current user: public




378010
Query: FM11698A YP_831092.1 378010 Selected-2007-05-11, from JCSG1009

Results of FFAS03 search in JCSG1009
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MPEDVWLIALKNLDDDARAIKLGEIAELELAADQQDFAGDPLRMMLVALEEDSRVPYVVDSGGMAVGVLTLQRGAASLAGWADDESVWLLRGFLIDRRRQGQGLGTLAASAAVREAAKLTARLGGGEAGVVLSVNERNPAGQAAYRKAGFEDRGQYLGGNAGPQRTMYRAFLast
1 -80.600FM11698A YP_831092.1 378010 Selected-2007-05-11  ali  100  1MPEDVWLIALKNLDDDARAIKLGEIAELELAADQQDFAGDPLRMMLVALEEDSRVPYVVDSGGMAVGVLTLQRGAASLAGWADDESVWLLRGFLIDRRRQGQGLGTLAASAAVREAAKLTARLGGGEAGVVLSVNERNPAGQAAYRKAGFEDRGQYLGGNAGPQRTMYRAF 171
2 -63.600FN11145A NP_244671.1 379062 Purified-2007-07-12  ali follow..  28  1......MITLSFVEQQ----HLSVLCNFSLPPEQLPFTSLPVDALRACEEDPTRTPIVILADQEPVGFFVLHEGEATK-AYIEEEGLLLIRSLAIDEKQQGKGYGKKAMLLLPAFVTV----HWPNIRELFLVVNERNAAAKQLYTRVGFEDRGLRRVGPIGPQRILHYDL 156
3 -58.400FN11698A YP_612562.1 379954 Purified-2007-08-22  ali follow..  24  1MTSPRPQNTASPSLLPLSRSDHDLVRDIAVAPEQVVYCGTIAMAFASD--EAGVDFYAIQQAGRFVGFFKIDVKYPRTYNFA-RQGDLGLRAFMIDHRVQGSGIGSGALRVLPSLLRR----TYPKAQALVLTVNMRNHAALRTYLNCGFRDTGDIHGGIAGPQHVMRLPL 165
4 -57.600FL11145B NP_785245.1 376378 Purified-2007-04-13  ali follow..  18  1......MIQLVRYSTT----RGALKQIQQYQLVNVIYTATPQQVIRACKSDLERTAVMIMNGNQLVGFFCLHVGQGPLSYGETEVNTILLRALSVDDRFKHQRVASDALAELPRYLAS----HYPMIQTILLAVNHANHVAQHLYLTMVSLIRIA................ 141
5 -53.900FN4424A YP_830239.1 378976 Purified-2007-07-12  ali follow..  20  7..ASLRAVRLEMLSDTPTAY-------VESLTSAQAQTEGQWRSRAAAMTAPGSVTFVAEDSSRPNAFCALMRVVVKHPQEPDRPRQAMLISVYVAGPYRGSGLADELLGRSVEAAAGE-----LECGLLQLGVHEDNTRALAFYARHGFRDTGRRALDAGKKEIIMEREL 166
6 -53.700FL11200A SSUI_28JUL04_CONTIG262_REVISED_GENE1467 376383 Purified-2007-05-09  ali follow..  19  1......MIRLELVNKD----NFEAVLQVQLAPEDQRRVASVEYSLAQYKDSGMILPYAVVSGRKVVGFAMLSIETKD--------NSYYLWRLLIDKDFQNRGCGKEVVQQMIGKAKADP-----LCHKISINYVIGNHKMRYILEKFGFQPVGLD--GQKMKMELIIK.. 147
7 -50.200FN4507C YP_495698.1 379628 Selected-2007-06-05  ali follow..  18  1.......MTLRLATAA----DAAAIADLGRRAFIAKFDAHTAAKVSGELANPDMKVAVIEEDGRLASFCKIVRTSGLPRH-TAAKKPMELKQLYTDPDLIGRGHGARLMDWALAEARA------WGADEIQLSVYADNPQAQKFYRRYGLEKVADIVGDHCDPEFMFAGPL 170
8 -49.500FJ9522A YP_167293.1 370402 Selected-2006-06-19  ali follow..  15  1......MSTIRRACPA----DAAPLAALSIEIWLATYTTFTPTAMEALIAAPASTVLVADCAEGIGGYLHLRHDSPA----PAGNAQVEIDKLYVQPRHQAAGLGRALLQAGLAGLP--------PGTPAWLMVSSENDRALRFYRGRGFAHVGDTLNENAYLNHVFQIKA 166
