIDPDTLVGTLGIGHQQMVEIARNLIGDCRVLILDEPTAMLTAREVDLLFEQVERLKAHGVALVYISHRLEELKRIARRAAVLRDGRLVHVDEMANLSTDRLVTLMVGRDIGDRIDLGERRIGEVAFKVSGMTREPVVRDVSFEVRAGEIFGISGLIGAGRTELMRLIYGADHADAGSVSLGRAPEPVTIASPSDAVQHGIALITEDRKGEGLLLTQPIAANISLGHLRAVSNKGVVDGRREAALARRQIDAMRIRSAGPSQPVSELSGGNQQKVVIGRWLARDCTVLLFDEPTRGIDVGAKFDIYALMGALAREGRALVVVSSDLRELMAICDRIGVMSAGRMTGLFERGNWTQDALLAAAFAGYAKRDDLLHEPIEPDAK 526
7 -124.000MJ0103AI NP_902688.1 402646 Selected-2009-06-20  ali follow..  43  1..............MQVTMRGISKAFPVKVLENVEFTLRGGEIHALMGENGAGKSTLMKILSGVHRADAGEILLDGRKAELRSTEAAEAAGIAIIHQELNLIPQLSVMENLFLGREPSRFGIIDYAAMRREARAQLEALGAGGIDPDAEAGSLSIGQQQMVEIAKALALNARVLIMDEPTAALTEREIDRLFELMAQLRENGAAIVYVSHRMEEIFRVCDRISVLRDGCFVGEREIARTDFDEVVRMMVGREIGDRYPKREAAPGEVRLKVENLADENMIAGIGFEVRAGEVLGIAGLMGSGRSDILKTLFGAKRRTAGRVELDGKE--LKVAAPGDAIAAGLGFVPEDRKSKGLVLGMSLRENATLVHLDQYARLGVVSAAEEKRAVDGLIAQLRIRARDAELDVKSLSGGNQQKVVFAKWLANPPKVLLLDEPTRGVDVGGKAEIYHIVNQLAAAGTAIVMVSSELPEVLALSNRILVLHEGRQAGIFDAAGCSQETLMAAATGGAVHSETRKQA....... 502
8 -124.000MJ0103AG YP_773396.1 402363 Purified-2009-08-05  ali follow..  68  4.....TFQPSRSAIPVLSVSGVGKTYAEPVLADVTLTLAPGEALALTGENGAGKSTLSKIIGGLVDPTTGTMQLGGQAYAPASRTQAEALGVRMVMQELNLLPTLTVAENLFLNRLPRRFGIIDRARLHDDAQAAMARVGLDAIDPDTPVGALGIGHQQMVEIARNLIGDCRVLILDEPTAMLTAREVELLFEQIDRLKAHGVAIVYISHRLDELARVAERVAVLRDGRLVHVGDMAATTSDGLVTLMVGREIGEHIDLGPRRIGAPRLAVSGMTRGTAVQDVSLEVRSGEIFGISGLIGAGRTELLRLIYGADTPDAGMISVGDPLKPARIASPVDAVRHGIALITEDRKGEGLLLSQSVTSNVSLGQLEQLARGGIVNTARETALAEQQIDALRIRTHGAAQPVGELSGGNQQKVVIGRWLARDMGVLLFDEPTRGIDVGAKFEIYTLMGALARDGRALVVVSSDLRELMLICDRIGVMSAGRMTAVFERGNWTQDALLAAAFAGFGRDALPEGARHLDAQA 522
9 -123.000NT0103S NP_744903.1 378551 Selected-2007-06-04  ali follow..  37  2............STPVLELRGIVKTFATRALDGASLRVAAGSVHGLVGENGAGKSTLIKVLAGIHRPDAGSLLLDGQPHGHFSPRQVERLGIGFIHQERLLPARFTVGEALFFGHERRFGPLLDRRSQQREAARLLDDYFGLRLPANALIGELSSAEQQMVQIVRALLIKPRVLVFDEPSVALVQREVERLLRIVQRLRDDGLAIVYISHYLQEIEALCDRVTVLRNGRDVAEVSPRNTSLEQITRLMVNREVGELYPKVAVPAGALLLDVRGLGRARAYQGIDLQVRRGEIVGLTGLVGSGAKELLRSLFGLAPPDSGEVRLDGQP--LSLRSPREAVAQGVALMPEERRRQGVALDLSVQENTTLAALSRFVRLGLLSPARERHTTLELIERLRIKAHGAHAKVRQLSGGNQQKVALAKWFARCSSLYLLDEPSVGIDVGAKVEIYRLIGELVKEGAGVLILSSDLPELIGLCDRIHVMHRGAIAARFAAGEANSDRLLAVATGAQRAQNEERPFYAYAIAI 512
10 -123.000NS0103O NP_243188.1 380479 Purified-2007-08-29  ali follow..  38  1..........MGEHFLLEMVDITKEFGVKALDRVQLKVRKGSVHALMGENGAGKSTLMKILIGMYKPNEGKIIFDGEEVTFNSINDALDKGISMIHQELSPIPEMTVAENIFLGREPTKSGLVDNKKLIEMTRNLLESLEIN-IDPRKKMGELSIANTQMIEIAKAISFHSKLVIMDEPTSAITEKEVAQLFKMIESLKKKGVGIIYITHKMSELDEIADDISVFRDGKYIGTDTAKNLTRDDLIKMMVGRELNQIFDKPEPKLGEVILSVKSLTKQDYFEDVSFEVRKGEIVGFAGLMGSGRTEVLETIFGVKEAESGEIFVNGQK--ARIKSPQDAVKNNMGFLTEDRKLTGLFLPLSVRENMITVNIDKYINMGWLNGKRVKKDCEQQKQKLYIKTPSIEQIVENLSGGNQQKVLLARWLLKNPDILFLDEPTRGIDVGAKSEFYNLIFELASQGKAIVVVSSEMAEILGLCDRILVMHEGKVTGELTREEANQEKIMQYATGQAKMAKKLHVHNNFEQTV 514
11 -123.000NS0103W BFUN_06OCT04_CONTIG481_REVISED_GENE2292 380492 Selected-2007-07-05  ali follow..  38  2.......QQPTSAVPRLELRRASKSFRVRALSDGDLALWPGEVHALLGENGAGKSTLVKILAGVHQPDTGELLVDGVARRFATPAEARDAGLAVIYQEPTLFFDLSIAENIFMGRQPDRIGRIQYDAMRREVDGLLASLGVD-LRADQLVRGLSIADQQVIEIAKALSLNANVLIMDEPTAALSLPEVERLFAIVRKLRERDVAILFITHRLDEVFALTQRVTIMRDGAKVFDGLTADLNTESIVAKMVGRDLETFYPKAERPPGEVRLAVRGLTRIGVFKDISFDVRAGEIVALAGLVGAGRSEVARAIFGIDPLDSGEIWIAGER--LTAGRPAAAVRAGLALVPEDRRQQGLALELSIARNASMTVLGRLVKHGLISTRSETQLARQWGTRLHLKAGDPDAPVGTLSGGNQQKVVLGKWLATGPKVLIIDEPTRGIDVGAKAEVYGALAELVRDGMAVLMISSELPEVLGMADRVLVMHEGRISADIARADADEERIMGAALGQPVGHPVQPIPP...... 511
12 -123.000NS0103J NP_600475.1 380474 Purified-2007-08-29  ali follow..  40  1MVNSEQALHQHDPAPILQLDKVSKSFPVNVINQVSIDVRPGRVLALLGENGAGKSTLIKMMSGVYQPDGGQILVDGKPTTLPDTKTAESFGIATIHQELNLVPTMTVAENVMLGRTPRKWGLVNFKHLRRQAQAALDLIGVD-VDLNAQVGSLGIARQQMVEIAKALSMNARILILDEPTAALTGREIDQLFKVVDQLKEKGVAMVFISHHLDEIARIGDTVSVLRDGQFIAELP-ADTDEDELVRLMVGRSIENQYPRSAPEIGQPLLEVKNLNAEGRFTDISLTVRAGEVVGLAGLVGAGRTEVVRSIAGVDKVDSGEVIVAGKK--LRGGDISEAIKNGIGHIPEDRKAQGLVLGSSVEDNLGLATLASTARAGLVDRSGQHKRAAEVAEKLRIRMASLKQPISDLSGGNQQKAVFGRWVLAGSNVLLLDEPTRGVDVGAKVEIYNIINEMTEKGGAVLMVSSELPEVLGMADRILVMSGGRIAGELPAKGTTQDDVMALAVSQVDDSITEEAAAEIENT. 520
13 -122.000NT0103P NP_106317.1 378544 Selected-2007-06-04  ali follow..  36  8...GTVKEGPQDSTPRLTLSGISKSFGVRALHNVSLSLYPGQVTALIGENGAGKSTLVKIMTGIYQPDAGTISIDGQAVTLPSAHAAFGHGVTAIHQETVLFDDLTVAENIFLGHAPTRLGTIDWRTMRGNAREVLDTMHAGHIDADARLKDLGIANKHLVAVARAMSIDAQIVIMDEPTAALSMKEIEELFLLIEFLKEEGKAILFISHKFDEIYRIADRYTVFRDGEVVGEGLIKDAGQSQIVRMMVGRSVDHIFPQRKAEIGAPVLSVAGLSHPTEFNDIGFELHKGEILGFYGLVGAGRSEVMQAISGITRTSGGTITLEG--KAIAPKSAADSIEAGIVYVPEERGKQGVVIGLPIFQNVSLPSLKRTSKSGLLRLAEEFSLARSYTERLDLRASSLSQDVGTLSGGNQQKIVIAKWLATAPKVIILDEPTKGIDIGSKAAVHGFMAELVAQGLSVIMVSSELPEILGMSDRVVVMREGLVAATYDNKGLDAETLVRTAAGIA................ 512
14 -122.000NS0103P NP_826496.1 380480 Selected-2007-07-05  ali follow..  44  2..........SNADELLRIEGIRKTFGVVALDGVDFDLRRGEVHVLLGENGAGKSTLIKMLSGAYRPDGGRVLVEGEEVRIHGAQDSEALGIATIYQEFNLVPDLTVAENIFLGRQPRRLGLIDRKKMEADAAELLARVGVQ-VSPRARVRELGIARLQMVEIAKALSLNARVLIMDEPTAVLTSEEVEKLFAIVRQLREDGVGIVFITHHLEEIAALGDRVTVIRDGKSVGQVP-ASTSEDELVRLMVGRSIEQQYPRERPDSGAALLSVEGLTRDGVFHDVSFEVRAGEVVGVAGLVGAGRTEVVRAVFGADPYDRGSVQVAG--ARVPRHDVSAAMSAGIGLVPEDRKGQGLVLDASVEENLGLVTMRAATRGGLVDLKGQRDAAARVAGQLGVRMAGLGQHVRTLSGGNQQKVVIGKWLLADTKVLILDEPTRGIDVGAKVEIYQLINELTAAGAAVLMISSDLPEVLGMSDRVLVMAQGRIAGELGADEATQDSVMALAVSTNQY--KPDKSDKPDASA 510
