current user: public




375334
Query: FL10589A JANN_22DEC04_CONTIG13_REVISED_GENE159 375334 Selected-2007-03-12, from JCSG0709

Results of FFAS03 search in JCSG0709
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .
# Score Template Links and tools%idFirst LAESTLQIHLNGRFRLVGANGAPIELASVKAQAMIALLGTEEHMTRSRTWLQDKLWSDRLHTQSANNLRQLIFQLRTALGPVAGVLVTNRGLVGLDPLQVEVVAAGEGEFLEGIDVRDPEFENWLAQKRAEADPPAEGKAALPARYGSPSTPLIRKETVRSPRQLTIESANELDSWLGRFETRVAEMIHRSLRELLDVDLVEPGQNLDGRGSVALYLHAYSETAGQVGIRVSIFEGLGQGKFWSDSATGKAPGPREDPGWPFRNLCHRGCDALVDRLIQATPSTGSEIDAISLAGMAMRRMFSMLPGSIGEAANLLQQANNIRPRGLYSAWQAQLAVIEYVESGGERREELADLADELCYRAMAAEGTNANVLAAVSHARLVFDNDLGAAVELSRLAVLANPSNPLAWSARANALLNANEPKMAYQAASAAHSLSRETTFRYWTEFQLATTAVETGNPEKAVAHSERARALNARYRPALRYLIGLHAELGDSDAARSNLARLRRIEQGLTVERFAMNETYPVSMMRKAGLVDISKLSDLLast
1 -159.000FL10589A JANN_22DEC04_CONTIG13_REVISED_GENE159 375334 Selected-2007-03-12  ali  100  1LAESTLQIHLNGRFRLVGANGAPIELASVKAQAMIALLGTEEHMTRSRTWLQDKLWSDRLHTQSANNLRQLIFQLRTALGPVAGVLVTNRGLVGLDPLQVEVVAAGEGEFLEGIDVRDPEFENWLAQKRAEADPPAEGKAALPARYGSPSTPLIRKETVRSPRQLTIESANELDSWLGRFETRVAEMIHRSLRELLDVDLVEPGQNLDGRGSVALYLHAYSETAGQVGIRVSIFEGLGQGKFWSDSATGKAPGPREDPGWPFRNLCHRGCDALVDRLIQATPSTGSEIDAISLAGMAMRRMFSMLPGSIGEAANLLQQANNIRPRGLYSAWQAQLAVIEYVESGGERREELADLADELCYRAMAAEGTNANVLAAVSHARLVFDNDLGAAVELSRLAVLANPSNPLAWSARANALLNANEPKMAYQAASAAHSLSRETTFRYWTEFQLATTAVETGNPEKAVAHSERARALNARYRPALRYLIGLHAELGDSDAARSNLARLRRIEQGLTVERFAMNETYPVSMMRKAGLVDISKLSDL 539
2 -93.700PD03704C 17741976 366222 Selected-2006-02-16  ali follow..  15  1MAAELIPIRLFGTPRCEAVRD---AFFPSKGFALTAALILAPNQSLSRQYAASLLWENVEQKRALGNLRQLILRLQKLPSEDDAILLTEGNDLKAGALAQRTDLEFGGDLLEGLEAGQDHLYLWLLSERRRLKAGPVEPEEGSRRQVLAKPRVAFVRPARVDGQPVPTVIHAFVEDVANSLVRYRTFTVLSPHSTFALAHDRVDDSYAMLRADYRIISTV---FDDSRMSVALIEDASGEIVWSLEAVLTERHIHAAFRLLSKQVAAALAREIERLQVEPDRNHSGEAYRQLLEGQQL-LRGKCDLPLLRRARSLFRKAVDLDHSLAVARARVAQSLQLEWLMLGGNDPHLLHRAKAEADASVEIDPALGVGHWMCAVVALY-QRDFDISAEKFFEAEALAPNSADLLLQHADALAHFGDAEIAWDKFQQAINLNPLAPDIYWW--AGASIAFKRQDYGTAVELCGRMENDEP----ALRVLTASHALHGDLLAARESGSRLQENYPGMTAREISSLSPDRDPIANERFYHALRLA... 639
3 -85.400PE00381B NP_103466.1 368094 Selected-2006-05-02  ali follow..  14  22.GASNLPYL-FEDFALDGDRNSLIAV-EPQVFDLLQYLIRNRERVVSKDDLVDAVWQGRIVSDA--TLASRVNAARSALQDNGE----------------------QQRLVRTFPRRGFRFVGTVHEEAGAEATAPVEPAKPGLGIPARPSIAVLPFVNLSGDPDQDYFADGMVEDIITGLSRILFVIARNSSFTYKGRAVDMKQVGQELGVRYVLEGSVRKVGSRVRITGQLIDTEDGGHLWAERYDRELTDVFALQDEITISVVAAIEPNLRRAEIERVKRQRPDLDAYDLFLRALPDVYTFMPQGAARGLPLLDQALAIEPSY-ALVHGFAAWAHQTLFIRGGMQAEHSGKASRHAHAAIEHGSGDAMALALAGFTIGLVEHDRKLADEAFSQALSLSASCAFVYAFGCVPVAYGGDATRAIDWGEQALRLNPLDAMNCVPQGMIGFGNFLAGRHEQAIAAGRRAVEMNPGFSILHGWLAAPLARLGRIEEAKAAGSRLMALDPHFTIGRWSAAVGL-----APAIIDDVTEAMR. 535
4 -81.400PD03704E NP_107464.1 366284 Selected-2006-02-16  ali follow..  16  10.TAPLISVTTLDKVALSR-LGRDVAVRNRKSRAVLAYLALSPHGFETRERICGLLWSESDEARARASLRQTVVDLKACLAEIEGVFSGDRLNVTLKPSLVTVDVRVAESFLNGLDDIDPSFRNWVLVQRQCLQDEFISCLEAMAKAAADWPALALRAYKGLWDLLETEFDSEPSAATQALVSDIKELVASLVRFRDWAVMEWEGHPPRFTENAYCIEATGFIDGPTLRLSMTLKQLASGRYIWSEQFVIENSQWYQTQQRLIRRIAVALGVSMSSERLVQIASIPDLSEQFDRWLRAQELIFQWRPESEERAEALFRSIIAESPRAAAYAGLAGIINSRLIFPGIGRRRERHAEALTFAKQATQIDPIDSRSQLHLAWSYAM-NGIPQQAAISFLLACELNGNDPWTLVSASLGLAYCDDRENARRIATLALQTGLGVSRLQW--SYQAGVRFLLGDYAGCVEAAERAADSVSY---IGGWKAAALALLGNEKAAHEEADRFLAPEPGNVGTWLMDSFPIYSPEAVEALRRGLAGA... 663
5 -67.100PE00381A NP_417329.1 367969 Purified-2006-08-17  ali follow..  1MDLENKFSYHFLEGLTLTEGNEQVYI-PQKELGVLIVLLESAGHVVLKDMIIESVWKNIIVSD--ESLTRCIYSLRCIFEKIGY------------------------RCIETIYRKGYRFSGQVFKTKINEDNTSDYSIA------------IFPFTTSLNTLDPLILNQELVQIISNKKIDGLYTYPMAATN-FCNDHISQNSFLSRFKPDYFVTGRINQNNAVNTLYIELIDAKNLFLIASNHLP--VDELHNTSQFIIDNILQTVHKPERSVRLAKQDQGYKNHYLSDEMLAGKKELYDFTPESIYRAMTIFQNKSDIQTLKTECYCLLAECHMSLALHGKSELELAAQKALELLDYVSDITTVDGKILAIMGLITGL-SGQAKVSHILFEQAKIHSTDIASLYYYRALVHFHNEKIEEARICIDKSLQLEPRRRKAVVIK--ECVDMYVPNPLKNNIKLYYKETESESHRVIIDNILK--LKQLTRI............................................... 455
6 -67.000FP10537B NP_105475.1 382012 Purified-2007-12-08  ali follow..  17  1MQGSRFA---FGPFVLDPGNDDPVAV-GYRGLKLLAALVGRPGEILEKAELMDAAWPGTAVEEG--NLTVQIAQLRKLLGPPAD-----------GGEWISTVPRVGYRFTGAIEQLDRA---------------KRKPLPLPDKPSIAVLPFVNLSNDPEQEAFADGLTEDLITDLSRA--PGLFVIARNSTFAYKGKAMDVRAIAEELGVRYLLEGSARRAAGRVRINAQLVDAKSGEHLWAERFDRGLDDIFAVQDEATAKIVEALLGRLRAPPPRNRPTNLEAYD----LCVRARKLIEESPQTAREAHLLLTRAVSLDPEYAEAHRWLAMNHWMGWVHWGEPVDPNRRIALELARKAVAIDPNDAGCRWVLGNL-LAYEHSFEESEAEFAKAFELDPNEADAWATLSDIAVLAGRVEEGLEHIRKAFRLNPYPASWYYL--TLGEAQYAARDYEAAVETLRREETYRTS---SRRFLAASLAQLGRLDEARAEVEMFLIGNPHFTTSYWVWTEPFRDDAMRDHFVDGFRKA... 498
7 -61.200FL11160A ROSE_TM1040_30MAR04_CONTIG54_REVISED_GENE2306 375954 Purified-2007-04-13  ali follow..  15  1.....................................................................................................................................................................................................................................................................LRDATSQIGQTVVGEAVRLVSFRPLGNANHTLLMAAIVMMQSKHPDQFEKSNEILDTLMEREMHHPVLTWAGIWHVMRVQKGLSGDRRKSTLMAENLANAALAQDPAFSLAHTLKGMIASYLTFDFDNAQYSYDKALQDNPNEALALLLKGATRAMQNRPDEGVVLTEAARKLTPLGPQRYYFDSLAAAVSLAARDYNRAIELADRSLEENDSYPSTLRTKAIALQMSGRSDEARHVVESLMKVTPDFSLSRYMQEHAAGFTPSGPDWASALREA... 277
8 -61.100FP10537C NP_103451.1 382060 Selected-2007-08-07  ali follow..  13  1.....MPIGSAMSRIATSSPGHDA---SDRERAVAEKFAAGLTYREIGEALF-----------APSTVRTHLASIYDKLGVRNKVALA----------------------------------------SHINGAIGAGMDGPPRLPGASPVLAIFPIECQTSEERWRRFADGLSSDITIDLARYLPVIAFHTMKSLGSKPADFAADGKALGATYVVSGQLRADERRVRLSIELADADNGVSLWSERYDRQVEDIFALQDSLTETVINVIAGSYGAGRKAIRRKPPASLRAYDCYLLGVEQQDTFSRAGIAEAIRLFSRALELDPTVRAWTALAYAYSIEGANGFGDDAQVSIENWRTAVENAILLDPMDSVACNCLGDLRGC-LGDLEGAERAYRRAFEYGSNHADTLAMLGSKALVAGDPAEAMPLIERAMHLNPLAPPWYF--GMLGRILFTLGRHREAIAALCRSTLNSPN---VLLFLALAHTSVGEAAEAARIEARLKTEFADFSVERFITCYPVTNPDAVHAIRHAAQQL... 481