9 -48.400FL11145A NP_372653.1 375932 Selected-2007-03-12  ali follow..  22  1MAKELCFITLKAFDEQ----YRSAINDFDLNERQQIYSSLPKEVIDDAINDVDRINVAINDKNEVVGFFVLHRYYQH-EGYDTPENVVYIRSLSINEKYQGFGYGTKIMMSLPQYVQG----VFPDFNHLYLVVDAENDNAWNLYERAGFMHTATKEEGPIGKERLYYLDL 165
10 -48.200FN12489A YP_289481.1 380104 Purified-2007-08-29  ali follow..  12  11.SGFSGVLRFRYIGPFQHTTIASHLEDLLGTVSAEESWRRRSRRYVEWLSEPETIAVIAESDGVDVGYAMVTIRDEHHGSWDRGDRVAVVQTLAVHPDYSLELVGSGLLDEVRRQLAE------TGVRDLELPAVSGNSAAIRFYESQGFRPFVTTMVSRIGVG....... 181
11 -47.900FN2031G NP_988304.1 379585 Purified-2007-10-04  ali follow..  12  1....MEKMVIRNARKT----DIDEIMNIEYDSFIDGI-SENRNVFLDRIATFQNGFLVLEVDSEILGYISSEIWEYSENIHKCNGSELYISSIGILKKHRKKGYGNLLFKELIEKISKN-----YKISSMILTVSVNWKPAIKLYEKNGFKEICRFEDEDSSDGIVMRKYI 175
12 -47.900FN11276A YP_807007.1 379436 Crystal|NMR-2008-11-20  ali follow..  20  1............MLREAQFIDLGAIVHLYQQETYRPLTSDNRQYFADYLQNDLARLFVTETAGTLSGFALVVLARTGDNAEFVPQHFAQLIDLYVIPAQRHQGLAKQLMDAVTAFAKS------HDATFIQLNVLNANQTAQQVYAKAGFEPVSLIL.............. 149
13 -47.600FK9311B NP_827962.1 371631 Selected-2006-07-12  ali follow..  16  1MSGRRAHMGMSVTISVATERDAEQIFRLQYLCGNYRIDPLVQSLESVRAEVAGDCVFVARLGDEVVGSVRGTV---------TEDGAASIGKLCVHPRLQGHGIGARLLRAAEAALAGE-----RGATRFRLHTGHRSEGNLRLYRRVGYETVGTSKGADGVPMIVLEKPA 165
14 -47.500FN12679A YP_461157.1 379837 Purified-2007-08-22  ali follow..  14  1MADEIEI-------KELSLEYYPEIVEIHRAIMKGKVSPSWMKSIKRHLREKDVGGYVALKDGKVAGIIIGQIQGPSF----GLEKSGWVTVVEAHPQFMGSGVGRALVESIFQYFRE------KGVKDIHTAVKWDAVDMLSFFIAAGFGRSAFINLRIKLDDVIP.... 150
15 -47.400FK2031C YP_718702.1 371721 Purified-2006-09-26  ali follow..  14  1............MISYIDEQDFAELFAI----EQKAHIVPWSLSTLKNNQGEHYLNLKKVVNGKIVAFAICHLVLDE----------ATLFNIAVDPDYQGLGLGKELLKELIQQLLE------RNIQTLWLEVRETNIKARQLYHNLGFNEVDIRKNGKRESAVVMALIN 145
16 -47.400FL11181A YP_012903.1 376360 Purified-2007-04-13  ali follow..  15  1MKRNYHVKFLNEKDVELAEAVCAASEDYYLMEQDKPASKSDALKIITEIRFDKFVLAVLDENEKPIGLVDIVSDY-------PRKGRWFIGLLLLTPDARHNGLGKVLHQTIKEWAND------GGADSLALGVLAENEKGRGFFEYLGYTKEETKYGGKEQEVSIFTLAI 166
17 -47.200FL0577B YP_426848.1 376298 Selected-2007-03-12  ali follow..  18  1MNEVITV-------RDAAESDAPSIARLFVQPDMESWQMVSHLVEAGDSPIGWPECRVAVMEDTVVGMVNAFPVERLDELSLDDAGSMLINAMAVSPTQRGAGIGRKLVGEALGMAGA------EGRKRVSLQVWSTNTRAIALYEDFGFQVTGEITRLSARRTLLMAREI 194
18 -47.100FJ9537A NP_349914.1 370418 Purified-2006-10-14  ali follow..  15  1....MLKISVKQMDYE----TAKQITKWNYEKPFSIYNMNESDECIKELLS-GYYFSAYDDKNYIVGYYGFGEAAQIPVGEQYSYKNITDIGIGLNPNLCGQGLGFDFFCCGLDFARNTL-----CAKDFRLTVATFNKPAIKIYTKLGFKKITSFKATGEIEFWVMTLCI 163