15 -122.000MJ0103AK YP_002546957.1 402232 Purified-2009-08-05  ali follow..  35  2.........TISQQAVLAATAITKTFAHVALHTIDIAFRPGEVHALLGENGAGKSTLIKILTGAYTPDAGTVLVDGAPMSFSTPQQAQAAGIGTVYQEVNLLTNMTVADNLFIGRQPRRFGLVDHRTMEREARRILSGYGLD-IDVRAELATFSVAVQQIIAIARAVELSGKVLILDEPTASLDRSEVLKLFEIVRGLKARGLAIVFITHFLDQVFELCDHATVLRNGKLVGSQPIDTLNRTTLVRMMLGKDLSLHHDAIEAEVGESLMQFTGYGLDGKVQPFTLTIHKGEVIGVAGLLGSGRTEMARLMFGIDSADKGELTLNGAS--FKIRSPRQAIDLGFGFCPEDRKADGIFGDLSVRENIIIAMQAKLGWLRTLSYDEQMEIAGQFIEALDIRTASAELPIKLLSGGNQQKAILARWLATDPRFLILDEPTRGIDVGAHAEIVRMISRLREDGLALIVISSELDEVVSYSSRIVVMRDRAMVAELHGADIAPDVIVQTIAAQSNTPAQSEGAFS..... 512
16 -121.000NT0103AM NP_828592.1 378576 Selected-2007-06-04  ali follow..  40  2.....THPSDTGPAPVLALEDISKSFAVRALRDVSLELFPGEVHALAGENGAGKSTLIKTLAGVHRPDAGQVLLDGRPTVFHGPADARDAGIAVIYQEPTLFPDLSIAENIYMGRRPRRFGRIDHKATRAATAALMRRLGVE-LDPERPARGLSIADQQIVEIAKALSFDARVLIMDEPTAALTGSEVARLFGVVRTLREQGAAVLFISHRLEEIFQICQRVTTLRDGALISSEPLDGMTEDDLVRRMVGRDLDELYPKQEVRAGEVAMSVRRLTREGVFTDVSFDVRRGEIVGLAGLVGAGRTEVARAVFGIDRWDAGEVEVEG--RRLTNGAPSTAMAAGLALVPEDRRAQGLVMNMSIERNIGLTGLRTTVRAGLVDRGAERSRSLDWAAKLQVKYARIADAVSTLSGGNQQKVVLAKWLATGPRVLIVDEPTRGIDVGTKAEVHRLLSALAADGVAVLMISSDLPEILGMADRVLVMHEGRVTAEIPRSEATEESVMAAATGRAAA.............. 505
17 -121.000NS0103BH 17742251 380542 Selected-2007-07-05  ali follow..  39  2..........TATASALRMRGISKIFGVKALSNVNFTVEYGRIHAVVGENGAGKSTLMKILSGSYAPTTGTTEIAGVEVQMRRPADAQKLGIRMVHQELNLVPDLTVAENIYLGRMPHRRFLVDRQAMLRKAAAVLKELEAA-IDPKARLGDLPISQQQLVEIAKSYSADPRIIVLDEPTSSLSEHETTALFSILRKMKSQGIAIIYISHRLKEVLDIADDVTILRDGSMIDTRPAAGITAAEMIRLMVGREVANVFPKTPSKIGPVAFKVTGLSDGEKFHDVGFDVRSGEILGLTGLVGAGRTEVAQAIFGLAPLATGRIEING--KAVTIGSPAAAVKAGVAYVPEDRKGDGIVPSMSVRENISLPVLRRLSRLGRIGMSRDRGLAAKYTRDFSIVPPDPERRINLLSGGNQQKAIISRWLAAGPKVLILDEPTRGVDVGAKAEIHRIIGELVAGGMAVVMISSELPEVMGVCDRVVVMRDGRASSPIARGDLTEERIMALATGEEPA.............. 499
18 -121.000PK0103A YP_001338111.1 389546 Selected-2007-11-16  ali follow..  38  1..........MTATPVLEMRHIAKAFKFYALKGVDLTVWPGEIHALMGENGAGKSTLMKILAGAYTATSGEILIDGKPQTIRGPKDALAAGITLIYQEMQLAPNLTVAENIFLGSELARGGLVQRKAMLSQAQAVIDRLGAQ-FKASDRVMTLTIAEQQQVEIARALHRQSRILVMDEPTAALSSRETQRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQYVGSLVRDKLNAPELVRMMVGRPLSDLFNKERDPRGQPRLRVEDLTDGGKIKPSSLVVHAGEIVGLAGLVGAGRSELAQLIFGVRKATAGVIEIDG--EPVVIHSPREAIDLGIGFLTENRKEQGLFLELAAQENITMATLERDATWGMLNRRKAQTISDDAIQLLNIRVPHAQVRAGGLSGGNQQKLLISRWVAIGPRILILDEPTRGVDVGAKSEIYRIMNDMARQGVAILMISSELPEVVGMSDRVYVMREGVIAGELQAGDISQESIMTLATGVTDSHLKAGQ........ 505
19 -121.000MJ0103AE NP_437029.1 403709 Purified-2009-08-20  ali follow..  43  2.............QDFLEFQSISKGYGVQALSEVSFSVRKGAVHGLMGENGAGKSTLIRVLSGDQAADTGEIRINGEPQHYRSVRDAFNAGVIVIHQELQLVPELTVAENLWLGRFPGKAGVIDRRQLIRVVSDRLAEIGID-VDPEAKVASLSIGERQMVEIAKAVMTDARVIALDEPTSSLSSRESEILFALIDRLRSNGTVILYVSHRLDEIFRLCNSLTVLRDGRLAAHHDISKVGREQIIAEMVGREISNIWGWRARTLGAARLTVERVSGANLPQPISFTVRAGEILGFFGLIGAGRSEMARLVYGADRRRQGKVLVDG--LAVPADSPRLSIRAGVVLCPEDRKFDGIVQGRSIEENMAISSRRHFSPFGVVDKGKEAELAERFIAKLRVRTPSRHQDIVNLSGGNQQKVILGRWLSEEVKVLLIDEPTRGIDVGAKSEIYEILYELAAQGMAIVVISSELPEVMGIADRILVMCEGRIAAEIDRSDFDEHRILAAALPDASATTATLPEQV..... 507
20 -120.000NT0103AL NP_104462.1 378574 Selected-2007-06-04  ali follow..  37  3..........EPGRTILELRGLEKKYGTHALKPVTLAFKSGEIHAIVGENGAGKSTLIKLLTGVMPRTSGDVIWEGKPAALATPHEAMALGINAVHQEVVLCRHLTVAANMFLGEENSRLGILQQRAMVKEAQKIIDDLGFD-LPAHVVLGDLTIGQQQLIAAARATVRGTKFLIFDEPTAYLTRKEADQLFTLIRRLKSEGVTIIYISHRMEEVFELADRVSVLRDGTLVGTRNIAETNDAELVKLMINRSIEQVYHKEHFTPGAAIVETRNLSG-KGFENVSMTVRAGEIVGLYGLIGAGRSEFVTTLYGRHRKSAGQILWEG--KPVQVNSEHDAIKLGMALAPESRRDQGLCLNLPVGLNLNLPIYKRISKNMLISGAQEKTQADRQIADLRIKTPTRHALASSLSGGNQQKIVIGKWLAHGAKLFIFDEPTVGVDVGTKAEIYRLFGALLSKGAGIILISSYLPEVYELADTLHVFRRGKLVATHGFRTADHEEILTQALAEKQEKLGGK......... 504
21 -120.000NT0103A NP_103560.1 378480 Selected-2007-06-04  ali follow..  39  1.......MPAEAAPVLLAVEGVTKHFGVTALSDVLLDIHPGEILGLLGENGAGKSTLLKILSGVMPPSSGRITFDGADYAPSSPQDAKRLGIVTIYQELSLIPTLTVAENIFIGRAPGPLGLVSWKRMERDSRDIIARVGLS-IDPMTPVSALSVAEQQLVEIARALSLKSRLIIMDEPTSALTETEVQRLLSIMGRLRQDKVAIMFVTHRLEEASAICDRMTVLRDGRLAGHLKGRPIQLPRIIEKMVGRAASELYPVQRAVAGNVVLSVRGLRTVIVLDGVDIDLKAGEILGVAGLVGSGRTELARAIFGADRIAAGTITLDGKP--IAPASPADAIALGIGLVPEDRKHQAIFAALGILPNFSVASLGRFNGLGFMAERRERDALSGFRKMLSIRMASAEQAIEGLSGGNQQKVILARWLARDPKVLIVDEPTRGVDVGAKAEVHQILVQLAARGIAVMMVSSELPEVLAVSDRIVTMRRGRITGEMPGVEANEEKLMELMALDKQDALGQDALGQDALGQ 530
22 -120.000MJ0103J NP_792792.1 403339 Purified-2009-08-20  ali follow..  35  3.....SATLQVQSVPALHLSGISKRFATQALDGVNLQVASGTIHGLVGENGAGKSTLIKVLAGIHRADAGSLSINGQRFEGHTPRQVEAAGVHFIHQERLLPGSFTVGEALFFGQEIKRGLFVDRRAQDREAARLLEDYFAMRLPQGALVRDLDSAQRQILQITRALLAKPGVLVFDEPSVSLVKQEVDRLLAIVRRLRDEGLTIVYISHYLQEIESLCDQVTVLRNGRDVAVVDPALTSTAQIARLMVNRDVGEQYFRAQSVPGAPVLQLNALGAGRVYDGIDLSVRRGEVVGLTGLVGSGAKELLKSLFGLLKPERGELLLNG--QPLQLKSPRDAVRNGIALVPEERRTHGVAPVLSVLENITMASLGRFSHWGLLDASAQARESERLITELAIKTPGPDAAVQLLSGGNQQKVALAKWLSRHSSLYLLDEPSVGVDIGAKVEIYRLIARLAEGGAAVVVLSSDLPELIGITHRIVVLHRGRIAGEFASRTTDSDQLLACATGASESDEQVEP........ 512
23 -120.000MJ0103AD NP_437025.1 403708 Purified-2009-08-20  ali follow..  40  1..........MTSETVLEIRNVSKHFAVKALTAVDFRLARGEVHALCGENGAGKSTLMNVIAGVLQPSEGEVLIEGAPVKIASPAVAQSLGIALVHQEIALCPDATIAENMFMAATNRRSALMNYAQLERDAQAVMNRLA--PIDVSQKVGDLPISSQQLVEIAKALTLDCRVLIFDEPTAALTETEAQVLFGIIRDLKARGISIIYISHRMAEVFSLCDRVTVFRDGRYVATEMVSDVTPDDVVRLMVGREISQLYPDKQERLGEPILSVRDLGG-ERFRDVSFELRYGEILGVGGLIGSGRTEIAEGICALRPVTQGEIRLHD--KVLRLRRYSDAAKAGVVYLSEDRKGSGVFLDLSIAQNIAALDLKALTSLGLLNSREERALAEDLTRRLGVRMGGVDMPVSSLSGGNQQKVAIAKQLAVDPKVILMDEPTRGIDVGAKSEIHRLLRELARAGIGILVISSELPELIGLCDRVLVVREGRIAGEVSGNEMTEEVIMRLASGIGPATETNLKASGHAA.. 512
