current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

376118
Query: FL10802A NP_978917.1 376118 Purified-2007-04-04, from JCSG1009

Results of FFAS03 search in JCSG1009
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MNRLNYIRQEEKKYHDLCYEQYKLFETGSWLYKPVKTVMDLMDYFEEKNNLQVLDLGSGVGRNSIPIAQKIQNTSGAVTCVDLLHSALTKLQTYSKEYGVINNIKTEQAAIENYYIQPNTYDYIVAVSSLEHVESEEDLKHVLHSMKKGTTNGGINCLIINSNIQEIDLHTNEELDALIEINLPTEDMIYLLKSIYKELast
1 -73.400FL10802A NP_978917.1 376118 Purified-2007-04-04  ali  100  1MNRLNYIRQEEKKYHDLCYEQYKLFETGSWLYKPVKTVMDLMDYFEEKNNLQVLDLGSGVGRNSIPIAQKIQNTSGAVTCVDLLHSALTKLQTYSKEYGVINNIKTEQAAIENYYIQPNTYDYIVAVSSLEHVESEEDLKHVLHSMKKGTTNGGINCLIINSNIQEIDLHTNEELDALIEINLPTEDMIYLLKSIYKE 198
2 -50.800PK0318D NP_243397.1 388919 Selected-2007-11-16  ali follow..  16  1......MRKMTGEEFDPLVSFFDGMAQASWL---RPVHDRLKKGTGSWANRAVLDVGCGTGRLLARGVHE----AAHLAGVDLSKQMVLATEERLHEHKQCGRLTVVQGDAYDLPFADESFDVCLSTCVMFLLPEPE---RGMKEMIRVLNGAGVIGMLNPTN................................... 147
3 -50.600FN12549A YP_517363.1 379271 Selected-2007-06-05  ali follow..  13  1......MNDKYTSRFITTSDAQDSMIFKLRSTWWSRFYEYAWAASFAEPEATVLDAACGISHPFKFFLSEN---CAHVYACDIDERILHPGSIIQEHPGYFERIHFSQANLAQLPYSESMFDTIFCISVLEHLDLP-TLRSALQEFKRILKQDGLIILTFDYPVI................................. 169
4 -50.400FL11253A NP_143189.1 375977 Purified-2007-04-13  ali follow..  12  6TDSTRGESMNLEELYKYLYWRMDPSDEIKRFQQIIEVFKKFRDSGLVPTEAKILDICAGTGIAGVAMAKVTK--AKTLTLLDARESDLKKSKDWVKIAGLELKPKLVVGDARNVAELVDEHDVAILWGLTMPHFDAFDAVKLFAGVASILSEDGVFLLEESDR................................... 168
5 -50.400PK0318E DHAF_12NOV03_CONTIG1070_REVISED_GENE2136 388925 Crystal|NMR-2008-06-11  ali follow..  16  2........AIINDYWSTQAEAFTEIVDELTSEKNALWKSILKPFVQTDRKLEILDVGCGAGFFEIFLSCL----GHHVTAVDFNGKMLAEARKNIEKLGRPELTKLMQMDAQNLAFQDSVFDIVISRNMTWVLENPQ---RAYGEWLRVLKPHGKLINFDAN.................................... 149
6 -50.100PG2288B NP_600671.1 372498 PDB-2008-03-05  ali follow..  11  1MTTWKELTDNNPAHSENYAQRWRNLAA----AGNDIYGEARLIDAMAPRGAKILDAGCGQGRIGGYLSKQ----GHDVLGTDLDPILIDYAKQDF------PEARWVVGDLSVDQISETDFDLIVSAGNVMGFLAEDGREPALANIHRALGADGRAVI........................................ 144
7 -50.000FP0318P NP_281009.1 383367 Purified-2007-12-08  ali follow..  11  10..GVHATPMSVREEFDEWAASGR---DKGMEDRHWHTAKDVLARMPVEDDDTVLDLGTGSGYAVRALRER---GVARGYGLDGAPEMAANARTYTDD----DDLAYVVGDFGSLPFADDAIDHVFSFEAFYYAS---DPRETLAEIRRVLKSGGTFYCGVNYYEENVHSHDWQDSISVEMTRWDRATYREAFRGA... 189
8 -49.800FP0318I NP_279815.1 383201 Selected-2007-08-07  ali follow..  15  1MNT-APDTGTERATYTWSAGRYPSLAPNL-----LPAIARLVSACGVDPGNTVLDVGCGTGNAALTARRA----GATVTGLDVTRSMLELARDTTQLTDY-NDISWVAGDASTLPFPDDAFDVVLSSFGHVFSP---AAAEAGREMLRVAQPGGRVAFTAWSPDG................................. 151