9 -60.100FP10537A ROSE_TM1040_30MAR04_CONTIG45_REVISED_GENE342 382573 Selected-2007-08-07  ali follow..  13  16....................................................................................................................................................................FAEGISEDITTELSRF--HAIRITSRMSSFQFNASERPAQEIATTLGADFILSGTVRRALNRIRVVVELYETLEDRQIWSERFDRADADIFAVLDEISGLVAACMTGEVQLAETRRTKAQDLTAYEALLVGQDLHKSGDISPRVATRAVAAFSEAIDAAPDFARA---AWRACSFSRTWDFPVRQDQFDQVSQDVFKALEFDPAEAEAHRIAGAV-CRALHEFDRATLHIEKALELNASDAHIAAKSAEHFAFIGQPQRAHDLINKAMALNPMFSGWYW--EIIALADYVASQYEEALAAITRAA--SPTFAGFAYQVG-SLLALGRTEEAKEAVALLKAQYPDVTLAVYQRDGRRFAFADGQPQKV........ 375
10 -59.000FL10954A JANN_22DEC04_CONTIG21_REVISED_GENE993 375763 Purified-2007-04-13  ali follow..  17  19.......................................................................................................................................................................................................................VEVSSVEMPGTKGVSVNLTRSLDGTVF---TTLTRLSESVDMIDLVNEAVVQSL-----DEIAGYEAQLPSAKIATAMCFRAMQSITDYAPTTIEAADRLISNAYEIDPQPVFLAWRAYLRTFLLGESGGGNSQAISEEMERFINLAEEREPGNSIILSLAAFIRSMWLLSSEDALDLAQRSHALNPSNPYGISYLGMVHTHLGNFEEGYRLTRRANALTVPRGAKSSIRYVAMRSAACAGRYTEAIKIGEALGRDAPHFVAPKRLMGLLYMKCGRVADAEAMVETLRQHEPDYSMEKMRRASPLLHRSKLGKA.......... 327
11 -49.200PE00381F YP_612533.1 368339 Selected-2006-05-02  ali follow..  23  1.MVVVLKVRQYGAFGVYRPDGEPIQL-GAKHQALMALMVTAEEGVRTRAFLEHTLWSFAQPEQAKASLRTALSTLRKHIGPTASAFKANRERVTLDLSMIEVERPARGEFMEGFELPHNAFSEWLSEMRSQASPWAPRDRSRVILDELLPSIAVLPFAQRAPGGSTAPLGAILSEELSRQLSRSFSVTSYLASRQFSLEDVRPAEVSSVAGVSYLVSGSVF-----VRVTILLRKLICMTRIGKKSFGRSFVGAFR........................................................................................................................................................................................................................................................................................... 264
12 -44.000FP12909B YP_386853.1 383177 Purified-2007-10-20  ali follow..  13  29................................................................................................................................................................................................................................................................................................................AHGAYLPVILQGGTVPACSVAKEKSS-LNSAGSCRPGICLTLAAAEKREQVAVFERRGTMSNHLDYEINKELGEC-YLFMGELDKAEEYYRKAAGSNGVHPDPYLGLATIAVQRGLFDDALVLYKKAADIEPGDKALA----GMGLIEMERGENEPAFSHFAQALDMNPANMIAVHGLVQLGYVLGRIDDVIPRLHAFLEVDPAKDAVRVSLAGCYISVGRTEDAAGQLEELLRR 257
13 -43.700PD03704D NP_103781.1 366273 Selected-2006-02-16  ali follow..  11  2....RVRIQLLGGFSVSLDDQIVAAWRRDRGAALVKLLAVARSHRIHREQVMEAFWPDLDPEAAGANLRKAVHFARRALGAHEIIALAPAADLEIDVETFAAADLYTGDLLP-----DDPYVDWFETPRQALRQRWQRLIALDPADEQAQCALMQSALDAGNRAEAIRLFNQLSECLRIDLGVGPGAETVKLYEKALAVPSIDPVGLSDRIRASLAWGLLHLQSGDFAKAGQV--GRETRELAMGAGLAREVGEASALIGLVAHMQGQWRELFRAEFIEWVRSKPAFVSNVFDGHLCLAEFCLCSAKGHHDIAASARELLSVAEGAGSVAGRGLASLV---LGEAALFSGQLAEAERMLTEAERLYAQRVLALQRLTEL-ALARHQKWQAGRLIHRATTLARSSWLLISLKGLEVRAAATSERIAETIREGDRMCNCQPCSMTFRTAAAVALAEAGEIEQVNRRLDEAERVGPWVAAVWEARGVQRRAEHNETRAIAAFEEAATR.................................. 547
14 -43.100GS13774A NP_810272.1 385097 Selected-2007-09-11  ali follow..  1MKKLLILPLALF-LLVQSGLAQTPKWVEKAKRAVFSVITYDKNDKMLNTGNGFFVSEDGLALSDKGAERAVIVTAEGKQMPVSLILGADDMY---DVIKFRVAITEKKPSLVVATTAPAAGADAWMLPYSTQKSIACVSGKVKDVSKIAGEYHYYTLSMQMKDKMVSCPVMNAEGQVFGISQKSSGVDTVAGAAFAMSQKISALSLGDVALKNIGIRKGLPEAEDQALVYLFMASTQMSADEYEKLLD-SSTDGYIRRANYYVAKGKDDQSYFDKAVADFNQALKVAAKKDDVYYNIAKLIYGYKDWTYDTALKNLRQAMAIDPLPVYT----------QLEGDILFAQQDYAGALAAYEKVNASNLASAASFFSAAKTKELLKADAKEVLALMDSCIARCPQPAPYLLERAQIYMNNDQARNAMLDYDAYYKAVNGQVNDLFY-YYREQAALKARQYQRALDDIVKAVELSPKDLTYRAEHAVVNLRVGRYEESMKILNEILKDEPKYGEAYRLLGLCQIQLKKTDEACGNFNKAKEL 554
15 -43.000GS4516A YP_001300150.1 384004 Selected-2007-09-11  ali follow..  44......KIKNTGNGFYINENGTALSDYTLFEGAERAVIINADSKELPVLRILGA-----NSMYDIVKFNTETDKKTIALKSASQPASVGETVYLLPYSTQKA-ATCQTGTVTKVDTIGDKAYYY---TLAMTTNEKTVSCPIMNANGEVLGLIQKNASDEAKESYAIGATYGASLSITALSLNDMSLNKIGIKKGLPETEDQALVYLFMASSQQNQDEYITTLNDFLEQYPNSADG-RRATTYMGFNDDEHNALADADLKKALEVTANKSETQYNIAKLIYSYT-----------ISLGDKKPYGDWSYDKALSIIHDAMQADNQPIYT----------QLEGDILFAMKKYPEAYAAYEKVNQSSIASAATFYSAAKTKQLIETDMNEVIALMDSAVAYTSEAAPYFYERAEIKAQTGKYREAVIDYDTFYDAIGGRVTAAFY-LQREQAEIQCKMYQQAINDINKAIEMTPEDIAMWVEKGSVHLRVGQHNEAIEALEKAISLDPKAAAAYRMLGYCQIQLKKNKEACANFAKAKEL 552
16 -42.700FL11061A YP_508933.1 376307 Purified-2007-04-13  ali follow..  15  1...........................................................................................................................................................................................................................................................................................................................MRQTVQKHAPLV---------FIMIALTACDFTPRLDAGDDDVTAPASVGELDDGAGSLITGDR-LMEAGEYELALRAYYRAGVEDGLSVDVITAIGAANLALGRLGQAEEQFRAALQRQQDFVPAL---NNLGAVLIERGEYGEARRILEQAFAVDSGSSETIRDLAIARMENQVYDETEQNRPGLIRRGGGRYTLQSSL....................... 191
17 -42.600FL0757A YP_322646.1 375497 Selected-2007-03-12  ali follow..  2................................................................................................................................................................................................................KLSLCMIVKNEATALPKCLSSVVNVVNSQDGTPHIARQFGAEVNDFSIARNTALKYVTGDWVLVLDADETLTPAIVPHLKNAIASEEYLLVNLMRQEVGAEQSPYSLVSRLFRNHPEIRFER-QGVAILHAGYQKSAIAQNNKYAKAQATMEGFLATHPHDPYVCSKLGAL-YVETGKTDKGMELLKRGINACQEEYELHYHLGIAYNRLQNTQQAIYHYQTAIKLPIYPMLKLGAYNNLGSLLKASGDLKGAKKTYETALKIDSNFATGHYNLGMICKAMGLFIEAIACYQKAIKLKPSYAEAYQNLGVVQLKVGNVPASITAFKNAIIL 373
18 -42.100GS12946A YP_212863.1 384306 Purified-2007-12-04  ali follow..  14  49...............................................................................................................................................................................................................................................................................................................VGKDSLVQAEDLLKQALKLEPKNAHNA------LLFSNLGLVQRKLGRYNDAVESYTYALNIAPLAVPILLNRAAI-YLEQGMQDKAYVDYCQVMDVDKKNTEALLMRAYIYMLRRDYKGARLDYQRLLEIDPKNYNGRL---GLATLEQKENKFREALDILNQLLVEFPEDAVLYVARADVERDMKHDDLALVDLDEAIRLAPDSIDAYLLRGDIYLDQKKKSLAKADFEKAISL 274