19 -47.000FN12563A YP_049837.1 379332 Purified-2007-08-07  ali follow..  12  1......MIRQNSATAE----DIACHLRACDDAFVRALEQRVEIAAYADKIARLAHCIEGWKNERLVGLVASYFNAQT--------KIAFITNVSVLTEAQGVGSGGILLEQCITKMQT------LGAIEIRLEVEESNQVARGFYLKHAFIQSEISGN............. 134
20 -46.700FN9700A NP_601374.1 379196 Purified-2007-08-21  ali follow..  13  3.......PIIRKLSIPEFTTNTPVLVDIYIAAMNYDKAIRDIEVWRRNSQNPGFTAVAALMDDQVVGVAYGFNGSPDHEEIHIIHNYFEVAEVHVQPGFQGHGIGRKLMHELLKDKQN------TFAILSTPEVDDEANHAFSLYRSLGFTDLLRQFRGDQRPFAVLITAL 182
21 -46.600FM11774A YP_677268.1 378106 Purified-2007-06-12  ali follow..  14  3.......IQIQKLSYRDIDSFIELLDVFEEVFEMKNFEMPSVEHLEELLGKDDFFVFVARSEGTIVGGLTAYSLTQY-----SKSPLLYIYDVAVMKRHQRKGIGKKLIMGIKDYCKD------SDIGEIIVQADEADEHAIEFYQSTGAKAAKVVQ.............. 142
22 -46.500FL10797B NP_979682.1 376393 Purified-2007-04-04  ali follow..  2......IQKLITTSHK----TATSILSIQIPAYEIEAKYPRLYDTVPDIQSCDEIFYGYFYEDTLAGFISFKIEKDE----------VDIHRLVVSPDYFHKGIATKLLLYVFDMFS--------PSKTYIVQTGKENTPALSLYKKHGFIEVKEIILPDGVVLTSLKKPE 150
23 -46.300FK9311A NP_638118.1 371600 Crystal|NMR-2007-03-15  ali follow..  14  1....MQTTTFRTATVD----DIDAIVALVTSAYRGDSSRIDPAVLRQDILRDRSLVLLVEQDGALVACAHVAD----------EDGAGYFGMFSVSPTLQGGGIGKTVLAEAERIAATE-----WALPLMRMTVIDVRNELIAFYERRGYRRTGVSKPGDERFGVPLRQDL 165
24 -46.300FJ9196A YP_001813965.1 369868 Purified-2006-09-11  ali follow..  14  1......MIHLEPATDS----DALALFELQVAAFSPLLANETIDRVYARIHHPTGCFLKIIADGQLVGAICIRW---------NEDVYFRISPLFLAPDAQGKGFAKQAMLLAEACYP--------QAETWELSSLFEETKTCELYEKMGYVEIGVRKSNGKATLIQYQKIM 155
25 -46.200FJ9523A ARTH_26JUL04_CONTIG45_REVISED_GENE3048 370403 Purified-2006-08-16  ali follow..  17  1VHSQILI-------RPAVPADFDAVARITRDA-ANADHPYMLQIQDVAKRAGQATIWVAERAGRIVGSVTLAVAGEPFAD-IALPDELEFRMLVVDPAVQRSGAGKAMVEAIIDHAKSL-----DGIRAVALTTGRTWESAHGLYRKTGFHRVPERVTDTDIKLLVYRLDV 167
26 -45.800FN12453A NP_812285.1 379094 Purified-2007-09-04  ali follow..  11  1MSITIHT-------EPLAYTEFRDFIISSANWFVPSLLQMPNLDEWILKMYHNGSMYYTISGSNIISLIVGYYNREE--------RFLYIPYVCVNPDHQGHGISKKTINYIIEHLST-------DIQEILLEVRKDNNNALHAYHKMGFYEAEDRDE............. 136
27 -45.800FK8799B YP_001095805.1 371707 Crystal|NMR-2006-12-15  ali follow..  1....MYTTSIEHH-TQLSDELIDTLIGLSQEVPEFD-GRHRAEDYQARLGGKTFLVQLIRIEGELAGYKIG---------YGETNGEFYSWLGAILPEFRQLGLAKALMQDQESWAKT------QGFNTLAVKTYNRFANMLQLLIQQGYKIAGLEAANIDDNKLVLNKLL 152
28 -45.700FM11685A NP_784136.1 377993 Purified-2007-06-19  ali follow..  13  6LQAQLPDFEIRLLTLA----DQEALLKLEQSPLTMTEVQHDLTAHPDELAAAQKQVFGFYLAHRLVAVLDVLNQY-------PQEQFLFVGLLMVNKAYQRKSVGRVIVTGLMQAALQ------ANITAIQLTRVTADEGVARFWQKLGFEDGNQLFAGGRLAVTTMTRLL 174