9 -49.700FL10676A NPUN_22DEC03_CONTIG1_REVISED_GENENPR5695 376020 Purified-2007-04-13  ali follow..  13  44.SNWDERLGQIAYRFNREYQRMPIFREWIGGSFSGRIASPFWEIAQPQKNQHCLDIGCGISFLIYPWRDW----QAFFHGQEISNVARDTLNSRGPQLNSKLFKGVELGAAHQLNYSPEQFDLAIATGFSCYFP-LEYWNAVLAEVKRVLKPGGHFVFDILN.................................... 210
10 -49.500FN0318N MMAG_12JAN01_CONTIG3797_REVISED_GENE1488 379559 Purified-2007-08-07  ali follow..  12  12MRDILRSVNPFPGRWSFITSVEYMLDSRLYVDSIGDD-AKVVRATLGPHDRNILDFGTGSGVFAIALRQVLP--ELDISAVDTTDNKSQSHPDFSDGQAAAFRISFNHYNGHLLPYPDGSFDAISAYAVIEHIPH-EELDAAMREIARVLKDDGKLFVFKMPRKLALVEHVAGILGLGRHDTLYGDGEALRLFR.... 213
11 -49.100FN0318R NP_988299.1 379580 PDB-2008-06-27  ali follow..  16  1......MSENKKKFDKKGAKNMDEISKTLFAPIYPIIAENIINRFGITAG-NCIDIGSGPGALSIALAKQS---DFSIRALDFSKHMNEIALKNIADADLNDRIQIVQGDVHNIPIEDNYADLIVSRGSVFFWE---DVTTAFREIYRILKSGGKTYIGGGFGNKELRDSISAEM....................... 162
12 -49.000FN12476B CHUT_08NOV04_CONTIG199_REVISED_GENE563 380174 Selected-2007-06-05  ali follow..  11  5................................SNINMTRQTIKTLELSANEEVLELGHGNAGHLQYLFEIEK--TVRYYGLEISELMHAEAKQINKSFADHKQAFFFMYDGMDMPFGNDYFDKGYTVNTLYFWE---EPVKMLQEIYRVMKPEGIFSIGFAQK................................... 130
13 -48.900FN0318Z YP_462820.1 379847 Purified-2007-08-22  ali follow..  14  3..................ISRYDEIARGVNAPIYEYYARKIKKETAVVEG-VCLDVGSSGGYLGLALARI---TDLEFIFLDVSADALESAKLHIIEDGLQERAKTLLADVHCIPLADGSVNLVISRGSIPFWQ---EPAKALSEIYRVLTPGGAAYVGGGRGAPEMQALIRQEMARLGIEWPEMPGHTGGSGEGGSG 175
14 -48.800PJ07021A YP_320284.1 374157 Crystal|NMR-2007-05-25  ali follow..  18  1MK--KQNIAGFSKVDDTANPQVSYLDAISSLNSIQKYKQQTFTRLEIQAGDRILDVGCGIGDDVRSLAVKVGNAG-EVVGIDRSETMVKEAQSRSADLGL--PVAYYVGDAEKLEFPDCTFDACRSDRTFQHLLNPR---QALTEIVRVTRCGGRVVVSDPD.................................... 156
15 -48.800FJ8791A DHAF_12NOV03_CONTIG1087_REVISED_GENE3542 370125 Purified-2006-10-14  ali follow..  14  18........................LKAAMMGPNAMRLAEELSSHLNIDETMRILDLGCGCGLSTLLLTKKY---GASVFAADLWISPTENYERFQSLGIADKAVPISVDATKGLPFAKGYFDLLFTVDAYHYFG---DTAAMLPSLIPFVKKGGYIAVAIPGLNYEFEDKVPDEMQPFWNSEMARTHSLDWWKDLWKK 186
16 -48.700PU0318B YP_833290.1 381535 Selected-2007-07-06  ali follow..  17  1MSAQQPEDVYTHGHHESVVRAHA---------SRTAENSAAFVIPYLTPGTSVLDVGCGPGSITCDFAGLVAP--GQVTGLDRSPDVIAHAAALAAERGV-ENVGFVAGNIYDLDFDDETFDVVHAHQVLQHLTDPV---EALREMRRVAKPGGIVAVRDADFHGMSWYPAVPELDEWMELYQRIARRNRRLVSWAQA 190
17 -48.600PC07021D NP_254144.1 361395 Selected-2005-10-10  ali follow..  14  1MIRLQRWRSRPAAASEPVSPRMCGLRDAVLDGWFRSETGELLAGFAIGAQDTLLDLGCGEGVATLFAARQ----GASVIFTDSEEDKVRSLAQQVEAVAR-RPFTGLVSDSDPLPLRDACADKLVCMEVLEHVANPA---RVMAELVRLGRPGAQYLLSVPDPVGEHLQQGIAPADYFRAPNHIHIFSRDDFARLVQD 192
18 -48.600FN2288C NP_637046.1 380139 Selected-2007-06-05  ali follow..  14  1MSATNEQLLETQRAFDSVAADYDGPRGNNALIQRMRTTLWDTVATELPVGSRLVDLGCGTGLDAGEFASR----GYSVLATDWSPAMVARTRERAARQGLEERLTAAHVGIQQLERLEGEFDGMYSNFGPLNC---PDLPAVAAECARLLRPDGCLVFSVIGR................................... 169