24 -120.000MJ0103X NP_437568.1 403663 Selected-2009-06-20  ali follow..  37  2.........QTSSDNILSATRIEKGFGTKALDRVDFHLRRGEVHALLGENGAGKSTLIKCLTGAYRRDGGSMLLDGAEADPRDTFDAQRLGIGTVYQEVNLLPNLTVAENLFLGRQPRRFGMVDTRTMNRKARELLAEYELD-IDVTRDLASYSVAIQQVVAIARAVDLSGKVLILDEPTASLDAHEVEMLFRIVRRLKERGLGIIFITHFLEQVYAISDRITVLRNGQLVGTRNAADLDRRELIAMMIGRELATEIHHSDAVAGEPRYRFRNFGRRGKIDPFDLDVRAGEVVGMAGLLGSGRTETAEILFGAHRADSGTAEIDG--RSVDLSSPRAAIRQKFGFCPEDRKTAGIVGDLSVRENIVLALQARRGWTRPIPRAEQNRLADHYIRALDIRTADREKPIRLLSGGNQQKAILARWLATEPELLILDEPTRGIDVGAHAEIIRLIESLREKGMSLIVISSEIEELVAYSTRVVVLRDHAHVAELDGAQLTAHRIVEAIAATNGRE............. 503
25 -120.000MJ0103H NP_792447.1 403266 Purified-2009-08-20  ali follow..  39  3.....QAIEQTATGGALRFNGICKVFGVKALSDISFEARPGSVHALMGENGAGKSTLLKILGGSYQPNSGTLQIGEHSYQFKSTAESIAAGVAVIHQELHLVPEMTVAENLLLGHMPNRFGLINRGAMYRRAGELLKGLADE-IDPRTRLGDLSLGQRQLVEIAKAMSRNAHVIAFDEPTSSLSAREIDRLMAIIVRLRDEGRVILYVSHRMEEIFRVCDAVTVFKDGRFVKTFEMADLDHDRLVTCMVGRDIQDIYNYRPRQHQGPSLRVTGLLGLGLQEPVSFAVQKGEVLGFFGLVGAGRTELFRILSGLTRSTAGSLQLDGQP--LTLKSPRDAIAAGVLLCPEDRKKEGIVPLSSVAENINIGARPRVNLGCLIQGGWERDNARAQIKSMNVKTPSPEQQIMFLSGGNQQKAILGRWLSMPMKVLLLDEPTRGIDVGAKSEIYEIIHTLAADGIAVIVVSSDLMEVMGISDRILVMSEGAITGELNRDEADESRLLQLALPRTR............... 506
26 -120.000TM0956 TM0956 282825 Selected-2001-10-12  ali follow..  40  3......LNTEKEREVLLEARNITKTFGVIAVNNVTLQIYKGEVCALVGENGAGKSTLMKILAGVYPDYEGQIFLEGKEVRFRNPREAQENGIALIPQELDLVPNLSSAENIFLSREPNEFGVIEYQKMFEQASKLFSKLGVN-IDPKTKVEDLSTSQQQMVAIAKALSLDAKIIIMDEPTSAIGKRETEQLFNIIRSLKNEGKSVIYISHRLEEIFEIADRVVVMRDGRKVGEGPIEEFDHDKLVRLMVGRSIDQFFIKERATITDEIFRVEGIKLWSLVDDVSFYVRKGEVLGIYGLVGAGRTELLEAIFGAHPGTEGKVFIGG--KEIKIHSPRDAVKNGIGLVPEDRKTAGLILQMSVLHNITLPSVVMVRKFGLIDSQLEKEIVRSFIEKLNIKTPSPYQIVENLSGGNQQKVVLAKWLAIKPKVLLLDEPTRGIDVNAKSEIYKLISEMAVSGMGVVMVSSELPEILAMSDRILVMSEGRKTAEFLREEVTEEDLLKAAIPRSVKVETTQREE...... 523
27 -120.000MJ0103U NP_384737.1 403606 Selected-2009-06-20  ali follow..  38  2.............KPAIALEGISKSFGVRALSDVSLALYPGSVTALVGENGAGKSTLVKILTGIYQPDAGTIRLGDTETTFPTALAASRAGVTAIHQETVLFDELSVAENIFLGHAPNRFGLIDWKQLNADAQALLGRAGAD-FDPTIRLRDLGIAKKHLVAIARALSVDARVVIMDEPTAALSHKEIHELYDLIERLKADGKAVLFISHKFDEIFRIADRYTVFRDGAMIGEGLIADVSQDDLVRMMVGRAVGSVYPKKEVTIGQPVLTVSGYRHPTEFEDINFELRRGEILGFYGLVGAGRSEFMQSLIGITRPSAGAVKLDGEV--LVIRSPAEAIRAGIVYVPEERGRQGAIIGMPIFQNVTLPSLSHTSRSGFLRLAEEFALAREYTSRLDLRAAALDQDVGTLSGGNQQKVVIAKWLATRPKVIILDEPTKGIDIGSKAAVHAFMSELAAQGLSVIMVSSEIPEIMGMSDRVIVMREGRVAGRYERSELTAEKLVRAAAGIETQAD............ 499
28 -120.000NT0103Q YP_511030.1 378549 Purified-2007-08-07  ali follow..  40  1.......MRQSSSAPLLTVQDLRKSFGVHALEGVSFELEQGEIHALVGENGAGKSTLIKVLSGVHAFDAGTITLDGQPYVPANPHAAKIAGLQVVHQEFNLLNDLSVAENISIEAMPTRLKLLDRREMNRRARTALDAIGLEDVDVSARVRTLGIAHRQLVEIARALQSDSRILILDEPTATLTERETIRLFEIIRDIRKRGVTIVFVSHHLNEVFDICDRVTVFRNGNTITTELIADTTPDHVVRHMVGRELAGTDDMHPSQAEDVVLEVSGLRTMKTDSSVSFQLHRGEILGIAGLVGAGRTEVLRGLFGADPIQAGSISVNGQP--VSIASPSDAISKGIGFVTEDRKEEGLILDMPITANSSLVDLSSVTKRGLLQFSKENEMARNGADMLHLKYGKLSDAAASLSGGNQQKVVLAKWLAKQPSILFLDEPTRGVDVGAKAEIYGILRDLARRGMSMIVVSSEMPELITLSDRIMVMANHTIQGVLPRADVTQERILKLAYGQHGDMERQT......... 511
29 -120.000MJ0103AC NP_437920.1 403696 Selected-2009-06-20  ali follow..  42  6...PRDSVTTESDRPILAAEAISKSFGVAALKDVRFELRAGEIHALMGENGAGKSTLMKVLSGVYTDYEGAVRVDGETVRFSNVRDAEAAGIAIIHQELNLVPELGVADNIFLGRERVIAGFVDRKASLEAARGLLNRLGIE-LDPEARVGQLRVGEQQLVEIAKALSVEARILIMDEPTSALSPGECRRLFKIMRQLAADGVGIIYISHRIDEVMQLSDRVTVFRDGRHVWARPMAGLDENTIIAAMVGRNLLDAHRRRGKGGGEPVLSVRDLSLADVLKGVSFDVRAGEILGIGGLLGAGRTEILETIFASNEGRGGEIRLDG--IAVNIRSPRDARRLGFALVTEDRKAKGLHLHESIRDNVALPLVGRLARFGLRSFEGERALAKGAVDALGVRCAGTGQAAGTLSGGNQQKVVIGKWLATGPRVLLLDEPTRGIDVGAKREIYDLIFKLAGDGLAIVVVSSELPELLLLADRILVMAEGRQTGLISREEASEERIMQLAAPRSARGRAV.......... 525
30 -120.000MJ0103L YP_352426.1 403396 Selected-2009-06-20  ali follow..  35  2............SGLAIDMTGISKAFPVKALVDADLRVARGTIHGLVGQNGAGKSTIIKVLAGILKPDSGRITINGTRVESLTPASVERLGVHFIHQERLLVPTATVAEAVFLNYELRFGPFLRPGAMKRRAEELIRTHFGLELPGDTLVRDLTTAQQKIVQITRALAQEAQVLVLDEPTAALVKREVDSLFAVLRNLRAQGIAVIFISHYMQEIEDLCDEVTVMRNGTDVGVVRPGETSIDEIVSMMIARDVGEMFPCRSHALGAPVLRVEGLSQAGHFRNVSFEVRAGEVLGITGLLGSGVKELVECLFGLEQPDAGSVTIDG--EVRRFANPGRAVQGRVALVPEDRRAHGVATDMSVRDNITIASLERYMTRGFVSRARENEAVDGFIRELSIKTPHRDQLVRNLSGGNQQKVALAKWLSCQSRVYVLDEPTVAVDVGAKVEIYTLLNRLAAEGAAILFLSSDLLEIAGFCDRALVVYRGTLNGEFAGETLDSDLLLAAASGARAQRK............ 500
31 -119.000MJ0103AL YP_002547028.1 402251 Selected-2009-06-20  ali follow..  39  7.....AAGECKPAPLLLKLEGVTKEFGVKALQDVSLDVRAGEVHAVCGENGAGKSTLMKIISGVYQRDAGNMIYKGETVHFTSTLQSEAAGIAIIHQELNLVPHLSVAENIYLAREPRLDFMVNRRKLRQDAKRCLDRLGVD-INPDAQVRTLSVAQRQMVEIAKALSLNASVLIMDEPTSSLTQQEAQLLFRVIRDLKREGTGIIYISHRLDEMAEIVDRVTVLRDGRYISTDDFDAITVDYIVARMVGRSLEEKFPAPTRSPKDTIFSVSGLTRHGVFSDIGFELRRGEILGFAGLMGAGRTEVARAIFGADPFDSGTLLLEG--RPLSISDPRSAIDAGLAYLSEDRKAGGLAVKMPVDANLMMANMEASNPFGVIDKELHRQSSQHYVNLLNIKTPSLNQPVRLLSGGNQQKIIIGKWLFRQPKIMFFDEPTRGIDVGAKLAIYRLMDELAAKGIGIILISSELPEILGLSDRVAVFHEGRITATLTTRETSQEEIMLYASGRVRESARGMTHG...... 524
32 -119.000NT0103I NP_419677.1 378535 Selected-2007-06-04  ali follow..  40  2..............TLLDVSQVSKSFGVRALDQVDLVVGVGEVHALLGENGAGKSTLIKILSAAHAADAGTVTFAGQVLDPDAPLRRQQLGIATIYQEFNLFPELSVAENMYLGREPRRLGLVDWSRLRADAQALLNDLGLP-LNPDAPVRGLTVAEQQMVEIAKAMTLNARLIIMDEPTAALSGREVDRLHAIIAGLKARSVSVIYVSHRLGEVKAMCDRYTVMRDGRFVASGDVADVEVADMVRLMVGRHVEFERRKRRRPPGAVVLKVEGVTPAGYLRQVSFAARGGEIVGLAGLVGAGRTDLARLIFGADPIAAGRVLVDD--KPLRLRSPRDAIQAGIMLVPEDRKQQGCFLDHSIRRNLSLPSLKALALGQWVDERAERDLVETYRQKLRIKMADAETAIGKLSGGNQQKVLLGRAMALTPKVLIVDEPTRGIDIGAKAEVHQVLSDLADLGVAVVVISSELAEVMAVSDRIVVFREGVIVADLDAQTATEEGLMAYMATGTDRVAAPDMERLTA... 515