29 -45.700FK8799C NP_241866.1 371713 Purified-2006-09-11  ali follow..  13  3.......IVCNAFQSIPEKNVVAGILHLH-----EQIFGQKDNLLEKMERKPNILIFVALDRGHVVGYKIG---------YELDKQTFYSWLGGVDPNIRKQGIGSMLMERQHDYLRD------VGYKVVRTKTMNKWRNMLLLNIKSGFDVIETYIDDKGLHKIVLEKKL 146
30 -45.500FJ9311A YP_264977.1 370266 Purified-2006-09-12  ali follow..  14  5.HMNKNSVFLRQAEAD----DIGALEQLRITQDELASTIANPKHYLFVYPKTTTGERDADETGELLGCIAVDMKVNADSSKSVCPKKAYIGMFAVHPTLQGQGVGNVILQAAETFAEHHAQTPDENPARLTMSILSHRPELLSYYQRRGYQLNGNKMPRQDLELLELEKMV 206
31 -45.500FL11048A NP_744887.1 376283 Selected-2007-03-12  ali follow..  16  1MPIDFRPARIARFFQLTSEGMADYIWSKLAAPGETLLSVGASRYAREQGDFSYKNCLMATFEGRVIGMMHSYALRATPDRPVEIPDTLYISSLALDEAWRSQGLGAEFLRHAQQRADD------AGLDGLCLIDYAENHGARRFYERHGFQIVKTCQLGVTGEAYLMYRPT 189
32 -45.500FL11076A YP_810151.1 376327 Purified-2007-04-13  ali follow..  14  1....MAEINYQLIDGRMKIDRLNNNWSYEVEIFTHKRTAFPDERYHLQEINQNGFALGAYDDSNCVGLAIYQKHWN---------KYLYLKDLKVNRDHRKLGIGNQLIKEGLRRAVQ------LGYKGVYAVCQDNNLAACQFYLKIGFQIGGFNDFQSGKSDIYFYLDK 176
33 -45.400NC2031A BC009157 369516 Purified-2006-07-26  ali follow..  14  1......MTTLRAFTCD----DLFRFNNINLDPLTETYGIPFYLQYLAH---PEYFIVAEAPGGELMGYIMGKAEGSV----AREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISER------KGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIGEPDEDAYDMRKAL 156
34 -45.300FK9451B YP_001049773.1 371627 Purified-2006-10-14  ali follow..  16  1......MSDIQFVISE----QLEELALAAQLIDGRDDNAHPLDH--QVFFDSRAVILAKTLEGEIVGCAAIKAGKGT---------VGELGYLVVSPHYRRQGIAQGLTQKRIEVAKA------LGISILYATIRAENTSSQANLLKAGFQFWRDYLSSANVDAEAIMLSL 159
35 -45.300FN12534A YP_387288.1 379234 Purified-2007-07-24  ali follow..  14  1MQKTTQTPVVHMMRPHEAGAVCALIAEVFDEFVAPEYCAAGAAHFHTFVQPDGGMVFVAYMGDELAGIIEMR-------------VCEHVVMLFTAARWQRRGIARRLLDAALEECRA------LNGTVRRLTVN-SSPNAVPVYARLGFIADGPEQERDGIRHTPMTKLC 159
36 -45.300NC2031B BC057117 369548 Purified-2006-07-26  ali follow..  15  2...KGSRIELGDVTPH----NIKQLKRL----NQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQ------NQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDG-----TFDNIYLHVQISNESAIDFYRKFGFEIIETYKRIEPADAHVLQKNL 154
37 -45.300FL11194A YP_001813207.1 376376 Purified-2007-04-13  ali follow..  3.......LQFVPVTKK----DFPIIQSIFAENPHDRIYLLSDDELEEEFLNADTISLLCIDGDDVLALIDYLPEHPT-------DHSTWIGLFIMSERLHRQGIGSMIYRMFHEQYLQ-------DCPVIRLAVLPENVSGRRYWEHLDFRFERQGVSDCHQPVEVFLKIN 153