19 -48.300FP0318M NP_347180.1 383316 Purified-2007-10-18  ali follow..  14  26LGDDEMDLEEMSSFFNKRVNEYEEHMMNN-VGGANQYYIETAKLIPRGKEINILDLGCGTGLELDEIFKINN--TVRVTGIDLAENMLRKIKEKHKDKL--DRLTLIVGDYFSCDIGEKVFDAALSVETLHHFNH-EQKIKLYKKIVRSLKDNGVYIEADYMAPN................................. 184
20 -48.200FP0318N NP_391868.1 383342 Crystal|NMR-2008-01-03  ali follow..  21  2.............ITAEECRTYKEFVDLYQSYLYPLLGARLSR-MYSPKNKVIIDMGTGPGYLSIQLAKRT---NAHVHAVDINPAMHEIAQEEAKKSGVSSLISFDLEDVHHLSYADQYADFIVSYSCLHHWE---DVVKGLKECYRVLAPGGKIVILDTFNPQGSHLEIMRKQ-------IKEPEYFRFVREAFEE 172
21 -48.100PG10010A NP_888589.1 372787 Selected-2006-09-08  ali follow..  10  17......TARAANADLNARYIPLLPVNQRIQHERDRALAYMLRQHLSVPPQARVLEVGCGSGSNLLDLIRLGFD-PANLMGNDLMDSRVEQARHR-----LPQAVPILAGNALDLDLEREGFDVLYQSTVFTSILDAQARRDLAQRMWHWTKPGGGVLWYDFAYNN................................. 170
22 -48.100FN0318AB NP_823056.1 379879 Selected-2007-06-05  ali follow..  18  1MSKSQETAVYTHGHHESVLRSHT----------RTAANSAAYLLDSLKPHMKILDIGCGPGTITADLAALVP--DGRVTGVDHAPDILEQARATAAGRGL-RNVEFAVADVHALEYPDDTFCVVHAHQVLQHVGDPV---QALREMRRVTRPGGFIAVRDADYAA................................. 150
23 -48.000PG0318D NPUN_22DEC03_CONTIG1_REVISED_GENENPR2814 372533 Purified-2006-10-27  ali follow..  11  93....QAAFEVEPAAYAVHSKVVEGAEEAQGDPMLRQSYHNILKSQIPNEPQDILDVGCSVGLSTFALQAVYS--QAKIIGLDLSPYFLAVANYRAQQRQA--KINWLHAQAESTGLPDASFDLVSIFLMCHELPQS-ATRQILAEMRRVLRPGGYLAIMDMNPKS................................. 248
24 -48.000FN0318V NPUN_22DEC03_CONTIG1_REVISED_GENENPF3654 379660 Purified-2007-08-07  ali follow..  14  28....QLNNTQHKKTWDAIGKTYYGSQKIEKLADTSPIKQDYTKFPLNKSVGSILEIGSGYGRAPLHLSKAKNLRCEKYYGIDISEPLLRRLIKVKQEYNFFPEFNLICTSAEILPLEDNSIDLVISNCVFMHIPDAQ-LRSLLADISRVLKPGGIFVFNHSFHNKSCPSHIIHNFPFVRNPVYLKQYSSAEINEMLAS 238
25 -48.000MA16094B NP_001005372.1 400365 Cloned-2009-02-26  ali follow..  14  1MEEQHKCSSKSLEHKTQTPP-----VEENVTQKISDLEICADEFPGSSATYRILEVGCGVGNTVFPILQTNNDPGLFVYCCDFSSTAIELVQTNSEYDPCFAFVHDLCDEEKSYPVPKGSLDIIILIFVLSAIV-PDKMQKAINRLSRLLKPGGMMLLRDYGRYD................................. 161
26 -48.000PK4030I YP_001050431.1 389077 Purified-2008-06-18  ali follow..  17  1MHQNTNVDPQEIAKFERMAETWWDLNGEFKPLHLLNRLNYIDQTAGGIFGKKVLDVGCGGGILSESMARI----GAEVDGLDMGDEPLEVARLHALETGV-SINYVKNTAETHSQDHQAYYDVVTCMEMLEHVPDPQ---SVIKACCDMVKPGGFVFFSTINR................................... 157
27 -47.900FN0318I NP_420653.1 379185 Purified-2007-07-24  ali follow..  13  1...MRSIRKMSDGGWKNSAKAWIAMGEQGDYGRRYVLDAPMIARLRRLNGGRALDVGCGEGRFCRILRAE----GFDPVGLDPTVELLEAARARD------PGGTYVEGRAEDPAFADASFDLVVSCLSLIDI---EAADRAIAEMARVLKPGGTLLIANLT.................................... 147