33 -119.000TM0115 TM0115 281996 Purified-2001-12-06  ali follow..  35  1MFPLLAFRG--DRMEILKAKGIVKRFGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILVNGERVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRSSRVDENYMYTRSKELLDLIGAK-FSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVEETERLFEIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTIIKMMVGREVEFFPHGIETRPGEIALEVRNLKWKDKVKNVSFEVRKGEVLGFAGLVGAGRTETMLLVFGVNQKESGDIYVNG--RKVEIKNPEDAIKMGIGLIPEDRKLQGLVLRMTVKDNIVLPSLKKSRWGLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQKVVLAKWLATNADILIFDEPTRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLSDRIVVMWEGEITAVLDNREVTQEEIMYYASGQKKQNGRV.......... 519
34 -119.000MJ0103W NP_386671.1 403641 Selected-2009-06-20  ali follow..  41  2.............TVLVSLSGISKNFGVQALKGVDFDLRAGEVHALVGENGAGKSTLMRVLAGEMKPTSGTVSIHGETMQHSGPRGAAGRGISVIHQELALAPDLTVAENIFLGRLP---RIVNHRRLRKAASEILERLGFD-IDPAIHAGRLTVAHQQVVEIAKALSNRARIIVFDEPTAVLANTDAERLLAIIRELRAGGTGAVYISHRLNEVFDLSDRITVMKDGSHVETLETSATDVDAVIARMVGRQMSALFPKAGRVPGEVVVRVRNVSRGRKVRDVSFSVRAGEVVGLGGLVGSGRTEVARLVFGADKMDSGTVELNGKP--LHLSSPREAVRARIGLVPEDRKQQGVILDAPIRINTTLAKIRSISRLGFLDAGKERQVAVALGAEMRLKASSVDAPVSSLSGGNQQKVALAKWFHADCDLLILDEPTRGVDVGAKGEIYNLINDLAKAGKAILVISSEHQELFGICDRVLVMAEGAIVGELTESKFTEQQLLTLAMTRSARERDETSQ....... 501
35 -119.000NT0103AW NP_244597.1 378588 Purified-2007-07-18  ali follow..  41  1..............MIVEMTGIHKSFGNPVLKDVSFTLEKGEIHALMGENGAGKSTLMKILTGIYERDSGTVKIKGREVHYKHPKEAEADGLAVIHQELNILPELTVAENLFVGKERTKTGWIKSKEMNRLAEEKLAELGLK-VKGTERAGNLSVGKQQLIEIAKALMTNADIIIMDEPTAALTDREIDTLFATVRELQKKGVTFVYISHRMEEIFSLCQRITVLRDGEYVGTKVIAETSFDEIVKMMVGRALGNRFPEHTLTPGDVKLEIKHLTRAGEFENVSLSVRAGEILGISGLMGAGRSELVETIFGYRKADSGEVWIDG--KQAAIKGPDQAIAQGIGFVSEDRKSKGLIVDFSIRDNISLTNLSRISTSSWISSEKERSLYEELAKKLHVKASGPSQQAKSLSGGNQQKIVIAKWLGIEPKILILDEPTRGVDVGAKKEIYTIMNELAKQGVAIIMVSSELPEVIGLSTRVAVMFEGKLMHILERDELSEETIMHYATGGDKHVR............ 498
36 -119.000NS0103BE NP_622418.1 380539 Selected-2007-07-05  ali follow..  39  2............GEVLIRMENISKEFGVKALKNVNFEIKKGEVHALVGENGAGKSTLIKILSGVYSKDSGKIYFDGREVEINSPKEAQQLGISVIHQELNLCLHLTVAQNIFLGREFVKNGVIDEKKQNEEAKKILEKLNVN-IDPAEYVKNLSVSRQQMVEIAKAISMEAKVIIMDEPTSAISEKETEELFKVIGELKKQGKSIIYISHRLEELNRIVDRVTVLRDGEHIITANFRDLTIDDIIRYMVGRKLEEKYPRVYVNRGKKILEVHGLSQGTRLKDISFDLYEGEILGFAGLVGAGRTEVARAIFGADKFDKGEILING--KKVEINSPIDAIKNGLAYVPEDRKLTGLALNLSVLANITLATMDNVNMLSVINSVKERKIGEKIIRDLKIKTPSLFQRVQNLSGGNQQKVIVGRWLLREPQIYIFDEPTRGIDVGAKIEIYNILNNLKQEGKGIIVISSELPEIMGITDRVVVMCEGRITAILETSKTTQEEIMYYATLYKKER............. 499
37 -119.000NS0103AT 17741339 380526 Selected-2007-07-05  ali follow..  41  1.......MARAERSVLLRLENISKEFGVKALSNVHFDLRSGEVHAVCGENGAGKSTLMKIISGVYQPSEGTILHKGEKVQYASPLQSEAAGIAIIHQELNLVPHLSVAENIYLAREPRRGFLVDRKKLRLDAKRCLDRLGVD-INPDQLVRSLSVAQCQMVEIAKALSLDAEVLIMDEPTSSLTEQETRLLFKVIRDLKASGVGIVYISHRLDEMAEIVDRVTILRDGRYISTDDFASITVDDIVTRMVGRSLEDKFPERTRPTDDILFSVEGLTRNGVFSDVSFSLRRGEILGFAGLMGAGRTEVARAIFGADPLDAGKIVFNG--RELSIGSPQDAIEEGIAYLSEDRKSDGLAIKMSVAANTTLANLGESNRFGLIDFKKHDDVAKRYVDLLNIRTPSIDQTVRLLSGGNQQKIIIGKWLFRQSRVLFFDEPTRGIDVGAKFAIYKIMDELAAQGIGVILISSELPEILGLTDRIAVFHQGRITGVLETAKTNQEEIMRYASGYGRAAQ............ 505
38 -119.000NT0103AD 17741601 378564 Selected-2007-06-04  ali follow..  36  2..........SETAPLLEARAIGKSFGITALDGVDFSLARGEIHALLGENGAGKSTLIKILTGVYHRDSGSIFLDGSEISPANVGEAQALGIGTVYQEVNLLENLTVAENLFLGRQPHRFGMIDRASMQKQSQALLTQYGLS-IDVNALLSSYSVAIRQIIAIARAVDLSGKVLVLDEPTASLDAHEVEMLFGVLKNLRARGIGIIIITHFLNQVYDIADRVTVLRNGRLVGTRDIGSLPRSELIAMMLGRELQHITHEHQAADGEPPIHFEGYGKRGSIAPFDLGIRPGEIVGVAGLLGSGRTETAFLLFGVDKPDTGKATIDG--KTVAISSPEAAITAGFGFCPEERKTDGIIGDFSVTDNIALALQARQGWARPLSRRQKAELAESFIKSLDIRPADPNRPIKFLSGGNQQKAILARWLATHPRLLILDEPTRGIDIGAHAEILKMIEKLCTEGMSLVVISSELEELTAVAHRVVVLSDRRHVSELKGGDVTADNIMRAIAEAAKTE............. 505
39 -119.000NT0103AE YP_050367.1 378565 Selected-2007-06-04  ali follow..  38  2..........TAQSPYLSFHGIGKEFGVKALSDISFSCHAGQIHALMGENGAGKSTLLKILSGNYSPSAGEIHIQGKPVQFSNTMDALNAGVAIIYQELHLVPEMTVAENIYLGQLPHKYGMVNYSLLRYEAKLQLQHLGLD-IDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREIEQLFRVITELRSEGRIILYVSHRMEEIFALSDAITVFKDGRYVCTFDMQQVNHESLVQAMVGRNLGNIYGYAPRPHGEDRLTLKDVKAPGVKSTISLNVKQGEIVGLFGLVGAGRSELMKGLFGATKITSGQVLLDG--KPLVVNSPIDAIRQGVMLCPEDRKADGIIPVHSVRDNINISARRKLKAGFIINNQWEADNAAQRIDALNIKTPSDEQLIMNLSGGNQQKVILGRWLSEEMKVILLDEPTRGIDVGAKHEIYHVIYELANQGIAVLFASSDLPEVLGLADRIIVMREGAVSGELLHADATEQKVLSLAMLRIPDIE............ 503
40 -119.000NT0103AC YP_052322.1 378563 Purified-2007-08-07  ali follow..  35  3..........METTRLLDIRSMSVEFGVKALDQVDFTLNRGEIVALLGENGAGKSTLIKALTGVYHRSSGDIILDGIAINPVNTAHAQSLGIGTVYQEVNLLPNLSVAANLFIGREPTRWGIVDQHKILLQAEALLLNYGLA-IDVSHPLGNYSIAVQQIVAIARAVDLSAKVLILDEPTASLDAKEVDMLLDILRKLRDRGIGMIFVTHFLDQVYRISDRITVLRNGRLVGTLPTAELPRIELVQMMLGHSFDETLLKRGEVSGEPIVQFKHYGRRGSINDFELSVRPGEIVGLAGLLGSGRTETAQLIFGINVPDAGEAWVDG--KKINIRTPRAAGKLGFGYCPEDRKTDGIVGAATVRENIILALQAQRGWLKPISLREQTRIAEKFISLLGIRTPSAEQEIQYLSGGNQQKVLLSRWLATEPRFLILDEPTRGIDVGAHAEIIRLIEKLCEQGMALLVISSELEELTGYADRIIVLRDRQHVAHLEHSEISVAAVMQAIAVQTGAADDRQ......... 508