38 -45.200FL11201A NP_242449.1 376384 Crystal|NMR-2007-06-23  ali follow..  12  1.......MTIVHAEKK----DAKEIHSVLHQATPPTTALREAVSDIEQELTSGTQVLLYKHNDKCVGMVKFVV----------HDKQLYFFRLSVIPEARNQGIARRLIDHLMTLAKE------QKCATVVCKVRADMAQNVAFYESLGFANTKEEMDNARLNVITMEYKL 155
39 -45.200MA16029A 13436010 399821 Purified-2009-03-14  ali follow..  12  1MTEVVPSSALSEVSRLLCHDDIDTVKHLCGDWFPIEY---PDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRTKIHFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQ---DHCKAIYLHVLTTNNTAINFYENRDFRQHHYLPYGVLKDGFTYVLYI 181
40 -45.100ND2031A BC012731 369502 Purified-2006-07-26  ali follow..  15  2...KGSRIELGDVTPH----NIKQLKRL----NQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQ------NQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDG-----TFDNIYLHVQISNESAIDFYRKFGFEIIETYKRIEPADAHVLQKNL 154
41 -45.000FK8799A YP_926009.1 371706 Purified-2006-12-13  ali follow..  11  2..YSIKIQAVTELTLA----DAQTTAALMQQIPEFD-APVSAQALLERLGDAPALLLLCYVEDELAGFKL---------GYQKAPGAFYSWLGGVLPDYRKLGLAQQMLDVQERWATE------QGYNELSVKTLNRFGAMLAMLVQNRYQITELNGLPLTERKISLQKSL 152
42 -44.900FL2031C NPUN_22DEC03_CONTIG1_REVISED_GENENPF4049 376169 Purified-2007-04-13  ali follow..  11  1MSDETEAIYVRELGID----DIAPVYHLGEGLFTSDLYTWDEWEVIGLYNTDPEYCLVAETDGELAGFILGTIITKA------SWTYGYILWLGVSPKYQRRGVADKLVDKVVARMIE------DGARFMLVDTDPTNTSALKFFNRKGFGNTRQHIFGRLIDYEHQKAER 173
43 -44.800XB5514A NP_645455.1 358652 PDB-2005-08-01  ali follow..  2..............RTLNKDEHNYIKQISNYKCTKLSIALRYEMICSRLEHTNDKIYIYENEGQLIAFIWG--------HFSNEKSMVNIELLYVEPQFRKLGIATQLKIALEKWAKT------MNAKRISNTIHKNNLPMISLNKDLGYQVSHVKMY............. 143
44 -44.800FN2031A 17739732 378984 Selected-2007-06-05  ali follow..  13  1......MIVIRNAYEQ----EAEVLAAIGLRGITSTLYDNAASAFSNFTRSSWLTMRVAEFGGSVAGWAAR------------EHFDETITDFWIDPDFHRRGIGSRLLGDVERLIEE------KGFDAIRLETHAQNEPAVAFFRRHGYSVRWLSVSDREVQSVGLQKQL 157
45 -44.800FJ9526A NP_371350.1 370407 Selected-2006-06-19  ali follow..  1......MIEIKTLTNNDFNEYKRVNEEFTQDSHYSQTMTDTLIHDILNQGSPKCIVFGCYENETLIATAALEQIRYVGKEHKSL--------KYNFVTNNDKSINSELINFIINYARQ------NNYESLLTSIVSNNIGAKVFYSALGFDILGFKIGNTYFDEHWLFYDL 161
46 -44.800FN2031B YP_321430.1 379010 Crystal|NMR-2007-10-16  ali follow..  19  6.......LKLQSLTSK----DLSAILELDQACFGGLWTMEGYQRELDSPNSDLLGLFSPSSPIKLLGMGCFWSIVGE----------AHITILAVHPQYHHQGLGQALLYFLLRTASD------RGLERATLEVRASNEAAISLYQKFGFQTAGRYYQDNGEDALILWLPD 152
47 -44.800FK9639C NP_103617.1 371695 Cloned-2006-09-15  ali follow..  14  1MTINSS-IRFRPAEPADAAAIRDIVRSAYGKWVPVIGREPLPMRADYGKAVAEHPFELAVADGRIVGMIETML----------AGDHLWIENVCVAPQAQGKGIGRLLLERAEQKALE------AGRAELRLLTNGAFEANVLLYKRHGYTINREEP-FMGGMTVYMSKKL 153