19 -42.000FL10667A YP_012323.1 376011 Selected-2007-03-12  ali follow..  11  27................................................................................................................................................................................................................................................................................................................AAQAFQSALVIVLKSPLMRAERE---------EFERMFADAAHHLNNDAGLRALFPLKIEYLPGSEKELLDIIRE--LVTAVNNAAVTEAQEQLAALDARKAAGLEQGQAHLDAQEFDAAAAVFRQLSHEFKDDPQLR---GEIGERFLKAGRYEEAFDYLAQALDLSPESIHLYNRIGIALRRLGRFETGEKYYLRALQYAGHDPNLLFNLGRLYVDWQRWDKVAKAAAAALRV 247
20 -41.500GS13833A NP_810764.1 384143 Purified-2008-09-15  ali follow..  15  33................................................................................................................................................................................................................................................................................................................EMDSLSKAEELLLQALKLEPKNAKNA------MLFSNLGLVQRRLGEYDKALESYSFALNFAPLAVPILLDRAAI-NLEMGNTDRAYTDYCQVLDEDKQNKEALLMRAYIYVLRRDYPAARIDYNRLLEIDPQSYSGRL---GLATLEQKEGKFKEALEILNKMITATPEDATLYIARADVEREMKHEDLALVDLEEAIRLNPSSADAYLLRGNIYLTQKKKALAKMDFEKAISL 257
21 -41.300FP12909A YP_009542.1 383653 Purified-2008-03-05  ali follow..  16  14......................................................................................................................................................................................................................................................................................................................................................GECYLFMGDLEKAEDYYRKAAASNGVHPDPYLGLATI-AVQRGALSDALVLYRKAADIEAGD-KALAGMGLVEMEQGDAEAAYGHLAAALALNPENLVAM---NCIVRLGYHFGRVADVVPYLENYLSLVPGKDTVRTTLAGCLITLGRPEEARAHLEQVLASDPANPEARSLYEGLA................... 186
22 -41.100FL11148A YP_010123.1 375935 Crystal|NMR-2007-06-28  ali follow..  41................................................................................................................................................................................................................................................................................................................IQKSFWYVDEGDDGVIEVQPLNS-----NYVPSGPKRKIDRDELLDKFAPEPEFYVQTVFPKMRELNKTIARADRH-RQKGETFSAEFEYNNALKVDEENVRANFGIGLTYLERGETDKADNIFERLVKLDAAFEEEHKLFNEFGINLRKSKMYDQAVEYYGRALELSQGDENLHLNVARAYLEKQDFPHCLEHVLRALMINPAHEAGLKFLAWMEAKKLVPEDQRAAVAEAVAR 270
23 -41.100FL10667B 17738543 375917 Selected-2007-03-12  ali follow..  12  69...............................................................................................................................................................................................................................................................................................................LNMEQLRQAEETAGKAYERNPKDR---------SVGMNYASVLMMTGKNTQALAVMQQIAIANPADREVLAAYGKS-QAAAGQLEQALSTIQRAQTPDRPDWRLYSAEGAVLDQLGRSNEARSRYRQALDLKPNDPSVL---SNLGMSYVLSSDPRTAETYLQSAISQPGADSRVRQNLALVVGLQGRFAEAERIAVQELSAQQAQANLTYLRAMLS-QQNSWQQLAKKDRKPAG. 289
24 -40.900FL10987A YP_410972.1 376253 Purified-2007-04-13  ali follow..  3.....................................................................................................................................................................................................................................................................................................................VIPGIAILVISLIAPDLHATS---------------SAYCGELINVHDYIGGDKQLLGTVEQHHFTSN-IESLRHGNTGTLGGDLSYTLMLFPNHHRALAAFSKLSLRAGAKYSVGCFFDRAIRFKPNDAVVRM---VYGDYLLKAGQTDKATEELGIAIDLEPENPTINYNLGLLYLKQKNYEQAKTYAKKAYELGFPLPGLKNQLKQAGKWDE............... 204
25 -40.800FL10862A YP_323758.1 375694 Purified-2007-04-04  ali follow..  10  143................................................................................................................................................................................................................................................................................................................KTTGGSTYLKTGTDCIKLNTT-------------EIAQEIQKRKQKYLKQELDNIDDKLLQNPDNRSLLKEKANI-AKLMGDIEKMDESYKRLINLNPNNSRTRVDYASAHKSIGDLEGALDILEDALKVDGDNLSILKTKGEILLGSDSSDKVKEAFQTYETALKLNPEDYTIITQIGIALRKLGKYKESIKVFNLALAKSPHYRAAKYEKRITYHKMFEGGIRI......... 354
26 -40.800FL11249A YP_011172.1 375973 Selected-2007-03-12  ali follow..  11  65..................................................................................................................................................................................................................................................................................................................NRHQAVRRFFEAQGVLSTPFVTYA-----AETELAERLESIRAGFEKDVAAHAAQHAAKVAHRKEALLRSGQE-KLDAGDAPRGRSFLKRAADEFGHEAGVLTDIGQRLQRAGLLFEAAEMFENAIAAFPKDGHAH---AGVVAAYMGLQEYPKAEMAYTRALKQFGTHPKTLVNMARMYLAWRKRDEAWTHIQRALQLAPGDAEAKALLAEIEGRGSRR............. 277
27 -40.300GS13253C YP_001301881.1 384803 Purified-2009-05-20  ali follow..  10  2..................................................................................................................................................................................................................................................................................................................KKIVLLVALCLCVGNLFAQDA---------DKLRDEGDAALKAKDYATVVTKYGEYLKQNNYQDTARIFNCGYAANQAKNYAEAAKYFDMAVKMNYNVDDSYVGEAMAYRNLNKTEEFLTTVKEGLKVIPDGNKNKTYCIKQGQAAQKKGDLAGAEKMYKEVLAVSNKDSNAYYSLGAML-----YGNGAKILQAATPIATSEPDKYNAEK--AKADKDFKQAKEYLTKAVEL 228