41 -119.000NT0103AI ARTH_26JUL04_CONTIG25_REVISED_GENE491 378569 Purified-2007-08-07  ali follow..  39  2.......TDMLAPRVVARLRGVTKSFGTTVVRNVDLDFRSGEVHVLAGENGAGKSTLTKLLAGIHQPDHGTVEINGQMGPF-DVKSSRTAGVTLVHQELLIAPNLTVADNLAMGQENNRFRGLDRTATLENARAQLAHIGAT-FPVTMRAEELTVADHQQIEIARALAQKPKILILDEPTSALSSAETERLLRIVDELRRNGTSVIYITHRMEEIEALADIVSIMRDGSLVETMPKAEATPDAIVLRMVGRKIDSLFTAERPEPGRVVLRVEQLTNGKDIGPIDLDVRAGEVVGIGGLIGSGRSEFVRLIFGADRASSGTVSVDG--SPVNVTGPGSAVRAGIALLPESRKTQGLVLDQSIAANIVLASLGHISSAGVVTPAAVKRVASKAQKRLGIKSASLGQEVTTLSGGNQQKVLFAKWLETKPKVLILDEPTRGVDVGAKAEIYQIINECAHAGVAVLVISSELPELIGLSSRVHVMREGRLVAEIDAQSLTEEAVMNHAFGIAQATQ............ 504
42 -119.000NT0103AQ YP_442864.1 378581 Selected-2007-06-04  ali follow..  35  1..........MTHSPAVEMIDIDKAFGVRALRRVCFRLFPGEIHALMGQNGAGKSTLINVLTGVQAHDAGEIRVGGRPVRFAAPREAEAAGIRTLYQEVNLCPNLSVAENVFAGRQPMKRGAIDWKTIHARARDALADLKLS-IDVTRSLDAYPIAVQQMVAIARAVSVDARVLILDEPTSSLDDGEVERLFDVLRRLKASGIAILFVTHFLEQTYAVSDRITVMRNGEREGEYLARDLPVDTLVAKMTGRERMSDTLRAGALAREPFLSMQRVGRRGMMHPFDLDMRPGEILGLAGLLGSGRTETARLAFAAERTDTGAIEIDG--ARARLASPRDALRRGIAYCPEDRKKEGIVAALSIRENIVLALQARRGWWRLIGRARQREIADAYIERLDIKARDAEQPIGLLSGGNQQKVLLARWLATAPKLLILDEPTRGIDVAAKFDIMERVLALCAKGLAILFISSEIGEVVRVSHRIAVLRDRRKVAELAGDDVSEERIYRLIAGGE................ 501
43 -119.000NS0103V YP_556479.1 380491 Purified-2007-10-11  ali follow..  34  1MNQDGASPLSETAQPFLQVVGVHKRFGVHALRGVSLTFERGQIYHLLGENGCGKSTLIKIISGAQPPDQGELVIEGVRHAQLSPLESLAAGIETVYQDLSLLPNMSVAENVALTAELAAARTFDRRALARTAARALEAVGLPADFQATLIEQLPLATRQLVAIARAIASEAKFVIMDEPTTSLTQKEVDNLIAVLANLRAHGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAQFTKARLSELMTGRELSNERYREAGHAQDVVLELRGLTRAGQFSDVSLSLHGGEILGVTGLLDSGRNELARALAGVAPAHAGEVLLDG--HAIALRTPSDAKRNRIGYVPEDRLNEGLFLDKPIRDNLITAMISSLDRFGQIDRARAQALAQQTVKELQIATAGIDKPVQSLSGGNQQRVLIGRWLAIDPRVLILHGPTVGVDVGSRDVIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMMKKGRVASEYRADALDEADLYHALLSEA................ 515
44 -119.000NT0103BE NP_977060.1 378599 Purified-2007-08-07  ali follow..  41  1..............MRIEMKNISKAFGNPVLKNAQFMIETGEVHALMGENGAGKSTLMKILTGVYKKDGGTITIDGQEHTFKNAKEAEEYGIAFIHQELNILSNLTVAENMFLGKELGKTGILRTRQMNAIAQQQLAELGLH-VKGAMLAGELSVGQQQIIEIAKALMTNASVIIMDEPTAALTDREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDTITILRDGEYVGKRSIPETSFDEVVSMMVGRSIGERYPERNSQVGDVIFEIRNGTKKGKFENVSFQVRKGEILGVAGLMGACRTDIMKAIFGYEPLDSGQIFING--QEVKIDSPIDAIRQRIAFITEDRKSEGLVLDFSIRENLALPNLESLSKGSVLSDELEQQFTADMMKLLNVKASSGEQAVKSLSGGNQQKVVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIMNKLTEQGDAVIMVSSELPEVLGMSDRVLVIHEGKVGGILEKDEASQESIMALATGGE................ 494
45 -119.000NT0103R NP_105717.1 378550 Selected-2007-06-04  ali follow..  40  2...NYSDTSIAATTPFLSLESVRKTYGVVALDGFSMEVRPGEVIGLVGENGAGKSTLMKILGGVTTPDTGTITVDGTAHKGLSVEGSLGSGIAFVHQELNLFENLDVAANIFFGREPLRAGLVDRSKLREMVAPLLKRVGAN-FSADAQVASLSLAQQQMVEIAKALSIKARLVILDEPTSSLPLAETDKLLDVIKALKADGISVIFISHRLHEVERVADRVVVLRDGMLAGTLGKRDINHDQMVKLMIGRMLKEREKASERAPGAVALAAKAIRTPYPSRPVDLDVRRGEILGLAGLVGSGRTELARVFFGIDGSLGGTLELDG--KTLVLGSAADAVAHGIFLVPEDRKLTGILLDLSIAQNISLPNLPAHARRSLVSASAETATAEKQKKNLGIKAPSVQTRTGTLSGGNQQKVVLGKWLAMNPKVMILDEPTRGIDIGAKAEIYGLMRALADAGVAVLMISSDMEEVIGVSDRIAVMHEGQISGILDKDQFSQENVLLLAVGKQPK.............. 512
46 -118.000MJ0103AA NP_437460.1 403684 Purified-2009-08-20  ali follow..  39  1..............MLLSMQGICKSFGIPALRAASLEVGEAEVMALVGQNGAGKSTLIKILTGAYRRDEGAVVFAGEGVSFSMPAESQARGIATIYQEINLAPQRSVAENIYLSREPRRFGLIDRRAMRDGAAAVLRAFNLE-IDVDQPVAGFSAATRQMVAIARAVTQKARLVIMDEPTSSLDEREVGILFDTIRTLKRGGVSVVFIGHRLEELYRICDRVTIMRDGKTVATAAMADMPKLALVRHMLGKELAAFEAIAKDAQRPVRLSVRNAGAGVRVRDVSLTVREGEISGLAGLLGSGRTETANLIFGADRLQRGEIRYNG--EARAYRQPADAIADGIGLVAEDRKVDGIIPDMSIRENMTLALLPKLARAGIVDRARQDEIVERYITALAIKCTSPDQPIKELSGGNQQKVLLGRWLCTDPKLLIVDEPTRGIDIGAKSEILRLLRRLADEGLGVLMISSELEELLAAADRVTVLSDGTSVAVLPRKELSEAALFAAMAHQV................ 496
47 -118.000NT0103V 17741890 378555 Selected-2007-06-04  ali follow..  37  4ETQTIKMTEASSPTPVLEMRGISQIFGVKALDGVDIALYPGKVTALIGENGAGKSTLVKILTGIYRPNEGEILLDGKAVHFHSAQDAIDAGVTAIHQETVLFDELSVGENIFLGHAPGRFGLIDWKTINERARILLEQLEST-IDPTIRLKDLSIAQRHLVAIARALSVEARIVIMDEPTAALSRKEIDDLFRIVENLKRQGKAILFISHKFDEVYEIAENYAVFRDGKMVGAGTLATTPQDEIVRLMVGRDVTNAFPKQAVTLGPTVLSVRDYSHQTEFRDISLDLRKGEILGLYGLIGAGRSELCQSLFGITRPASGEVTLDGQP--LTIRSPEDAIRAGIVYVPEERGRHGLALDMPIYQNMSLPSLTRTSRKGFLTAANEFALARKYAARLDLRAAALSVPVGTLSGGNQQKVVIGKWLATKPKVIILDEPTKGIDIGSKAAVHGFISELAAEGLSIIMISSELPEILGMSDRAIVMREGLMAGQFERAEFSPEKLVRAATGNA................ 510
48 -118.000NT0103AV YP_054736.1 378587 Selected-2007-06-04  ali follow..  41  2.............TTVLRLDHVTKAFPVKVIQDVSVDVIPGRVRVLLGENGAGKTTLIKMMSGIYHPDSGSVVIDDTPVELPTVKAAEARGIATIHQELNLVPQMSVAENIMLGRTPSRGGLVNWGLMRAQARAALERIGLD-VSPDRLVGSLSTAHQQLVEIARALSMDARVLILDEPTAALTRKESGQLFEVMDDLKTKGVAMVFISHHLDEIPRVGDDVSVLRDGTLVGEVP-ARTSERELVTMMVGRDIDDQFPRHRGEVGEVLLSVTGLSRERAFQDVGFDLHAGEVLGLAGLVGAGRTEVLRAIAGADKYDSGTVRVRG--KELPKGKISRAIVDGIGHVPEERKSQGLVLDASVNENLGYATMKSTSHAGLVDRSGQRRRAQNVAEKLRVRMASLDQPVRNLSGGNQQKVVIGRWILADSSILLLDELTRGVDVGAKVEIYQLINAVTDAGGAVLMVSSELPEVIGMSDRILVMSHGRAMGILDAKTATEDAVMELAVASVDPV............. 496
49 -118.000NT0103AH NP_438983.1 378568 Purified-2007-08-07  ali follow..  34  3.....AQTQCQDSQVLLTMTNVCKSFGVKALDNANLTVRSHSVHALMGENGAGKSTLLKCLFGIYAKDEGEILFLGEPVNFKTSKEALENGISMVHQELNLVRQTSVMDNLWLGRYPLKGPFVDHAKMYRDTKAIFDELDID-VDPKEKVAKLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLSEKEVEHLFKIIDKLKQRGCGIIYISHKMDEIFKICDEITILRDGKWINTVNVKESTMEQIVGMMVGRELTQRFPEKTNVPKEVILQVENLTAKPSIQDVSFELRKGEILGIAGLVGAKRTDIVEAIFGVRELIEGTIKLHG--KTVKNHTALEAINNGFALVTEERRSTGIYSNLSIEFNSLISNMKSLTPWKLLSTKKMKSDTQWVIDSMNVKTPSHRTTIGSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGIDIGAKFEIYQLIQELAKKDKGIIMISSEMPELLGVTDRILVMSNGKLAGIVESAKTSQEEILQLAAKY................. 505