48 -44.700FK9196A NP_979032.1 371687 Purified-2006-09-11  ali follow..  3.......ITLEQATES----DASVLFQMQIDSFSSLLHKESIEKTIFRINNPSSNFYKIIIDSRLVGAICISQ--------KELPYKFWISPMFIHPIYQGKGIAQKVIILIEGMFSK--------AQCFELATILEEERNCFLYEKMGYKRTEETKKNDKTTLIYYKKE. 156
49 -44.700FN2031E NP_279672.1 379394 Selected-2007-06-05  ali follow..  13  1.......MIVREATHA----DGDAVRAVANASLEASYADYDSDRLADRLDTDAVQYLVAERDDAVVGFSESER----------DGDVAAIQWLHVHPDARGDGVGGSLLSDTETHLLE------HGASRIEGRVLAANEPGNDFYQAHGYARSGTRIRDDTHTEHLYVKLP 161
50 -44.700FK2031A NP_826150.1 371679 Selected-2006-07-12  ali follow..  22  1................MRWWDIDPVFEMEKDLFPED--AWSRGMFWSELAHSRRRYVVAEEDGKIVGYGGLVASGEV----------GDVQTIAVDRDHWGTGLGATLLTELLRAATA------FECAEVLLECRVDNVRAQKLYERFGFEPIGFYYQPGNVDALVMRLQD 145
51 -44.700FK9451A YP_926959.1 371620 Cloned-2006-09-15  ali follow..  17  1......MTPILTISQASCDEDVVAAADLIDSRDD------NHHPLDRAALAKARLLLLARLDGRLVGCGAIKAG---------DGEVAELGYLVVASQYRRLGIGARLTQARIDWARA------QGIKLLWATVRAENQASRENLLKAGWQFYGDYIRGTGNTIGWYVLPL 146
52 -44.700FJ9119A YP_109194.1 370149 Selected-2006-06-19  ali follow..  13  24.....STLTVRRIAAD----QGGVYRELRAASLREPYAARAAAIAQQRAASDESTTFVLYTEGHPAGMIGAYFD-------GTPARRAFVSELWVAHAVRHLRGGVLLVNTARAWLAT------RGAGEIYAWIADQNRSAIRFYEHVGFADTGERRVPGAMKSLFVWREH 189
53 -44.700FM11882A NP_978592.1 378241 Purified-2007-06-12  ali follow..  13  2...........................ITFEKVTVENENVVKEMFRSHSLSEKQVQYCVKVDDTYIGVIDYRV----------QGETAILSQLIIHFDYQSYGYGTNTYFTFEMMMKE------RNVKEIKVLQTELTEPVKSFIESFGFNVEDGIY.............. 115
54 -44.600FN9639A YP_288862.1 380097 Selected-2007-06-05  ali follow..  16  3.......HTIRPMTAA----DRPRLVEVSRAADTLFARAGVHLPDDDPDDLFDQAAAVLVAGRPPVGFAALTVL----------DGAAHLEQLSVHPDYGRRGIGTALLTAACAYAQE------HGSPWITLTTFRDLPWNAPWYARHGFTVLPEPEWGAVLPRVVMRRRL 161
55 -44.600FK9742B YP_813530.1 371630 Purified-2006-10-12  ali follow..  17  1MTEETLVRKAESRDLEDIVAIIKDAKALLKAQNSSQWQEGYPNLASIEEDLDNRQGWVLLKDGQVAAYMAATDFDPNYEVPIGSAPYWALHRFAIKKDFRGQGLIQLLLKKVIAFGQE------NGIKSFRLDTGKQNQAVQHLADKLGFVYRGIITDSVDPERRAYELLF 170
56 -44.600GD11704A YP_001087313.1 388104 Selected-2007-09-21  ali follow..  11  1............MIRKANMNDLESIMKITYNNTQWDENYPLEKDFVSDIKKQD--LYIYEVDGEVAGFICLNYEEPEEYLWSSNKKAMVIHRMAVNPNFRKTGIASKLVDFAEKLAVE------NNVSYLKSDTYSINSKMNLLLTKCGFIKIGEMFLGKEKSFYCYDKIL 164
57 -44.500FJ9453A YP_511743.1 370386 Cloned-2006-08-25  ali follow..  15  7.SATLLLGQIRPYTLH----DRDAVERLNKRYYEDEHMSGALDQIGLAIQSTTGIGWVLIDNNEVAGSLFLT---------PERRGTGRIRLFFVRSDLQGRGLGAALMAQCLQAATP------LWFQTILVSTFTVHDAACALYLKSGFVQAQRSVFGRDLMQVDFVRSN 169