28 -40.300GS13605A NP_812421.1 385044 Crystal|NMR-2009-02-04  ali follow..  11  3....................................................................................................................................................................................................................................................................................................................................................TLIILLLCTNTSFAIAQISPKAVEKNNQ----SVKTAGF-FNDSDSLNKAIHLSDEAIALEPSYKLAYANKIKYLMALGQKEKALQTMLQMEKFSPDDPYYIL---GKGMMLEENAKKSLAMDAYKQALKEKPTEADLMNYVFVLFLRDNKNYSLDEIEKEYPQIFSPAIRQH-TKKLIDELSNKREDVIHEMLGG... 196
29 -40.200CL5873A 10173092 359053 Structure-2006-08-24  ali follow..  2................................................................................................................................................................................................................................................................................................................................................................................DVKQTLEKAIA-LRQNKRYQESNAILVTLCKEHAHDPQILYQCGWSFDVLGLEAQAVPYYEKAIASGLQGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETWKA....... 164
30 -40.200FL10894A NP_242915.1 376173 Purified-2007-04-04  ali follow..  14  1................................................................................................................................................................................................................................................................................................................................................MNKLEERSQHRKSRFRFLVISTFWRVLLLLKNDAEPLFHLGNI-HYAYGHKASAMNYWKEAVSKNREHEKAWHNLVQCAVIQEEWEQAAEGLTILCRNHPTRFEYMS---LYTHALKKLGKKEELEEWYLSHIN-GPHHEWAIEGLGMLYIRTRREIDAFKLLSPFVRKFPNRPVGLKILGISSIRTNQYEAGLTFLEKSLEL 198
31 -39.900FL11443A YP_001050170.1 375514 Purified-2007-04-20  ali follow..  10  127................................................................................................................................................................................................................................GRNYIASEALRTQSGNCMSLALLTYAVANILNVETTFQVIHSSPLLTDIKDDLVVSSDHVRVFLSDSAYKGHYLSGGNYTVIDYFPDVNDRAGAIVSEQEF---------LAMFYRNLAADALLEGDLSRSFAMLERGVLLAPKYSPVINMMAIL-HRRAGDYDTSRDFYKYGLEIADSQVVLLSNYRQLLRQVDDKKELNSVEAQLLALNDSTPYEWY---GLGLDALKSADYKKAQVYLKKFLNNTPYFHRAYYDLAKAQFALGDIRSAQESLHQALELAKLPDNLQKYKAKLQWLSQQNH............ 416
32 -39.500FL11323B NP_952598.1 375321 Purified-2007-04-13  ali follow..  16  1........................................................................................................................................................................................................................................................................................................................................................................MSMNSEPTPAEAFFLEGNR-LLAASECRAAEACFREALALAPDFAEAHANLGMLLDQEGMAAEAERQYRLALALNPRLGHTHS---NLGVLLANQKRFEEAESAYLSAIELEPDSPAAWSNLGVLQACRKQEREAEESYRTALRLDPDYHRASFNLSYLLLRQGRFDEGWSLLESRNRR 175
33 -39.100FL11007A CHUT_08NOV04_CONTIG199_REVISED_GENE1453 375781 Purified-2007-04-04  ali follow..  75................................................................................................................................................................................................................................................................................................................ELKNVDRAIEEGQKALQLGNAEP---------ILYALLANCLLEKNDTISANQYIGKLTAIAPQMAELKYVQAKK-LLIGKDTSHSFLKFRECIQNNPQYIEAYIDLMSLYYKKQMYDSIMPLLIKAKRMRPNNPTLFL---YEGKFYETINKNQVALAAYKEGLLCDPQAIELYKPLSDYYGRQGNYKESMYYLSKWIEKNSSDAQSIIKMGNYALKQNDEAGAVTYYKNSLSI 296
34 -38.800FL11138A NP_108297.1 375921 Purified-2007-04-13  ali follow..  15  21................................................................................................................................................................................................................................................................................................................NSGNHGLAMQLCELGLKQHPDDP---------ALCHLLAAVLFARADLSGARTHIETSLAARADNVPALILACKI-ARADGRFEAALQQLDRAAKLSSQ-AEIPIERARTFDQAGNALAAREWWTLVLQRDPKSEEAA---ARLGRLAWQRGASVEAEGFLERAVA-SGGHPSAWFDLGLVRQDMRKFGAAAQAYRRVLEMSPDAPEAAVNLGVVLQETGDLDGAMLAYSTAYRL 240
35 -38.700FL11140A YP_001815333.1 375925 Purified-2007-04-20  ali follow..  11  1...........................................................................................................................................................................................................................................................................................................................MIHTLQAQSNEITIPFAELDLLSHL------TSEFEPKLFQQKIERLHQLDPGHPLPGIAKAYA-FFHEQNFSAARRQLEQARSETGDHVRAHLLLGLMSEVENFQHEAERHFLDALSLFPEEPSVH---RHLAVHYHEREFFGEAAHALQYLKKIGPGGEGTLMTIDMMQSMPGHDEHVLESLYSLLFEIPEHHHDMVFHS---IAANNAEMRYELFHQALDG 212
36 -38.500CL5996A NP_662233.1 359220 Purified-2006-08-29  ali follow..  11  1...............................................................................................................................................................................................................................................................................................................................MTSDPH------------LIFADVSLDIKCGAFQSALDKLKEVERWLPESYIFHLLTARA-ARGLKRYEEAIEHLGHCCRIAPANQVAWRELIEVKTLQSQAEPARTPAIDEVAVEFEELSKAL---AGFTPPRATECFEPTIAEQKQPFPDDASIAVPTESLAKLFVNQGAYKKAIRVYTSLIQLNPSKADHYRQSIDKVLEK................ 190
37 -38.400TM1695 TM1695 283552 Purified-2001-12-11  ali follow..  12  109................................................................................................................................................................................................................................................................................................................DRNLYDIAHDIIKFMLDIDENYAPA---------YELKGSLLVEQGKIEEGIKFLDKAVEIDPWLVQAYASLGEA-YYNLGDYEKAIHYWERELEYNPNDKITYFMITEAYYEMNRKDLAVKTLERLLEIDPDNIPALY---QLSQLYRELGNEEKAREMEEKIMNCKPKYPTELEPWARVMLKHGRYKEVAEELEKIVESSPLNTLARLLLVVPYVKLGQIDKAREILDDIGQS 330