50 -118.000NT0103AO YP_050810.1 378578 Selected-2007-06-04  ali follow..  34  2.........TSTSQSRLEMRNISISFGFHALKQVNFTLEGGSIHALTGANGAGKSTLMTILSGAYDHYQGDILINGKLVDIHSPRDAKRYGIHLVQQEVDLVPTLSVAENIMLDTLAQDGHLLNWPQIYSQAQALLDQLGVP-LNVRQRLDTCSLAEKQQILLARALSHECRFLILDEPTAPLDQAESARLFQVVRRLQADGIGIVFISHRIHELSEICDTLTVLRDGEFVSSGVMQGLSGEEIVERMLGHRLDDIFPPRRTTPSETLLQVIGLHDETLLHNISLTLHKGEILGIAGLAGAGKTELCKALFGAEPCQIAQGEYRGKP--WQPHSPHQSVEQGLALVPEERRKEGIFIDESVTMNLSITATDSFSHWGIFSRGKALRWAKQIVERLAVRTTGPAQKLARLSGGNQQKVAIGKWLRSEAQVLIFDEPTKGVDIKAKQDLFTLIDGLARQGKGIIYASGEFSELVGLCDRICVLWDGRIVAELNAAEIDEETLLLYSTGGTPT.............. 503
51 -118.000NT0103BF NP_391475.1 378600 Selected-2007-06-04  ali follow..  41  1..............MQIEMKDIHKTFKNQVLSGVSFQLMPGEVHALMGENGAGKSTLMNILTGLHKADKGQISINGNETYFSNPKEAEQHGIAFIHQELNIWPEMTVLENLFIGKEISKLGVLQTRKMKALAKEQFDKLSVS-LSLDQEAGECSVGQQQMIEIAKALMTNAEVIIMDEPTAALTEREISKLFEVITALKKNGVSIVYISHRMEEIFAICDRITIMRDGKTVDTTNISETDFDEVVKKMVGRELTERYPKRTPSLGDKVFEVKNASVKGSFEDVSFYVRSGEIVGVSGLMGAGRTEMMRALFGVDRLDTGEIWIAG--KKTAIKNPQEAVKKGLGFITENRKDEGLLLDTSIRENIALPNLSSFSPKGLIDHKREAEFVDLLIKRLTIKTASPETHARHLSGGNQQKVVIAKWIGIGPKVLILDEPTRGVDVGAKREIYTLMNELTERGVAIIMVSSELPEILGMSDRIIVVHEGRISGEIHAREATQERIMTLATGGR................ 493
52 -118.000NT0103AN NP_416413.1 378577 Purified-2007-08-07  ali follow..  38  2..........QQSTPYLSFRGIGKTFGVKALTDISFDCYAGQVHALMGENGAGKSTLLKILSGNYAPTTGSVVINGQEMSFSDTTAALNAGVAIIYQELHLVPEMTVAENIYLGQLPHKGGIVNRSLLNYEAGLQLKHLGMD-IDPDTPLKYLSIGQWQMVEIAKALARNAKIIAFDEPTSSLSAREIDNLFRVIRELRKEGRVILYVSHRMEEIFALSDAITVFKDGRYVKTFDMQQVDHDALVQAMVGRDIGDIYGWQPRSYGEERLRLDAVKAPGVRTPISLAVRSGEIVGLFGLVGAGRSELMKGMFGGTQITAGQVYIDQ--QPIDIRKPSHAIAAGMMLCPEDRKAEGIIPVHSVRDNINISARRKVLGGCVINNGWEENNADHHIRSLNIKTPGAEQLIMNLSGGNQQKAILGRWLSEEMKVILLDEPTRGIDVGAKHEIYNVIYALAAQGVAVLFASSDLPEVLGVADRIVVMREGEIAGELLHEQADERQALSLAMPKVSQA............. 502
53 -118.000NS0103AQ 17742317 380522 Selected-2007-07-05  ali follow..  37  2............GEVILSMTNIHKAFPVRALRSAALELQRGEIHALAGENGAGKSTLMHIIDGILQPDGGEILLDGKPVRISSPNAANRLGIGFVHQEIALCPEISVAENMYMSETGSRSWFMNYRDLEKRAATVLREIG--DIDPTHRAGDLSISQQQIVEIAKALTLDCRILILDEPTAALTETEAQTLFKIMRRLAARGIAIIYISHRMAEIFEHCDRITVMRDGCHIRTENIADISPEEVVNSMVGRVLDKLYPPKDEKSNEVILSVRGLNEGKRVFDVDFDLRRGEILGFAGLIGAGRSEIARAVCRLEGKPKGEVVLRG--RSLKLRDYRDSIREGIVYLSEDRKGDGLFLNMSIATNVSALDIGRSNGMGFIQRRKEMKRADELGRRLKLRANSVGDAVSTLSGGNQQKVALAKMLSVEPEVIFLDEPTRGVDVGAKAEIHRQIRELARQGVGVVVISSELPELIGVSDRVLVVREGRITGEVEGDDMTEEKIMQLASITIMQNAAE.......... 505
54 -118.000NT0103AF NP_107470.1 378566 Purified-2007-08-07  ali follow..  38  1..........MTQSDFFSLDGISKRFVVQALDNVSIAFRPGEVLALVGENGAGKSTMMRILEGVSGPDTGTVRHGSTPIVFGEPRDSHRAGIRVIHQEPEIVPNLTVAENIFVGELPRLAGLLDWRKLEEQTDRVLATFGMQDMRPRQLCGTLGPAQRQMIEIMRAIRAGGRLIAFDEPTSSLTDDEARRLFSVVRRLREKGTSIIYISHRLNEIIDLADRIVVLRDGRLVDDSPAAGASEQTIAKLMVGRNIDDLFTRETWRSGEQLLDVAGLTT-DRVNDVSLRVRRGEVLGIAGLMGAGRSELAKAIVGYDRRIAGTIAMNG--VPVLPNSPHAAIVAGIGFAPEDRKHEALLLFRSILDNAALCVPDKTSSFGFFNRRKAMEIVSPLAAKMSIKAPNLDEQVSKLSGGNQQKVVLARWLARQPMLLILDEPTRGIDIGAKAEIYRLIDELAASGIGIILISSEMPELIGLADRVLVMAGGRITAELARPDIDEATILKHAMPQSASSPGDYIQ....... 507
55 -118.000NS0103I YP_426425.1 380472 Purified-2007-09-18  ali follow..  35  7VLIRDSAPREATSPPFLDIRDVHKRFGVKALRGVSLAIERGQIYHLLGENGCGKSTLIKIISGAQPPDEGTLVVEGREVAGLSPIMALAAGIETVYQDLSLLPNLSVAENIALSQQLQLARRLDLARLKATATRALEAVNLPDGFLATRVDELPIATRQLIAIARVIATDAKLVIMDEPTTALTKREVDNLIAVVEKLRAKGVAVLFVTHKLDECRTIGGRAIILRDGRKVMEGDIADFTKKDLSHWMTGRALDDSRYREAERGGERLLDVRDLGRANAFGGVSFSLNRGEILGVTGLLDSGRNELALALAGVCPADRGGVSLAG--ERVVLSQPADAIAAGIGYLPEDRLSEGLFLEKPIADNIIASVLDRLGRLGMLDRPLSRSRAQEMTDDLQIATPDIANPVQSLSGGNQQRVLIGRWLMIEPRLLVLHGPTVGVDVGSKDTIFRIIQRLAKGGMAVIIISDDLPELLQNCDRILVMRKGRVAEVFDAEGLGEGALYRALVAEESPRSLP.......... 527
56 -118.000FP0103B YP_298331.1 382011 Purified-2007-12-14  ali follow..  37  2.......NAMTQVSPLLEMRGICKTFGVKALDDVSFDIYPGEVHMLLGENGAGKSSLMKVLCGVYVADAGEFHHQGQRVEVSGPADTMRLGIAVIFQEFSLVPYLDIAQNIFLGREPRGPGSVDHAKMHAEARRLLDTLGMD-ISTHTPVHRLGVAQQQMIEIAKALSQNARILVLDEPTAALSERETEKLFGVIARLKADGVSMIYISHRMAEVFALGDRITVMRDGRKVGSYMPGDATPDELVARMVGRKVDMGYTRRGGPVGEVALDMQGVSADNGIDDITLQVRAGEIVGLAGLVGSGRSEVARAVFGADPVRAGEIRIFGKSMR---GGPDKARALGAALIPESRKTEGLALIRSVRDNLLLAGLRRAFPAHWYRSGKAAQLSTREIGRLRIATPSGDQLAQFLSGGNQQKIVIGKWLVAESRLFIFDEPTRGIDVGAKAEIFALIDGLVKQGAAVLLISSELPEIINVCDRTYVMRGGRVAGELAHDAMTEESILQLGMNDA................ 502
57 -118.000PX0103A LCAS_20SEP02_SCAFFOLD53_REVISED_GENE3242 395778 Selected-2008-07-14  ali follow..  36  14...SKHQHVLGGITMKIEMKKITKSFANRVLEGVDFTVESGEVHALMGENGAGKSTLMNILTGLYQANSGEILVDGQPTTYSGPMEAEQHGISFIHQEMNNFLEMSVVDNMFLNKELTKFGLMDNKAMREQAAHYLSLLGAK-LDVEQPIGNLSVGRQQMVEIAKSLMTDAKIIIMDEPTAALTETEIDQLFGVVRRLKEKGVGFIYISHRMEEIFEIADKVTVMRDGLSITEYATKDVTMKQLVKDMVGREIDDFYPDRTPDHGPVAMEVKGLTENGVFKDVSFTVHQGEILGFSGLMGAGRTEIMRAIFGIDKYQSGEILLDG--KPVKIRDPQDAIRHNIGFLTENRKDEGLILEDSLHDNIVLPSIDGFVKHGLVDDKATDEFVRMLMKRLTVKAMGPDVSAGSLSGGNQQKVVLAKWIGSGSKVLILDEPTRGVDVGAKREIYDLMNELTDRHVAIIMISSDLPEVLGMSDRIAVVYEGKITGILDGKTATQESIMTLATGGVEEH............. 520
58 -118.000NS0103Q RRUB_10JAN05_CONTIG98_REVISED_GENE2208 380481 Purified-2007-09-18  ali follow..  32  16...CRQTEWSQMPEAFIELRAITKRFGVCALDALSLTINKGEIHCLAGENGSGKSTVIKVMAGVYQPDGGEILINGAPVRALTPIEAVRRNIQVIYQDFSLFGNLTVAENLALCGELQKRKLADWKRIRAIGRQALDRLGVD-IDLEVDVERLPTSSRQIVAIARALMSDAKLLIMDEPTTALTGREVDALFRIVKDIQAQGIAVLFVSHKMREMLEISERLTVIRNGRTVIDGPTSAFDESAVTRHMTGLDILSEGAWAGSPEAVPRLEVRGLSLPGAFEDLSLAIRPGEIVGLSGLLGSGRTEFALSLFGMMPPAAGQVLVDG--AQIAPRSVQDAIAEGITYVPEDRLTEGLFLTQSIDRNILATSYERLAPRGVIDRAKAAMQSAGMIKAMQIATPTGEKPVGQLSGGNAQRVVLARWLLTDAKVLILNGPTVGVDVGSKAEIHRKIRELSAHGLAVLMISDDVLELVQNTNRIVLMHRGRFVDDLPTATVSEQSINDLLKSFT................ 521