58 -44.400TM0577 TM0577 282450 Purified-2003-11-26  ali follow..  16  7LLKDGSLLLIREASIWDARRIVEYLKELITRPDEVYDVSTERNYIRMYRSNPGKLMIVGEINREIVSLLTFTGFGRKRTKHVGE------IGISVKKRYWNIGIGTRMITSAIEWARR------NGFIRIQLEVLKSNERAISLYRKLGFELEGIKRDGSFEDVLVMALLL 178
59 -44.300FN9434A YP_612546.1 379955 Purified-2007-08-22  ali follow..  12  12.SPRTCQPRLRKPNAT----DGADIWELV--RACEPLDRNSMYANLIQADHFRDTCVVAELDGDIVGWISGHI--------IPGEDAFFVWQVAVGEAARGMGLGKKMLKALIARDDI------RDASVLKTTITKDNAASWGLFRSFARDIGGELSDGAHDTEHMVTITL 172
60 -44.300FN12610A MMAG_12JAN01_CONTIG3848_REVISED_GENE2540 379564 Selected-2007-06-05  ali follow..  18  3.NIALAGCQLRPLAPG----DAPALAQALAAMDPWARLDYGAQALERGREDRALTRWVAEHDGGTAGILAL---------RSPWLRGPYIELFAILPGHQGLGLGGKVLDWAAKSAAEIAP-------NLWACVSDFNAPARAFYARHGFTEVAPLDGQAGMSEILLRKRL 156
61 -44.300FN9520A YP_055264.1 379726 Selected-2007-06-05  ali follow..  14  1......MATTRRATPA----DLPFMVHVLRHAAGGTSGPLDVEECRTNPATPDQVGLICLVDDTPVGAAWVRNLPASDPGYGFVAPGIPELVIAISPHHREQGLGGYLLESLLDTCSA------NGIKSVSLSVGVGVGWLVRVCRRVGFVVVSYR............... 148
62 -44.300MA16029B NP_001077070.1 399860 Purified-2009-03-14  ali follow..  12  1MTEVVPSSALSEVSRLLCHDDIDTVKHLCGDWFPIEY---PDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRTKINFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQ---DHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYGVLKDGFTYVLYI 181
63 -44.300FK9751C NP_638452.1 371671 Selected-2006-07-12  ali follow..  15  1....MTVSAPEPLTAHHRVEPFAS--------GVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGPIPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAAD----TIGIRGLLVHALSADAKAFYERIGFEPSPLD............... 148
64 -44.100FK9700A TFUS_04MAR05_CONTIG93_REVISED_GENE2046 371512 Selected-2006-07-12  ali follow..  15  1VETE---IEFWELAAPAFIRALPALMEIYAAAPPPRQLPGRQAIMRQHAHYPRFHSVVAVTERNAVAFAYGFHGCPGQGVRRWFADSFEVAEVHVLPEWQGNGIGRALLYRLLEPRRE---------RTAVLSTPTGATPAHGLYRSSGFVDLITFPGTVDQEFTIMAAQL 181
65 -44.000FK9700B NP_978754.1 371614 Purified-2006-09-11  ali follow..  12  1.......MEFLRIEND--EVLINNMAQLYCKAFEKTNFNEIIERMKRHVEYTDFKGIVAINENEVVGFTLMREALNLEQVEEWLQDCFEFVELAVHPQYQNEGLGTKLHNELLKRISN---------RTSVLTTQINNEKARSLYERLEWVNILEPPSKNDVPYIIMGKTL 169
66 -43.900FJ8821A NP_825984.1 370484 Selected-2006-06-19  ali follow..  17  1............MGGEASPRSLQDWRHVH----NTIIPAHVLSLDDVRERAGRNRLEVAYLDDVLVGCSTVRPPADAPT---PDAPATATVIARVLAAHRGRGFGGEMYERGLKHARA------LGAQVIETVVLSSNPDGLRFALKHGFAETERYLPGDTVPWIDLRLSV 147