38 -38.300MA2004B NP_078775.1 399829 Purified-2009-03-14  ali follow..  14  28................................................................................................................................................................................................................................................................................................................AQESLEVAIQCLETAFGVTLEDSD-LALPQTLPEIFEAATSSKQEMPQDPRAPDRTPPSEEDSAEAERLKTEGNE-QMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLGNYVGAVQDCERAIGIDPGYSKAYG---RMGLALSSLNKHAEAVAYYKKALELDPDNDTYKSNLKIAELKLREATGGVGSLDIAGLLNNPHFITMASSLMNSPQLQQLMSGMISGGHNPLG 260
39 -37.900CL6125A 17130711 359434 Selected-2005-05-20  ali follow..  12  12................................................................................................................................................................................................................................................................................................................LRKYFYTLKSMKFTSITYTLSAV---------LLLGFSIPLVFAQTPDSGLSADCQMPIPPNLNSVDHFLGMGHFQQDCKKDLSAAVAAFSQAIKLNPQAEEPYYHRANSYAAMGNYQAAVTDYTEVIRQNTGRLGFS-AYWHRARAYEKLGEKQKAISDLTQLIGNNSSLAEEYLFRANLYKELGNKESAIADYKIAEKLLQQYADGVFHTGMMDTRYDQVRNELSSMGVAVTV 243
40 -37.900FL1695A NP_953073.1 375632 Purified-2007-04-13  ali follow..  14  4................................................................................................................................................................................................................................................................................................................GTESFWTDIKRYEDILAKDPGSYCFAPLSELYR----------KVGLLDDAIMTARTGIGQHPEYVGGYMALGRA-CFEKGERTESRAALEKVVRVTPDNLLAQKLLSQIYVDAGESDLARRCLEIILSLSPGDLESK---LMLDAMCRQPENADRADDLFNEMGAAAAIDLEDESLLEEIEIIEELVDEVEEPVANADVPSPRDVLSTGTVADLYIAQGFPKKALAIYRDLLDA 254
41 -37.900GS13253B YP_211956.1 385297 Purified-2007-12-04  ali follow..  10  1...............................................................................................................................................................................................................................................................................................................MKKIILLLALCFTANNFFAQTTDPNQ----------KNEGNDALNAKNYAVAFEKYSEYLKLTNNDSVTAYNCGVC-ADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNATIE-YYLKEGQKFQQAGNIEKAEENYKHATDVTSKKTDALYSLGVLF-----YNNGADVLRKATPLASSNKEKY--ASEKAKADAAFKKAVDYLGEAVTL 226
42 -37.800CL6104A NP_840242.1 359393 Purified-2005-09-24  ali follow..  11  25......................................................................................................................................................................................................................................................................................................................QEKPTPEELKQRALQSA---------KIHTELAGQYYHRGQYRVAIEEAEIALQKKTDYAPAYNMLGLV-YMDLQEDDRAEWNFERGLGITPNDPDIRNNFGWFLCQRDGIEQAIGHFMAAVR-DPLYETPERTYTNAGLCVLKQNDFERAQSYFQEALVIRPGYPLARLGLVELDFSRGEVKKAWAAINRYLQTYPPAPGSLWLAVRIARANGDVNAETNYAFQLQKR 244
43 -37.600MA16021A NP_003305.1 399793 Purified-2009-03-27  ali follow..  13  55................................................................................................................................................................................................................................................................................................................EDQGEEECFHDCSASFEEEPGA---------DKVENKSNEDVNSSELDEEYLIELKKNMQKRREESTRLKEEGNE-QFKKGDYIEAESSYSRALEMCPSRSILFSNRAAARMKQDKKEMAINDCSKAIQLNPSYIRAIL---RRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQ 286
44 -37.600FL10982A YP_322623.1 376244 Purified-2007-05-11  ali follow..  3...........................................................................................................................................................................................................................................................................................................................................................FANSLENQLQQWNEVISKQPNNPNAYIRRGMV-QFQLAKIEESIDDFDTAEKLDNRIKPYLWQRGLSYYYADRFAEGAQQFEIDLTVNSQDVEETV---WRYLCMARLVGVTEARNNLLT---VKNDPRLIMRSVYDLFAGHCTPDNVFNIGQTEGNKGKFY--SHLYLGLYYEAENNLPLAQEYIVKAADK 185
45 -37.500MA16038A NP_000310.2 399867 Selected-2008-12-22  ali follow..  14  338...............................................................................................................................................................................................................................................................................................................LQEGDLPNAVLLFEAAVQQDPKHMEA----------QYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVS-FTNESLQRQACETLRDWLRYTPAYAHLVTPAEESLLSDSLFLEVKELFLAAVRLDPTSIDPDVQ-CGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNM 577
46 -37.500FP12946A NP_905403.1 382794 Purified-2007-12-11  ali follow..  15  31.................................................................................................................................................................................................................................................................................VTNSEKSNLSTDPDHVNRQADTLKFDAIRAMNMGELVFATEALRKAMELRPEFETR----------YYLTEALLRRHLTEEALAQMNLLLEEVPMHTATLLNRAKLRMKDMKNLKDALCLLKQAIEKNDAFIPARLLRARILIDLERYEEATQDLDWVAASDPEEEQVPM---LRARLFMLEGKQQNAIQAYEELLSLDPFNEEGHCGIATLMIKEGRSAEAETFLREAIEEMPVQRNLILMLVEILENKGQTQEAAEWRAKLPEA 319