28 -47.400FP9120A NP_294154.1 383370 Selected-2007-08-07  ali follow..  16  3ITTLEELLEALDELFDDGSDLTRRGAQDPWLPDACLVDWTRQGLLPSGDGLTALDLGCGLGRNARWLARQ----GYAVTGLDLSPYAVGQARERTPGPD----IRYLEGDVLRDPIPGGPFDVVYDSGCFHHLPPHR-RLSYLHTLGQVLRPGGWFGLCTFAWGRMGSAKSDLELLRQGQLEGGVGYTLDDLREMFGG 205
29 -47.400FN0318T YP_496556.1 379615 Selected-2007-06-05  ali follow..  12  1...MTNIADWEGGVGRNWAAQWRRTDATF-----AQLTPRLLNAIAAEPGRRVVDIGCGAGEVSLAVARARP--QAQVIGVDVSPDLVDAARGRAGALP---NLSFELADASSWTSPQGAPDLYVSRHGVMFFPDPP---AAFAHLASVAAPDARLVFTCFRAAK................................. 149
30 -47.300FP3845A NP_662628.1 383071 Purified-2007-12-08  ali follow..  10  30.YKLDVNIANVNEVYDGAGGIWEMLMGEQIHVGAEAETDVLARKAGVTAETHLLDVCSALGGPARYLAKNY---GCRVTGLDATQRMHAEAIRRTIEAGLSGKIDYVLGNALDMPFPASSFDVVWGQDAWCYIT---DKQRLIGECARVLKPGGVLAFTDWLEAGPMTDEELTALNT--FMVFPYMETLDGYAMLAEQ 219
31 -47.300FP0318H YP_465314.1 383175 Selected-2007-08-07  ali follow..  16  1MSQETLNPQARQMADESMFRNLAAQASAIW-----PQEAPLFRRYELPPGARILDAGCGTGEITARLAGLFPQ--ATLLGVDVLEPPLRVARARHGALA--PRVSFAQGSVFHLALPDREFDLTVCRHVIQAIPHPE---RALAELVRVTRRGGRIHLLAED.................................... 150
32 -47.200FJ0318A YP_165123.1 369556 Selected-2006-06-19  ali follow..  15  2......ELNAVKSSYARWAPIYDKTFGAI----TNVGRHAAVDYINAHDATELLEVGVGTGLSLPNYRP-----GLKVTGIDFSEEMLAKARAKVESLGLGHVQSLRQMDARDLDFADASFDVVAAMHIISVVPEPE---RVMAEMARVCKPGGLIVITNHFARD................................. 148
33 -47.100FK9217A YP_001021613.1 371426 Purified-2006-12-13  ali follow..  11  8.TLEKGAGMQSKAHWERVYTTKAA-TGVSWFQEHARESVRLIAQTGAAKDAGLIDVGGGASTLVDDLLCGGYS---NLTVLDLSEAALSTAKLRLGSRAN--EVTWRVGDVTRVDLPRHAYDVWHDRAVFHFLTQREEREAYVRAVLHAVRPGGHVIVATFADDG................................. 165
34 -47.100FJ9217A NP_253491.1 370214 Selected-2006-06-19  ali follow..  16  2.........SEREHWQRVYESKPS-DAVSWFQAEATLSLDLIRRIGAPREAAIIDVGGGASTLVDGLLAEGFG---DLTVLDLSDAALRVARNRLGARGE--EVRWIAGDITGVDLPEATYDVWHDRAVFHFLTTAEARRAYVRQVMKAVRHGGHVIVATFAADG................................. 151
35 -47.100FL3388A YP_324297.1 375706 Purified-2007-04-04  ali follow..  11  25IKTTMTYLETAAQFYSEVAQTPQVLKIPLSMQEMNYGCGTTVHPTELGKQPTVLYVGVGGGLEALQFAYFSRRPG-AVIAVDPVAAMREAAARNLEMALTDNFVEIREGDAFNLPVADGSVDIVAQNCLF-NIFEPEDLTRALKEAYRVLKCGGRLQMSDPIATSPIPAHLQQDERLRAMC-LSGALTYEEYTQRIID 239
36 -47.000FK0318E NP_106473.1 371071 Purified-2006-12-13  ali follow..  13  3....SSFEVETRTVFDRYQRQQENDDHIFDRLVSLIEEEYFGLPTGSFRGLDVLDAGCGSNANASWAFLDKG--ARNVVSLELSNDWMDCARKRLSRFGL--RSELVAGSVLDLPFDDFSFDFVHCAGVLPHTSNPK---KGFEELARVTRPGGSFFLTIMGTANGVIYRCINHLRELYQSDEQFRSSIDNLDA.... 185
37 -47.000FN0318F YP_001637164.1 379161 Purified-2007-07-18  ali follow..  12  65.AQVVNEVPVAAWAYERTWRPFALSLLSGEQFPLTRELKLITGLAGAERGGLMVDVGCSNGLYARALEHVRRQRGGFVVGIDLSMAMLQEAQRRARHEGL--SISFIRASAQAMPFADGTVDALVMGGSLNEIG---DIPAALSEWRRLLSPQGRGVMMSLVAASTPIGQGIQQLLASGGLQFPSLAELNHYFT.... 254