67 -43.900FJ9515A AE010300_85 370395 Selected-2006-06-19  ali follow..  10  1MPKSKTKFQIANLLPEHREASIELVNQFFRLINSLQLGTKMIDVYLKLKGTGKVLLLGGFLGDELVSLLIART---EDKPYLEEQKTLFIDLAVTKRGKQKSGYMKPLVLACESWAKD------QEFKSIELRAIVENENAVSFWKAMGYDPFYIRFRKSFKMDSI..... 170
68 -43.800FJ9520A NPUN_22DEC03_CONTIG1_REVISED_GENENPR6335 370400 Purified-2006-09-12  ali follow..  13  3.......YSTRPLTQEDEPFLWQMLYEAAHLEKEGNLTVQDAINNPDLAKDDSGFIAILETSNQPVGSAWLRLLTGENKGYGYVDDQTPELAIAILPQHRNKGIGTQLLTHLLAAAQT-------SYSSISLSIRATN-PALSLYKRFGFEIILGSINRIGSISFKMKIDF 168
69 -43.800FN12435A NP_981174.1 379032 PDB-2007-12-11  ali follow..  14  1......MKNVTKASID----DLDSIVHIDIDVIGNDSRRNYIKHSIDE-----GRCVIVKEDNSISGFLTYDTNFF---------DCTFLSLIIVSPTKRRRGYASSLLSYMLSHSPT---------QKIFSSTNESNESMQKVFNANGFIRSGIVLDEGDPEIIFYTKKL 140
70 -43.800FN9751A NP_720396.1 379979 Selected-2007-06-05  ali follow..  15  2...............STNYIDCQLLNKMERQPSFSSFDSFAPKKLANADANNDSRVYVAVDGDIGVGYATMKVFMLSNDEYKILSPVVMLDQIAVDKAYQGKGIGKRLMRKVLEATVLV-----NELAAAKGLALWAHPRAKDFYESLGFEAIPDAVQDVELTLMFIHVET 169
71 -43.700FL11055A YP_012833.1 376297 Purified-2007-04-13  ali follow..  14  26LPEGYSFCFYKD-------GLEEDWCRLQLETGQVLSMDSIRARFETEFGNAKRCVFVEAPNGEIIGTAMLWDGNTF------GEMASRIHWVAVLDSHGGKGIAKALLSKILGLNKS---------SFVYLTTQTGSYQAIYLYQKFGFEKYVGKTVNFQEEKEAAWQII 185
72 -43.600FK2031B YP_107553.1 371692 Selected-2006-07-12  ali follow..  17  1MSTAIVSDDIA---RPFARADTDAALAVWRDSDASTPHRDPRRAIELKLATQPELFFVATAGGRVVGTVMAGY----------DGHRGWLYSLAVERGARRLGIGRALLAHAEAALAE------RGCPKVNLQVLPGNDDACRFYEALGYHEEAR................ 142
73 -43.600FN9533A NP_890805.1 379023 Selected-2007-06-05  ali follow..  14  1MPQSYIV-------RTMRPADVEAVLRVQAAVYPASL-LESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARR------LGLRRASLVA---LAPAVGYWLRHGYQPLADSDAGYGDGARYMVRAD 168
74 -43.500FJ9419A NP_821368.1 370345 Selected-2006-06-19  ali follow..  11  1MTVNVRHYGLDEIRETILDLHVEVRHRDFGLTGPFYDRDRFNERLSAYAARPGWSAALGYEDGQPVGFCFMKEPLPAETTHEDGHRTVSLNEIVVRKSWRGRSVAWQLHEAWLHGRTE-------ERVTLLVNPAAGNGAVQARYEAWGYRSIGLQQPPDSPVFAVMLRPT 181
75 -43.500FJ9525A MMAG_12JAN01_CONTIG3833_REVISED_GENE2184 370405 Cloned-2006-08-25  ali follow..  10  1MANPQTRQSERKCTRLAKAADIPQVIAIDLLERYNNRSTDVDDDTQPKSVKRYRFFLVACDGDAVLGFIIGEVRAWEF----GSPPCGWIFAIGVRNNTRQGGVGHVLLEALNDRFRK------AGVSKVRTMLARDDTLIMSFFRSQGMMAGPF---------IQFEKDL 167

FFAS is supported by the NIH grant R01-GM087218-01
6 0 3 7 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.