47 -37.500FL10979A NP_103882.1 376240 Purified-2007-04-13  ali follow..  10  2......................................................................................................................................................................................................................................................................................................................FSQTIFFGMKQSARGVS---------VAFSTLQEASMHKRVLIQAASALLALQFMAVPVFAAGSSGGGVTQCKKGEVWDKKKKKCVAPQEGMLDDDSIYDAGHALAMAGRYDEAISVLTLA--ANKQDPRIL---NYLGYSHRHSGRVTVGLGYYEEALRIDPNYTLVREYLGEAHLQIGDLAGAQQQLMEIEKRTGKGSREYGMLS----------EQIDHFMRS... 207
48 -37.300MM4349A 18204569 354728 Selected-2002-07-05  ali follow..  17  2.........................................................................................................................................................................................................................................................................................................................................................................GTPNDQAVLQAIFNPDTPF-VVGLDLEEAEEGDEDGVQAQLEHSKALELQGVRAAEAGDLHTALEKFGQAISLLPDRASAY---NNRAQARRLQGDVAGALEDLERAVTLSGGRGRAFVQSGLLARFQGRDDDARRDFEKAARLGSPFARRQLVLLNPY--AALCNRMLADMMGQLRA 181
49 -37.300FL11323D YP_298617.1 375994 Purified-2007-05-09  ali follow..  10  32................................................................................................................................................................................................................................................................................................................ARGPGSQYRFSFQDLLLFRTAQSLRAANV-VVRSLKRLDALATGRPLTGIRITALGGSVAVKDAHGPWQAETGQR-IMDFDTPDRSA----PVLPLSPLPATAVGLSGHELFEREDPEEAELAYRRAIAADPGLLDAYV---NLGCLLCDRARYADAVDLYRAALEQGLDGPLIRFNLAVALEDSGYAEAALAEYHACIALAPDLADAHYNAARLHEAMGDHQRAIRHFHQYRRL 267
50 -37.300GS13125B YP_001297464.1 383969 Purified-2007-12-08  ali follow..  16  93................................................................................................................................................................................................................................................................................................................LTGNSRRAANCYQKAMNLQPENK---------FFRLQFIRSLLASEDYEEARTACHGWLERDSLSATGYKYLGQA-YEGLQDAASAFLSYNIAYRRDSLDAQTVARIAGIFNNNQQFKDAVDVTEVYRLSDTTNIDVNR---QNAKAYCMLKEYGTAVKRYESLKELGDRSFLTLYYLGVSHYGDNWFYGAYDNLKEAYQKNPMDVNVLYYLAKASARTSWKKEGVEYMEEAFRI 314
51 -37.200GS13827A NP_809813.1 384130 Selected-2007-09-11  ali follow..  12  138...............................................................................................................................................................................................................................................................................................................FNLDKNKEALQFFATYVESASYPMLAE--TLLAQIAYYATLAADRVGDKDAIIKYAPAALDDKDGGKFAMQLMADA-YKAKGDTAAWVKSLEEGILKFPGNDYFFANLVDYYTSSNQASKAMEFADRMLSTDANNKLYLY---VKAYLYHNMKEYDNAIEFYKKAIAADPEYAEAYSNVGLVYLMKAQYEEAKPFYEKARALKPDQKDLWLQGLYRVYYNLNMGPEFEEIDKMMK. 398
52 -37.200MA2004D NP_598487.1 399833 Purified-2009-03-14  ali follow..  12  2.................................................................................................................................................................................................................................................................................................................DPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWHKAKSEENTKEEKRDKTTEENIKTEELSSEESDLEIDNEGVIEPDTDAPQEMGDENAEITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAIKLNPRLAILY---AKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLRE-----VQPRAQKIAEHRRKYER 239
53 -37.000MA16111A NP_055448.1 400166 Selected-2008-12-22  ali follow..  143...........................DKMDQADAQFLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRHCFVKLNKLEKARLAFSRALELNSKCVGAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYEGSLYAASEDQEKRDIAKGHLKKVTEQIQGALSAYGTATRILQEKVQADVPPEILNNVG---ALHFRLGNLGEAKKYFLASLDRAKAEAEHD-NAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAM-ARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRK 710
54 -36.800MA11323A NP_796342.2 400540 Selected-2008-12-22  ali follow..  10  505................................................................................................................................................................................................................................................................................................................SQSKISEAESAYRNALFYRSNMA---------DMLYNLGLLLQENSRFAEALHYYKLAIGSRPTLASAYLNTGII-LMNQGKTEEARRTFLKCSEIKSSVTSCLYNLGKLYHEQGRYEEALSVYREAIQKMPRHFAPQSLYNMMGEAYMRLSKLPEAEHWYMESLRSKTDHIPAHLTYGKLLALTGRKSEAEKFFLKAIELDPTKGNCYMHYGQFLLEESRLTEAAEMAKKAAEL 740
55 -36.700GS13473B YP_001301592.1 384025 Crystal|NMR-2009-04-09  ali follow..  11  141................................................................................................................................................................................................................................................................................................................DNADYNQAYTWLKEIVDEKGADTEALGLSLFSF-GVDNAFANSGAADCETLQNLYAAKIEENKDNLPYLKETISLLRRTGCQEIEAYFLASDYAYRQEPSAEAAVGLGKKAVKIKDYDTAIKYFDEAANLETDATSKADDYYMIALLLFEQNAYSKARQYCQKALEVNPNYGNAYLLIGKMYAATSKYNAAIDKFEKAKQVDPSVAEEANTLISSYRAHLPSTEEIFMHPDLEKG 438
56 -36.700GS13640A YP_001088498.1 384046 Purified-2008-01-26  ali follow..  24................................................................................................................................................................................................................................................................................................................PRESASEVAKKYIDKMNSGDYETAYSLLS-----DSKKKISIENLEEFQNILVSTKRIISYKIGKEKIIKKYKHDGKEYK-NVVKLEETFNIKNLLYKKDDSLKVNRYFVVENNKYKLLLYESFKKEFGINSMD-------AQLKLNDFGLKYFKEVDLILKKAIAINPTDSKLYYAQACNYMNFDGFPGYSDTTYNALDYKKNASNIYNLKGVILMFHKRFDEAQQYLNKALYF 262