38 -47.000PG9987A NP_394203.1 372665 Selected-2006-09-08  ali follow..  12  43............................................IDQDADMNIIDVGCGLGFLTILCADYFK--NSRITAIDTFSMSRERLIENLRLADVLDRVTVVEADITKPFNIEDKFDLAVSNLVFHNTG--RQRFSVYRNVWNVLKCGSYFINADGFIRKNVA.............................. 168
39 -47.000FJ9113A NP_637295.1 370143 Selected-2006-06-19  ali follow..  1MPLINLNPTSSADEWDRKWTQIFDRY------QHDRRHAHYIHALLERDEHSVLELAAGSFRDMASLRSM----GVNCSGMDFSMESVQRAKQAFPQ----FATHIARMSAFEMALPDRAVDVTYHNGFWVLFSD-DQIQTLAREQARVTAHRMIATVHN...................................... 145
40 -47.000FP0318W NP_987617.1 383460 Purified-2007-11-03  ali follow..  16  25.KYKSWLSGAFSFLYDPLMSKSVFPKTLGASMEKHE--LFLKNELNFIHNKEILELGTGSGNLSQILPN-----DNKYSGIDISKGLLKIARKKFYKAGFNKNFKLFLCSAEELPFKDNFYDVCIFNLSLNFFN---DLDSVISELKRVLKPDAKFICSVPIKDR................................. 178
41 -46.900FJ9231A YP_679605.1 370231 Purified-2006-08-16  ali follow..  13  1...MEQINEKNFNFYNRIG--LDTFQALAKDGGFSTFVDLEIAYRYIQPTENIAEIGAGYGRCIDFLLAK--KHQGKIIAVEQSPKLCEHLRAVY-----SSTIKIVEGDIYKVSFDHQIDAALWMWSGMIDFSVE-EQAAVIKHIHELLTQKGKLFIDIPRIGIKTIADHIDQQRIKLTTDFGEIECYIPLSSEVKE 185
42 -46.900FP4030Q NP_718003.1 383393 Purified-2008-01-04  ali follow..  16  1MQQNTNVDPQEIAKFERMAETWWDLNGEFKPLHLLNRLNYIDQTAGGIFGKKVLDVGCGGGILSESMARI----GAIVDGLDMGEEPLEVARLHALETGV-SINYVKNTAEAHREDHREYYDVVTCMEMLEHVPDPQ---SVIQACCDMVKPGGFVFFSTINRNV................................. 159
43 -46.900FP4030N YP_719374.1 383380 Purified-2007-12-06  ali follow..  16  1...MQNLDPQELEKFEKMAKSWWDPNGDFKPIHQLNRLQYIQQQANGLTEKKVLDVGCGGGILSEAMAKQ----GAIVTGIDMTVAPLEVARLHAKEQGLVQQITVEEFLQKQTALYAEKFDVITCMEMLEHVPDPL---SIIQSCRALLKPNGVLFFSTINHT.................................. 159
44 -46.800PK4030J YP_001183591.1 389132 Purified-2008-01-26  ali follow..  17  1MQHNTNVDPQEIAKFERMAETWWDLNGEFKPLHLLNRLNYIDQTAGGIFGKKVLDVGCGGGILSESMARI----GAEVDGLDMGEEPLEVARLHALETGV-NITYVKNTAEAHSQDHQGYYDVVTCMEMLEHVPNPQ---SVIKACCDMVKPGGFVFFSTINR................................... 157
45 -46.800PU4016A NP_106341.1 381600 Crystal|NMR-2009-05-11  ali follow..  17  2.................................EPEASPLFIDFAGISAGEKILDVGCGTGSLTFALLKAADL--KEITAIDDSPVFVAETIRRSTD----PRIKVEQGDACALAFDDGAFDRALALLVLHFVT---DAGKAVAEMRRVVRPGGVVAASVWDHLG................................. 124
46 -46.700FL11259A YP_324635.1 375987 Purified-2007-05-09  ali follow..  20  1MTQLKTLPIYDPTLFEGAAEVYAQYRTKY----PPAVFDKLTEIFNLNGQGRLLDLGTGPGLIAIPLSTK----FQEVVAIDPDPEMLKEAQRQAATAGA-NNITWLEQGAELINPSLGVFKLATIGRAFHWM----ERQLVLERLYELLADDGAIALLNTGD................................... 150
47 -46.700PK0318F NP_267336.1 389116 Selected-2007-11-16  ali follow..  14  2AQKTHDYERESEDFYDHIASRFDHSFDGFL---ASFFKRFIIKRLKVEKNSSILDVGCANGNLLAMLNRK---EKIFGSGLDISSEMIKIAQVKH------PNFTFKQGTAQKIPFEDANFDLIICSASFHHFPLPE---LFLAEAKRLLAPEGKLVIAEIHIP.................................. 150