59 -118.000NT0103BG NP_438660.1 378601 Purified-2007-08-07  ali follow..  39  2.............ETLLKISGVDKSFGVKALNNACLSVYAGRVMALMGENGAGKSTLMKVLTGIYSKDAGTIEYLNRSVNFNGPKASQEAGISIIHQELNLVGNLTIAENIFLGREFTSWGAINWQKMHQEADKLLARLGVT-HSSKQLCAELSIGEQQMVEIAKALSFESKVIIMDEPTDALTDTETEALFNVIRELKAENRGIVYISHRLKEIFQICDDVTVLRDGQFIGERVMAEITEDDLIEMMVGRRLDEQYPHLSQEKGECVLDVKHVSG-SGIDDVSFKLHAGEIVGVSGLMGAGRTELGKLLYGALPKTAGKVRLKN--QEIENRSPQDGLDNGIVYISEDRKGDGLVLGMSVKENMSLTSLDHFSQKGGIRHQAEKMAVDDFILMFNIKTPNRDQQVGLLSGGNQQKVAIARGLMTRPNVLILDEPTRGVDVGAKKEIYQLINEFKKEGLSILMISSDMPEVLGMSDRVLVMREGKISAEFSREEATQEKLLAAAIGK................. 493
60 -118.000NT0103BB CAUR_25MAY01_CONTIG1053_REVISED_GENE778 378594 Selected-2007-06-04  ali follow..  39  1..........MQVSPVLEIRDISRRFNTQALDGVSLRLYPGEVHALLGENGAGKSTLIKIMTGVYQPDSGQILLDGRPVHIGSTLAAQRLGIAAIYQEPLMYPDLNVAENIFIAHA-GRGPFVDWGRMYREAEALLAQLDVR-LDVRLPARGLSVAAQQTVEIAKALALQVRVLIMDEPTAALSAHEVEQLFAIVRRLRDQGVAILFISHRMEEVFAIADRITVFRDGRLISSAPRAEVTPEQAIRDMAGRSVEQLFPRRHTVRDQVLVEVRDLSRQGAFQGISFDVRAGEVLGFAGLVGARRTDVGLALFGIAPADSGTVRIDGQL--VRITNPRQAMRHGIAYVSEDRRGLGLSLPMSIAANITLPTLRRLNPLGLLRQADEIATAEAYRQRLAIRAPSVAVEVGKLSGGNQQKVMLSKWLNTRPRLLILDEPTRGIDVGAKAEVHQMIDDLAAEGIAIILISSDLPEVLAMSDRVLVMREGRQMAIFSRQEATQERVLGSGDGPNV............... 497
61 -118.000MJ0103Z NP_436843.1 403674 Selected-2009-06-20  ali follow..  35  3.....SAGARSDTMPFLEVRDLEKRFGVRALKGVSFTIERGRTYHLMGENGCGKSTLIKIISGAQPADGGELTINGKKVEGLTPIGALAAGIETVYQDLSLLPNLSVEENVALTQQLVAARRLDLKGLRETAVRALKDVGLEPAFLSTPVEELPIATRQLIAIARAIASDAGLVIMDEPTTALTRREVDNLIRVVHGLHAKGVSVLFVTHKLDECKAIGGQAIIMRDGLKVAECDVATQSKTELGFWMTGKNLDDTRYRVDTHGDETLLSVERLGG-AGFDDVSFTVSKGEIFGITGLLDSGRNELALSLAGVESARRGSVLLAG--RRADLSSPASAIEAGIGYVPEDRLSEGLFLGKSIRENIVMAVLDRLGAFGLLDSRRAKALAQKTVDDLQVATPDIDNPVMSLSGGNQQRVLIGRWLTIEPSLLILHGPTVGVDVGSKDTIFRIIQRLAGDGMSVVIISDDLPELLQNCDRVMVMRKGRVADIFPAEGLEEDAIYKSMMAEDGQG............. 514
62 -118.000NS0103BN NP_621901.1 380551 Selected-2007-07-05  ali follow..  39  2.............EPILQMKGISKKFNVKVLDNVDLTLYRGRVLALLGENGAGKSTLMKILCGIYEKDEGSIYLKGKKVNIRNVRDAEKYGIAMIHQELNLVPSLSVAENIFLGREYRTFNSIDWKKIKQESAKILHELGMD-LNVDRLVKHLSVGEQQMVEIARSLLMNAEILVMDEPTAALTEGETRRLFEVIKRLRKEGKSIIYISHRMNEIFEICDDYIVLRDGCLISQGEISEVTRDDLVKMMVGRELKEHFPYECSSPGEEILRVENLTVKGMFEKVSFVVKKGEVVGFAGLIGAGRTEVAKTIFGFYKKTSGKIYLGG--EEVKINSPRDAIEKGIMYLSEDRRNEGLIIKHTLKENMTLSALKKIDYIGTINFSKERSIVNEMIQKLNIKSFSPNQKIFRLSGGNQQKVAIAKCLLTNPKLIILDEPTRGIDVGAKNEIYKLINDLKRQGIGIILISSELPEVLNISDRIIVMHEGKITGEISREEATEEKVMLKAVGGE................ 496
63 -117.000NS0103T YP_322687.1 380488 Purified-2007-08-22  ali follow..  38  11........PPATATPVLEMQGIAKRFGVPALQGVNLTIYPGEVHALMGENGAGKSTLMKILAGAYIADEGEIRINGKGVKITDPGTARQAGINLIYQELNVAPNLTVTENIFMGSELTRGQFLDRKAMELEAQQVLASLGAS-FAPTDIVGTLAIAEQQQVEIARALKDNSRILVMDEPTAALSDRETERLFEVIRKLRNDGIAIIYISHRMEEIYALADRISVLRDGQYIGSLTREEISPQRLVQMMVGRSMQDFYEQRQSNPGPVVLEVRNISDGRKVQPASFQLRAGEILGLAGLVGAGRTEVSRLIFGADRKVSGEVFLNG--KKLEIHSPSDAIAVGIGYVPEDRKDQGLFLEMSSRKNIGLNRLKQDANLGIVNWGSVNKIATDAVENFHIRLANLEIRAVDLSGGNQQKLLLARWLAINPRVLMLDEPTRGVDIGAKSEIYRIISDLSAQGVAILMVSSELPEIVGLSDRVLVMREGQLVGELDNKEITQENIMHYATGASEVT............. 515
64 -117.000NT0103AT NP_418205.1 378585 Purified-2007-08-07  ali follow..  38  2.............EALLQLKGIDKAFGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTGIYTRDAGTLLWLGKETTFTGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGREFNRFGKIDWKTMYAEADKLLAKLNLR-FKSDKLVGDLSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETESLFRVIRELKSQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAEREVASLTEDSLIEMMVGRKLEDQYPHLDKAPGDIRLKVDNLCG-PGVNDVSFTLRKGEILGVSGLMGAGRTELMKVLYGALPRTSGYVTLDGHE--VVTRSPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYSRAGGSLKHADEQQAVSDFIRLFNVKTPSMEQAIGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEVLGMSDRIIVMHEGHLSGEFTREQATQEVLMAAAVGKLNRVN............ 499
65 -117.000NS0103BP YP_557366.1 380553 Selected-2007-07-05  ali follow..  37  2.............SLAIRFDDIRKDFPVRVLHGVSFELAPGRIYGLLGENGAGKSTLMKILAGYETATSGSLLIDGQPQQFNGSRDAEAQGIVLIHQEFNLAEHLTIAQNMYLGHEKKRGWFVDDAAMNIEAARYLAQVGLE-KAPDTKVRELIVAEKQMVEIAKALSRRARLLVMDEPTATLTPSETERLFTLMAKLKADGVTLIYISHKLDEVERITDEVIVMRDGRFVARGETAGLSRQQMANLMVGRDVSDMFPEKITVPAPVALKVQGLVVPDWVEDLSFDVRAGEVLGFAGLVGAGRTEAFEAIIGLRKRTAGRIEIAG--RPADLKSPRDAMRHGLTYLSEDRKGKGLHVNLSLQDNVTMMTLERYAH-PLLDMKAGRAALTKAVSEFGIRTGDLSSRARMLSGGNQQKLALAKFLQPEPDVIVLDEPTRGVDVGAKRDIYFLIHRLAAQGRAVIVISSELIELIGLCHRVAVMRAGRLPATLTLEHLTEEELIAHATGTH................ 495
66 -117.000NS0103BG YP_611489.1 380541 Purified-2007-09-29  ali follow..  35  2.............SKLIETRGLTKKYGVVALDHVDFDLEPGEVHVLFGENGAGKSTLISMLAGANAPSEGRLLLNGEEVQFESVADAQAKGIYTVFQEFSLIPTLTVAQNIFLGWELRFGPFLDHRAMRARAREMLAELGFD-IDPAAIVAQLSRAQQQMVEITKAFHGDLNVLILDEPTASLTDREVDHLFEFVAKLKAQGVGIVYISHRIQEFERIAERVTVLRDGAVIGTVAMAETDEDALVEMMTGRAFDQIYPSITFSPGETLLEVSDLTA-PGISGACFQVRRGEVLGVAGLVGSGKSRLFRAVMGLTPVQSGSIRFKG--ADITNAPTRKIITRGMYYLSPDRKAEGLDLAKNARDNLAVNIISGSGHGPFIPWGAVNARIDQISDHVELHAGYRSKPTSQLSGGNQQKVLFGKCFGQDADLIIFDEPTVGVDMGTRAALYLLIKELAEAGKAIVVISSDLPEAMNIAHRLLVLAHGTITARLSADEMSEDTVLKYFFDETGASQ............ 500