57 -36.600GS13113B YP_001302476.1 384650 Purified-2008-06-17  ali follow..  11  144...............................................................................................................................................................................................................................................................................................................FDQKDYNKAYDFFEQYLKISDMPMFKGEAVAFMTVQFYAAVAATQLGDSQKAIAALERAKNTDYRASEVYQYLCYE-YEQAKDTVNLEKTLEEGLNKFPEEQYFLMSLINNYIYSNRNEKAIEYLNTAIAKDSNNPQLYD---VMGRVYTGLKDYAKAEEYFKKALAINPDYIESLSNLGRVYYNQGVFKQALPYFEKAHQMKPEEREYMTALRGIYYNLNMGDKFDAIEAEMNK. 405
58 -36.500CL3474A 16411967 359358 Purified-2005-09-01  ali follow..  13  1....................................................................................................................................................................................................................................................................................................................MEKDKKIPAKIYPFYPNGQFY----------FERGVEAFRDQRIKEAIRYLVRASELEPGEAVILCQLAIC-YTEIGQFHKSNQLLREVLEQRNGNEYCYYFIANNFAYMKDYRRALQYANRYLDSSTDGEQEFYSYKKEINRYLAEEDSASACDILRKVIDEKPNFWPAYNQLASLYFEQLKEEEGVRVLSDLLSRNPGNLLGICDLFIYHFYKGNRKEADELYLELRDV 251
59 -36.300CL5948A NP_880893.1 359157 Selected-2005-05-20  ali follow..  13  14......................................................................................................................................................................................................................................................................................................................................................GSGSPMVSSIHPSEPIQPMEHVLEEADARLLTEVGFL-AAAVSDLTRADAIFNALQRVRPGRTHPCIGLAVARMNAGLPDEAAEILANFQPAQP--EDRSELDAWCGFALLLAGRSDEARRMLQRAIDAGGEAARLAQVVLDSGPAMMRPAPLQS---EPLPGAPG............................... 173
60 -36.300GS13473A YP_001299842.1 383997 Crystal|NMR-2008-12-17  ali follow..  12  105.........................................................................................................................................................................................................................................................................LMKVHDQRIQYLDDLNKLVKRDATKGSIIGMKAHDYFTMGGQDMNEAYNMFKEAIELEKENSDYFVLQEFMDANIDAFFINSGVATCDNLQAIYAPKVEQNKTNLDYLKQVISVMQMLN-EQEAYFAASEAAHAIEPT-AETAVGCGYMYYKKGDMDKCIDYFDQAINLEQDPLKKADYAYKTAAILFSKKQLSKAKQYALKSISLDGNNGKPYILIANMYASKCTYFAVIDKLQKAKSVDPSVAEEANKLIGTYAAHTPKDADL--FFLSLKK 434
61 -36.200GS11148A RER070207002363 384000 Purified-2007-11-28  ali follow..  14  43...............................................................................................................................................................................................................................................................................................................IENGSYDDAVDAFQKALDQSVGSVG----AEELDICYYKAKAQYLSGDVDGAIDTYTAIIDYNKD-SDAYYLRGCI-YFAKNDSDKGLKDFKTALSENNDNYELYLGVYETLSKYGMNDQGKEYLDNALKLKAKTADDYM---QRGRIYTMLGDYDSAIKSLQKAI--DEKLVKANYYMGEVYQKKGDNDSSQKYFKKYLDSGEADSYELMNMGQAQMDNGNYDTAITYFQNALEL 267
62 -36.200FL10744A YP_562933.1 375606 Purified-2007-05-09  ali follow..  16  100...............................................................................................................................................................................................................................................................................................................IQLGNPETALERLIHASELSPETEILYLLARTQY----------QLKNFELAVSTLTALADSDAKYAPAHSLLSQI-YMDIEQWADAQASAAKALALDPNNVTANITIGFITLNSNQYDQAARHFSQALNVNDESCRTHL---GLAIIDVFQQRYVEAEQHLLKALSLQNDLLPGINLLGWLYLLTDRFALARDVFDRGVEVDRSYAEMYGGIAIVDILEKDETAARKNVAIALRL 321
63 -36.100GS13113C YP_001300548.1 384002 Selected-2007-09-11  ali follow..  142...............................................................................................................................................................................................................................................................................................................YNKGDYADALKYFGLFVDVVNEPMFAD--TLNALYACYATLAANMLKDNQAVIKYGNIGKNHKEEGYRALMCLAETYGQKEGDSAKWLEVIKEGTESFPKQEYFVGNIMDYYIQKGMVDEGLAQINKLLATSETPYYLY----VKGILLYEKKQYDDAVAIFNKIISNNGDLAEAYSKIGDCYFFPAQYEKAKPYYEKAKELKPDNKALWGNYLLNIYWKLNRAE-YDSLEKELG. 404
64 -36.000MA16021C NP_598556.1 399838 Purified-2009-03-14  ali follow..  13  93..........................................................................................................................................................................................................................................................................................................................................................DEEYLIELEKNMPEEEKQKRREESAKLKEEGNE-RFKRGDYMEAESSYSQALQMCPDRSVLFSNRAAARMKQDKKETAITDCSKAIQLNPTYIRAIL---RRAELYEKTDKLDEALEDYKSVLEKDPSVHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQ 286
65 -36.000FL6249A YP_292557.1 375549 Purified-2007-04-20  ali follow..  1...........................................................................................................................................................................................................................................................................................................................MDGSSQEGEKKK--------KVYEVKTFPISFALGENQENITITTQTPS--KPSKEKKFHKARM-LHKQGKIAEAKKYYQQLINEGFNDHRVFSNYGVILAQLGKLKEAEISTRKAIEMQPNYAEAH---SNLGIILNDLGKLEEAEICQRKAIKIKPNLTGAAWNLYGL---ANTIKEAEERVNQVLKIDENHVEAQLHLSALKLHQGDQSLFDNLTKSTHK. 206
66 -35.900MA11323B NP_689801.1 400281 Cloned-2009-02-19  ali follow..  11  473............................................................................................................................................................................................................RNGDWQNEEMLYRSGIKVNPAKAWGNLGNVLKSQSKISEAESAYRNALYYRSNMADMLYNLGLLLQENSRFAEALHYYKLAIGSRPTLASAYLNTGIILMNQGRTEEARRTFLKCSEIPDENLPHAHKSSVTSCLYNLGKLYHEQGHYEEALSVYKEAIQKMPRQFAPYNMMGEA-YMRLSKLPEAEHWYMESLRSKTDHIPAHLTYGKLLALTGRKSEAEKLFLKAIELDPTKGNCYM---HYGQFLLEEARLIEAAEMAKKAAELDSTEFDVVFNAAHMLRQASLNEAAEKYYDLAARLRPNYPAALMNLGAILHLNGRLQKAEANYLRALQL 808