48 -46.600FJ9254A NP_978915.1 370258 Crystal|NMR-2006-11-12  ali follow..  15  2............EFWESSFIEKQ----TMWGFEPTESAILAKDFFLEKNVKDILVPGIGYGRNAKVFIEN----SINVTGIEISKTAIDLARENGLE-----DVSIYHGSVNEMPFDNKLYDGIFSHALLHLLN-DQEREGFIENCYNQLKPGAYMVFTTVSKKAPMYGKGKQLDKDYYEIMEGVKMFFESIKKDFNQ 176
49 -46.600PG4030F NP_104543.1 372690 Purified-2006-10-26  ali follow..  15  1MPEPRRIDAGEVERFSALAAEWNPVRLSYIRDQIAARFGRDPRAARPFEGLRILDIGCGGGLLCEPMARL----GAEVVGADASETNIEVAKLHAAEGNV--IVDYRATTAEDLADAGETFDVILNMEVVEHVADID---LFVAKCGQMVRPGGIMFVATINR................................... 169
50 -46.600FN2288H SBAL_17SEP04_CONTIG225_REVISED_GENE2047 379907 Purified-2007-09-29  ali follow..  12  2..........SIAFYNGHAVTLSAQYLSKTFEEVHSSWLHHLLPILARDKLSILDVGAGSGRDVHYLAKKAQSKETQIFAIEPAIALAKMGQVLTRDLPV-RWIEDSLPQLQKVVGLAQQFDLILLSAVWMHLS-PSERPLALATLSGLLNSTGLLVI........................................ 147
51 -46.600FN0318B ROSE_TM1040_30MAR04_CONTIG44_REVISED_GENE276 379947 Purified-2007-08-22  ali follow..  17  32.....AASSKDAAFWSKISRKYAADPIR---NMDGYLQTLDRTKSYLKPEDHVLEIGCGTGSTALLLAPH----VAHITGTDLAPGMIEIAAEKRAKEGL-ENVTFKVAETLDHNPQDGAYDAILAHNLLHLLH---DLDQSLQRIAALTKTGGVFISKTVCAPK................................. 180
52 -46.500FP0318K YP_509964.1 383240 Selected-2007-08-07  ali follow..  15  4...............EYDDAAAERLEAVYLGPDVVSQRDNTLQRISVQEGERVLDIGSGPGFLAAQIADQSGPDG-EVVGIDISEQMVDRATQRSEHSW----LSYRCADATELPFEDSYFDVVVSTQVAEYVP---DIAKFCSEVFRVLKPGGRALILATD.................................... 142
53 -46.500PG9806A NP_721731.1 372159 Selected-2006-09-08  ali follow..  12  4........HYLIKQAKKPSGAVGRVITKIWSSYFKDLSLWVIRQTAISDNSRILEVGYGGGSTIKNLIALGK--NLEIHGIDISKESYQTTKRINRESVQNGSVQLKIGSVEALPYQNQYFDVVFAIQTHLFWK---DLKKGFQEIYRVMSSHSILVVAS...................................... 150
54 -46.500FP4030J YP_750815.1 383366 Purified-2007-11-14  ali follow..  15  1MSHAPNVDPLEIAKFEAMAQTWWDLNGKPLHLLNPLRLNYIDQTADGIFDKKVLDVGCGGGILSESMARL----GANVDGIDMGNEPLEVAKLHALESGV-TVNYLKTTAEAHRDNHREYYDVVTCMEMLEHVPDPQ---SVIQACCDMVKPNGFVFFSTINRNM................................. 163
55 -46.500FP9827A YP_102821.1 383056 Selected-2007-08-07  ali follow..  19  1MSSDTAPQSAPQNIYDSFFEGYRTLRQGDTGLNGALESPAMKRLLPNLAGLHVLDLGCGFGDFARYARAH----AASVTAVDVSSRMLEEARARTDDGA----VTYLQRSIETYHAATRAFDLVVSSLTLHYV---EDYAGVVARIYDALRSNGRFVFSV...................................... 154
56 -46.500FJ9208A NPUN_22DEC03_CONTIG1_REVISED_GENENPR5288 370203 Purified-2006-09-12  ali follow..  12  1...MATEIIYMVKDWFEWHDLYKNEPKLQQRLQIVQEYISYSLNLPEPGLIRVVSVCAGDGRDLLGTLSNHPRKDVYARLVELNPHLVERGQQTIESLGLTKQIEFINGDATLSSNGAVPADIVIVCGVFGNLADEAELNRLLANLSFLSKQGAFVIWTR...................................... 160