67 -117.000NS0103BD YP_511035.1 380538 Purified-2007-10-11  ali follow..  33  2..........NAVLPRLAMRDIVKSFSVRVLDGVSLDVMPGEIVALLGSNGAGKSTLMKILTANYTKNAGDIRVNDTLVDFASPRDAARVGITFLPQEISVFPELSVAENICMSADSK--GTVDWSGMARRSAAVLDDLGFGHLSPDMLVADLPVAERRIIEIARALEGQADILVMDEPTASLSEQESEQIFTILRRLKDRGTSIVYISHYLKEVFEISDRIVVLRDGLNAGEFDPTTADVTKVVGAMLGKAAGSMFDDRDPLPAPVVFTCAGLTLPGVIEDVSFDLRAGEILGIFGLIGSGVEVLGRAIFGTQRPPAGAMTLNG--TPYTPVSPRKGKEAGIGFVTAERKTDGIMADMSVRENIVAAFQSDLGHGPFTSPAREAAHTLDWIEKLGIKTSGPEQAIRLLSGGNQQKVCVARWLNPKVKMLILEEPTRGVDVGARREIYSHLVDFARSGLAVLVLSSDVEEVAGLSDRSLVIDRGRILAEFGRGATPGDLMAASAQSEHHD.............. 501
68 -117.000NS0103AB NP_823004.1 380502 Selected-2007-07-05  ali follow..  37  2..........APEPPLLTMSGITKSFGVRALDGVDLDVQAGEVHCLLGQNGAGKSTLIKVLAGAHQPDDGRLCWRGAPVTLRSPIAAMRLGIATIYQELDLVEGLSVAENVHLGHEPTTAGVVRGKAARASTAALLKRLGHPEIAPSRLVGDLSAAQQQIVSMARALSHDVRLIVMDEPSAALDPDEVDNLFRIVGDLTADGVAVVHISHRLEEIRRIGDRVTVLKDGRAVGGLPAKSTPTREIVALMTGRDVEYVFPDRPPATSDPLLKVQGLAREGEFEPLDLELRPGEIVGLAGLVGSGRSEILETVYGARKPSAGQVTVAG--RALRPGSVRAAVRAGLGLAPEERKTQALLLLESVTRNVSLSSMSRFAHGGWIDRGAERDAARAATRELSLRPDRPSAPARTLSGGNQQKAVLARWLLRGCRVLLLDEPTRGVDVGARAELYAVIRRLADEGLAVLLVSSEVPEVLGLADRVLVLREGRVVHRAPARELDEHRVLDLVMEGSPVEGTPAS........ 512
69 -117.000NS0103B YP_553910.1 380457 Selected-2007-07-05  ali follow..  35  35.....NSPQSEASLPFLQVVGVHKRFGVHALRGVSLSFERGQIYHLLGENGCGKSTLIKIISGAQPPDEGELVIEGVRHARLSALESLAAGIETVYQDLSLLPNMNVAENVALTSELATVRTFDRRELARTAARALEAVGLPAEFQATLIEQLPLATRQLVAIARAIASEAKFVIMDEPTTSLTQKEVDNLIAVLANLRAQGVTVLFVSHKLDECYAIGGEVIVLRDGQKMAQGPIAQFTKAQISELMTGRHLSNERYREGACEQNVVLDVRGYTRAGQFSDVSFALHGGEILGITGLLDSGRNELARALAGVAPAQSGQVLLDG--KAVSLRTPSDAKEHRIGYVPEDRLNEGLFLDKSIRDNVITAMISSLDRFGQVDRSRAQALAEQTVKDLQIATPGVDKPVQSLSGGNQQRVLIGRWLAIDPRVLILHGPTVGVDVGSKDIIYRIMQRLSQRGIGIILISDDLPELLQNCDRILMMKKGRVAGEYQAATLSEADLYHALLSEA................ 544
70 -117.000NT0103H YP_110163.1 378532 Selected-2007-06-04  ali follow..  39  2.......QRSDPPRPLLEMRGISKTFAVRALAGVSLTVHPGEVHSLMGENGAGKSTLMKILSGAYQADGGEILIDGRPISIDGPLAARDAGVAVIYQELCLAPNLSVAENIHVGRELRRRGTIDRAAMARGCQDVLERLGAD-FGPNTLVGTLSIAEQQLVEIARAVHTRARILVMDEPTTPLSSRETDNLFRLIRQLRAEGLAIIYISHRMAEIYELSDRVSVLRDGAYVGTLERDALSAERLVGMMVGRDISGFYKKAHADPGNLLLSVRDIADGARVRGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGEVTLAG--KAFAAHSPREAIDAGLVYLTEDRKRQGLFLDMSVRENINISVCGRDARLGALDLARGAQRARDAIAALSIRVPHANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRIINELARAGVGVIVISSELPEIIGVADRVLVMREGRIAGELGGAPITQEAIIALATGSRTEASAAH......... 517
71 -117.000NT0103AS YP_048143.1 378584 Purified-2007-08-07  ali follow..  38  2.............QPLLQLQGITKSFGVKALSGAALNVYPGKVMALVGENGAGKSTMMKVLTGIYRKDAGSIHFLGQEVDFNGPKASQEAGIGIIHQELNLIPQLTIAENIFLGREFNRFGRIDWNKMYAEADKLLKRLNLR-YDSRRMVGDLSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETASLFSVINELQSQGCGIVYISHRLKEIFEICDDITVFRDGQFIGERPVSDLEEDTLIEMMVGRKLEDQYPRSNKAPGEVRLKVQNLSG-PGVDSVSFTVRKGEILGVAGLMGAGRTELMKILYGALPRTGGNVTLDG--RDVVTRKPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRYSHAGGRLKHAEEQLTVADFIRLFNVKTPSMEQPIGLLSGGNQQKVAIARGLMTRPNVLILDEPTRGVDVGAKKEIYQLINQFKEEGLSIILVSSEMPEVLGMSDRIIVMHEGRLSGDFPIEQATQEALMAAAVGKQYGAK............ 499
72 -117.000NT0103O 17741941 378543 Selected-2007-06-04  ali follow..  34  2...........DKQPVFQARNVEKVFGVRALKGVNLSLQPGSIHALLGENGAGKSTLIKVVTGVHHQSSGQILVDGQAVRFSNPREAIARGIGVVHQERNLIPRFSIAENIHMEKLGAHLKPIDYAALNRDARRWLEALNLE-IDPATPVSELSVAQMQLVEIAKALSLQSRVLLLDEPTTSLTPSETDNLFRILRRLRDDGASLVFVSHKLEEVLDICDRVTVLRDGENACESSMEGLGRQDLVRLMIGRAESGGWRKRAVEHNPMVLELEGVSTAIGHGDVSLSVRKGEIVGLYGLVGAGRTELAKSIMGKFAVTSGNVRVSG--RPARIRSVAEAIHYGVGYVSEDRKGDGLILQHSVLANAGVPIWRKLNTFGVLSDGRIRAAVTPFLKKLEVKTPSLSQTVGNLSGGNQQKISVAKWLAADVKLLIVDEPSVGIDIKTKAYLHDLLRELADNGTAILVITSDMPEMVALADRIVVMDQYRVKGIVENNGVYADMSHDIMTLIHHSEESEARLHQ..... 512
73 -117.000NS0103BR YP_425341.1 380557 Purified-2007-09-18  ali follow..  37  2............SSPLLTMRGIRKSYGVHALVDGNLDLERGQIHALCGGNGAGKSTILGILMGFTRPDCGEIRIEGKPVSFANPTQALQAGIAIVQQELSGVPHLTVAENIYLGAEPRRRGFVDFPQLNRQAEELLASLGFD-IDPRVPLASLSIASQQLIEIAKALSRDADILIFDEPTSAIGEKDTLRLFEVLRDLAAAGKGIIYVTHRLAEVFTIADSYTVFKDGARIETGRVADITREKLIESMIGGAIEGEYVKENVPSDRPLLDVRGLSRAPWFDRVSFTLHAGEILGIYGLVGSGRSQLLDTIYGLYPADAGTVWVEG--REIRPGRVRAALGAGISYVTEDRKHSGLVLCASVGDNLSLSQLPHIQRFGFIRTALERAGIDDSIAKMRIKTPGPEQIVRNLSGGNQQKVVFGRCTSIGPKVLLLDEPTRGVDVGAKKEIYRFVSDFTKAGGAVLMVSSELDEITGMSDRIIVIKKGAHVAEFPREETTQKALMMAAV................... 493
74 -117.000NS0103BS YP_001814852.1 380559 Purified-2007-10-11  ali follow..  41  1..............MQIEMTGITKAFPVPVLKGVDFTLATGEIHALMGENGAGKSTLMKILTGVHKADQGTILVDGVEQQYKNPKLAEEAGIAFIHQELNILPDLTVTENLFLGRELSRFGVLKQAEMKRLAERELAELNVF-MDVNQLARTLSVGQQQMIEIAKALMTDAKVIIMDEPTAALTEREIRALFSVATALREQGVSIVYISHRMEEIFELCDRITVLRDGVSVSTHRIADTSFEQIVREMVGREMGERYPERQVTLGQTVLEVTGATG-KRFEDVSFSVRAGEIVGFSGLMGAGRTEVMRGLFGIDRMKAGTISLNG--KTIKIKSPHDAIKQGLGFLTEDRKGEGLFLDFSLRENISLPTIRSLSKSGVISDQSERQFAEGYLKSLSVRHSSMDQPAKSLSGGNQQKVVLAKWLGTKPDVLILDEPTRGVDVGAKKEIYMIMDELAATGVAIIMISSDLPEILGMSDRVYVMREGQMSGMLNQEEATQESIMTLATGGQ................ 492
75 -117.000NS0103BT NP_687152.1 380560 Purified-2007-09-18  ali follow..  40  1..............MKIDMRNISKSFTNKVLEKIDLELQSGQIHALMGENGAGKSTLMNILTGLFPASTGTIYIDGEERTFSNPQEAEEFGISFIHQEMNTWPEMTVLENLFLGREITTFGLLNQKLMRQKALETFKRLGVT-IPLDIPIGNLSVGQQQMIEIAKSLLNQLSILVMDEPTAALTDRETENLFRVIRGLKQEGVGVVYISHRMEEIFKITDFVTVMRDGVIVDTKETSLTNSDELVKKMVGRKLEDYYPEKHSEIGPVAFEVSNLCG-DNFEDVSFYVRKGEILGFSGLMGAGRTEVMRTIFGIDKKKSGKVKIDD--QEITITTPSQAIKQGIGFLTENRKDEGLILDFNIKDNMTLPSTKDFSKHGFFDEKTSTTFVQQLINRLYIKSGRPDLEVGNLSGGNQQKVVLAKWIGIAPKVLILDEPTRGVDVGAKREIYQLMNELADRGVPIVMVSSDLPEILGVSDRIMVMHEGRISGELSRKEADQEKVMQLATGGK................ 492

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 1 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.