67 -35.800MA16074A NP_001026853.1 400307 Cloned-2009-02-26  ali follow..  12  63................................................................................................................................................................................................................................................................................................................LDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTSIEYSELDCEEGWT-QLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPESTDVLKQAIELSPDNQYVK---VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQESEASGNKEMIEA 309
68 -35.800FL11344A NP_111723.1 375350 Purified-2007-06-18  ali follow..  16  19...............................................................................................................................................................................................................................................................................................................IAAGNYAEAIEKIDKAIDKEPRNP---------SLHLIRADALYRQGNYSSAIEELNFTEHMDKNNPELFSLKSIC-YGSMGDFKRSKEEADKAIKADQSYPFAYYNRAAALRGLGDVDGAEKDFRKYIEMQPSDPDPHY---DLAEIYFEKKDYKKAMEEVKAVLRNDKSNEKAYDLLTDGLIGIGSYDTAEDILKQFIKVYEKEPYLYDLLARTYDQEGKAKEADETYNTLLRL 274
69 -35.700MA2004C 13278497 399832 Selected-2008-12-22  ali follow..  11  112................................................................................................................................................................................................................................................................................................................THDSLSQESESDEDGIRVDSQKA---------LVLKEKGNKYFKQGKYDEAIECYTKGMDADPYNPVLPTNRASAYF-RLKKFAVAESDCNLAIALSRTYTKAYARRGAARFALQKLEDARKDYEKVLELEPDNFEATNAEKDLGNGFFKEGKYEQAIECYTRGIAADRTNALLPANRAMAYLKIQRYEEAERDCTQAIVLDGSYSKAFARRGTARTFLGKINEAKQDFETVLLL 381
70 -35.700MA2004H NP_078880.1 400162 Cloned-2009-02-26  ali follow..  11  111................................................................................................................................................................................................................................................................................................................THESLSQESESEEDGIHVDSQKA---------LVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASA-YFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLL 379
71 -35.600MA11323C NP_001008238.1 400194 Cloned-2009-02-26  ali follow..  11  1..........................................................................................................................................................................................................................................................................................................................................................................MEGQRQESHATLTLAQA-HFNNGEYAEAEALYSAYIRRCA-------------------CAASSDESPGSKCSPEDLATAY--NNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRNVAKN..... 150
72 -35.600MA2004E NP_058017.1 399849 Purified-2009-03-14  ali follow..  1..........MEQVNELKEKGNKALSAGNIDDALQCYIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDAALEFLNRFEEAKRTYEEGLKHEANNVQL--------KEGLQNMEARLAERKFMNPFNLPNLYQKLENDPRTRSLLSDPTYRELIEQLQNKPSDLGTKLQDPRVMTTLSVLLGVDLGSMDEEEEAATPPPPPPPKKEPKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCREEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAE----------HRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNE-CFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYT---RKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLEQMQKDPQALSEHLKNPVI 527
73 -35.500TM1449 TM1449 283307 Purified-2003-09-16  ali follow..  10  2............................................................................................................................................................................................................................................................................................................................................................................VSSEFEEAYRELE------EGKLESALEKFLKIAE-KEQSVEVWVNIGNIYRRMNLLAKAIESYKRALEIDQKNPVVLF---NLGSAYYQMGKFFEALKLLEKAEEQGLTDPRVKIVKALCKIKLNLPDEGLDEDQKRIVKDLMKN............................. 139
74 -35.500CL6230A SMU.1453C 359624 Diffraction|HSQC-2007-08-31  ali follow..  96................................................................................................................................................................................................................................................................................................................SLGKFETAIEFLEKAVEIEFDETTV----------FEVATLLYDQEEYQRANLYFKQLDSMNPDFAGYEYNYALS-LHAEHQTKQALRMLQQGLSKNEFDSQLLLLASQLSYELHDKKAAENYLLKVLETAEDDEEALM---RLSNLYLEENRFEDVINLDRAD----IDSVLTKWNIAKAYQKLEADTKALEIYDTLIVDLADNPDFLKDYIYILRKFGYDEKVKTFADKYLQL 312
75 -35.500MA16074B NP_036552.1 400029 Purified-2009-03-27  ali follow..  51...........................................................................................................................................................................................................LALYNLLAYVKHLKGQNKDALECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEF--NIGYAITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALK-LQDVHAEAEGEKYIEEILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTPTSSFLHHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDIFRKALRLENITDDHKHQIHYHYFHRKSENTAIHHYLEALKV 406

FFAS is supported by the NIH grant R01-GM087218-01
6 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Bourne PE, Allerston CK, Krebs W, Li W, Shindyalov IN, Godzik A.,Friedberg I, Liu T, Wild D, Hwang S, Ghahramani Z, Chen L, Westbrook J. The status of structural genomics defined through the analysis of current targets and structures. Pac Symp Biocomput. 2004;:375-86.