57 -46.400PK4030B YP_102250.1 389258 Purified-2008-01-18  ali follow..  20  1MTNAD---PHELQKFSDLAHKWDPNAEFKPLHDLNPVRLSWIDAHAHLPGKRVVDIGCGGGILSESMASL----GAQVKGIDLATEALGVADLHSLESGV-SVDYEAIAAEALAAREPGAYDVVTCMEMLEHVPSPA---NIVAACATLVKPGGWVFFSTLNRNL................................. 155
58 -46.400PG4030G YP_299130.1 372769 Selected-2006-09-08  ali follow..  16  1MT--PATSATSAQAFDAMFEQDDPWGFETLWYE-ARKRALLMAALPEARYARALEAGCANGILTEQLAGR----CDALLAIDVAARAIDRMQTRLAGHS---HVEGRVARLPQ-EWPGGSFDLIVLSELGYYFTPD-DWIATARQAVGALTPRGTIVACH...................................... 148
59 -46.400FJ8769A YP_324782.1 370100 Purified-2006-09-14  ali follow..  17  49LGHKDFDWEQATAFYRDKVGEVYLFELGAWHLASHDYIGDTLRLIADHAHGCVLDFGGGIGTHAIGAALC--PHVEQVVYCDINPINFDFVKYRAEKLG----LSEKIIFCVEIP-PQKTFDTIMSFDVLEHLPDPS---QQLLEFHQILADEGKMILNW...................................... 198
60 -46.400FJ9253A RRUB_10JAN05_CONTIG98_REVISED_GENE2629 370257 Purified-2006-10-14  ali follow..  13  1......VKTNLEHWVTLQEKGYFENHPFYQERQVNDDAARVEKATPLTKDMKIAIIGCGYGRESASFCRR----VRKVYGIDVSWTILAKALERMLADNH-VNFTPVLASQWKTILPDGGLDLVYSVVVFQHLTRDL-VDDYIGGLKGKLRPGGRFYV........................................ 146
61 -46.200PC07021A YP_001019814.1 361050 Purified-2005-12-17  ali follow..  13  1.................MSDVYDYLKESLPGDHSRQATAEAVRVAKGFAPAKVLDFGCGDGRSIDLFRRMLP--QVDWTGVDIEASPEVASRRRQ-------DGRFVTYDGYELPFPDRSFPLVYSHQVLEHVRKPE---LALREIARVLEPDGLFIGQTSQFEP................................. 139
62 -46.200FP9827D YP_103731.1 383358 Purified-2007-12-08  ali follow..  15  2..........TQNIYDDFFEGYGQLPRSRDGLDGAPEWPSLRAMLPNVAGRRVVDLGCGYGWFCRWAAEQG---AARVLGIDVSARMLDRAREMTTSPA----VRYERADLERLSLPSASFELAYSSLAFHYV---EHLPALFGAIGRALVPDGRLVFSI...................................... 143
63 -46.200FN3388A YP_315186.1 380087 Selected-2007-06-05  ali follow..  18  73.......................................NPQAIAALQSGETVLDLGSGAGFDAFLAARQVGAEG-SVIGVDMTPDMVTKARANAVKGGY-ANVDFRLGEIEHLPVADATVDAIISNCVINLSP---DKVQVFREAFRVLKPGGRLAFSDIVTTAELPEAMQREVALYTAC-VAGAASVDELTAMLAD 225
64 -46.100FP9827E ARTH_26JUL04_CONTIG29_REVISED_GENE654 383391 Purified-2007-10-18  ali follow..  18  2..........KANHYDDFAEYYAAENEASLLNA-YYERPAMIGLAGDVDGHRVLDAGCGSGPLSAALSAK----GAIMTGFDSSPAMLELARQRLGATA----DLYVADLSKPLPFADGSFDDIVSSLVLHYL---QDWSAPLAELRRVLKPGGRLILSV...................................... 139
65 -46.000PK4030A YP_562955.1 389212 Purified-2008-01-26  ali follow..  15  6HTTQANVDPAEIAKFEAMAQSWWDPNGEFKPLHQLNRLNYIDSTAGGIFAKKVLDVGCGGGILSESMAKL----GANVDGIDMGEAPLEVARLHALESGV-MVNYHKTTAEAHSASHANHYQVVTCMEMLEHVPDPQ---SVIQACCDMVEPGGFVFFSTINR................................... 162
66 -46.000TT0318A YP_463428.1 403899 Selected-2009-08-14  ali follow..  33.......ELSGRGPYAEDVRRRSTPSLMPLVYPHYLEPLLEEVRARTGAPPRVLDAGSGPLSMWAHGA------EQDRIALTCSDALADAYRELLARHGLRPPLVQCAGEALSARFGEAAFDVAWMHNALDHTQDPG---AVVRELVRVLAPGGYLVVQGWCREG................................. 183
67 -45.900FP3845C NPUN_22DEC03_CONTIG1_REVISED_GENENPR6023 383136 Selected-2007-08-07  ali follow..  15  1MS--ATLYQQIQQFYDASSGLWEQIQKKDRRQAQIDLIEELLNWAGVQAAEDILDVGCGIGGSSLYLAQKF---NAKATGITLSPVQAARATERALEANLSLRTQFQVANAQAMPFADDSFDLVWSLESGEHMP---DKTKFLQECYRVLKPGGKLIMVTWCHRP................................. 172
68 -45.900GD0318B YP_001088469.1 388123 Selected-2007-09-21  ali follow..  20  2.....ETKQYLIDFYNTYDE-----DSRLALKHGMVEFLTTMHYIDIKSGDCVLEIGAATGRYSHTLARQ----GYDVDAVELVEHNIEVFHKNTQSNE---NTSITQGNAMDLSFPDNKYDITLLLGPLYHLYNKEDKQQALHEAIRVTKPGGVVFAAYVIS................................... 150
69 -45.900FJ0318C YP_679633.1 370192 Purified-2006-08-16  ali follow..  16  7.TLKETAVVPAATGYDRIAFIYDIIAGIASFDQINKSQLAFLSSIP--TQSTCLILGGGTGYFLQKLLEQ--NATIQVTYVDASQKMIEFAQKRIAEKKPYDAHRVTFVCKQVNVFEFDTYDSIVCNYFLDLFEEA-DVTMLIKKFKKHLKKDGILYITDFTMPI................................. 165
70 -45.900FP0318O DDES_06JUN05_CONTIG143_REVISED_GENEDDE3542 383348 Selected-2007-08-07  ali follow..  12  1VTTGTAPAAACEPLWARPAMRGASPDA--WRPGGLELTDRAAALAGVKPGWRVLDAGCGTGASALHLRRRY---GALAAGMDMLAGRHRQGDVPC---RVATGVPMVRADAMQPPFIPESFHMILCECVLSLLP---DPARALHIFRNLLRSGGTLAVTDLYLTG................................. 155
71 -45.900FN9827A NP_104914.1 379544 PDB-2007-12-07  ali follow..  17  2..........AQNIYDDFFAGYSQLGRSIEGLDGAAEWPALRAMLPEVGGLRIVDLGCGFGWFCRWAHEHG---ASYVLGLDLSEKMLARARAAGPDTG----ITYERADLDKLHLPQDSFDLAYSSLALHYVE---DVARLFRTVHQALSPGGHFVFSTEH.................................... 145
72 -45.800PG0318A YP_106659.1 372244 Selected-2006-09-08  ali follow..  13  1MTATDRNDNGQAAHWNGRAGRAWADAQPMLDRMFEPFAQRLVEAA--RTGRRVLDVGCGAGATTLAVAQRL-GARGRCVGVDVSRPLIAAARARAERGGV--PASFVHADAQTHAFVPASFDTIISRFGVMFFE---NAVDAFANLLRAATSDASLAFVAWRTAA................................. 157
73 -45.800XB5692A NP_865209.1 358830 Selected-2005-01-24  ali follow..  18  69....TYMGRIVAQPMSHRGAAWLVRPE----RDDEEKAGESFDRLGLKPGMTVVDLGCGNGYWTIPMARAVAIKAGQVLAVDIQREMLQMLQRNAARAKL-DNIQPILGAIDDPKLPAGKVDLVLLVDVYHEFSHPE---SMLWAIRQSLKSDGVIALLEYRAED................................. 249
74 -45.800FL11000A YP_111759.1 375770 Purified-2007-04-04  ali follow..  21  7........................................FSRYLNRKRVQRAASLGAGRAETEIALLEL--GAVEHFDLFDVSSVGIEYAKSIAEEKGFGHKVTCHVGPIGCAELNENTYDLITFVASLHHME---PLAETLERANRALTQHGIIWCAN...................................... 121
75 -45.700FN2288G NP_250611.1 379733 Selected-2007-06-05  ali follow..  10  1MTATEQ-IMALLERWDRQQEGYIRQREERY----EAMFQLLEDLFGRDGRFTAIDAACGPGSLGRRLLERFP--AARVVALDADVMLLEIARTALAGFA--ERVRVVECDLARESLAGERPAALLSSTALHWLSPA-ELAGFYAQAGELLAPGGVLLNADHMRYD................................. 166

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jambon M, Godzik A. New avenues in protein function prediction. Protein Sci. 2006 Jun;15(6):1527-9.