current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

283508
Query: TM1651 TM1651 283508 Purified-2001-12-11, from JCSG0408

Results of FFAS03 search in COG0408
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680
# Score Template Links and tools%idFirst MGGLQNVRSAALIGHNGSGKSLLLAQILYKSGLIDKADTKYVDYDPVEEEKGASFSSHVASLEWKGKKVYLIDTPGFSDFISEVINGIFVSENIISVVNAVAGVEIQTERTWNMADEMKKPIIVFVNQMDKERANFENVVAELKERFSRKIVPVVVPIGAAENFEGVVDLLKKKAYRYDGDKVQEEDMPESFNDMRSEILEDIVEQDEELMMRYLDGEDIGYDELMRVLKEGYKKGEIVPVLSGSALKGIGLDLLLDYLGDIGVSPEEAPSYKALLEDGTEIEVKFSEEEPFCAYIFKSVVDQFVGRITFAKVIAGVLRPGDTVVNVQKDVTEKVGHVYVPILKQQKEVESAGPGEIVVLLKLKEGAVGETLAHRDRRVKIVPPAFPEPMFSRSVHPKSKSDIDKISSGLSRLSDSDPTFVWEYDPETGETVVSGLGAMHLDVMIERLKKIFGVDVEVGKPKIAYRETITTTAVAEHKHKKQTGGHGQYGHVKIQLEPLPRGQGYEFVDKIVGGVIPRNFIPSVDKGIREAMKKGVLAGYPVTDVRVILFDGSYHEVDSSDISFQIAAIQAFKKGMEAAKPVILEPIMEVEVFVPEENAGDVMGEISSRRGRPLGMEPSGKGMVKVKAEVPLAEMLDFSSKLSSITSGRGYFTMRFQRYEIVPPNIQEKIIEERRREMQEQEKLast
1 -174.000[J] COG0480 Translation elongation factors (GTPases)  ali follow..  38  4INPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEAVTDWMDQERERGITITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYRVHEQMRDRLRANAIAIQLPIGSENDFKGIVDLVRKRAYMYNNDQDIPADLQDQVEEYYTKLVEAVAETDDDLMSKYFDGEPLTEEEIRSALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVDYLPAPTEVPPIQGTLPNGDAIERRADDNEPLAALAFKIMADPY-GRLTFVRVYSGVLKKGSYVLNATKNKKERISRLVLMKADDRQDVEELRAGDLGAALGLKDTLTGDTITDEGAPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKPVTVEGKFIRQSGGKGQYGHVVINLEPGEPGTGFEFVSKIVGGVVPKEYIGPAEQGMKESCESGILAGYPLIDVKATLVHGSYHDVDSSEMAFKIAGSMALKEAVLKASPVLLEPMMKVEVEVPEDYIGNVIGDLISRRGQIESQSTEQ-GLAKVASKVPLATMFGYATDIRSKTQGRGIFTMEFSHYEEVPRSVAETIIAKSKGN...... 691
2 -157.000[J] KOG0465 Mitochondrial elongation factor  ali follow..  30  64IGRCNKLRNIGISAHIDSGKTTFTERVLYYTKRIKAIHEAKMDSMDLEREKGITIQSAATYCSWKNYHFNLIDTPGHIDFTIEVERALRVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGSDPFRAIEQLNSKLKIPAAAVQIPIGSESSLSGVVDLINRVAIYNKGDNPVPENLKPLMEEKRQLLIETLADVDDEMAEMFLEEKEPTTQQIKDAIRRSTIARSFTPVLMGSALANTGIQPVLDAIVDYLPNPSEVLNTALDSNNEAKVNLVPAVQQPFVGLAFKLEEGKY-GQLTYVRVYQGRLRKGNYITNVKTGKKVKVARLVRMHSSEMEDVDEVGSGEICATFGID-CASGDTFTDGSVQYSMSSMYVPDAVVSLSITPNSK-DASNFSKALNRFQKEDPTFRVKFDPESKETIISGMGELHLEIYVERMRREYNVDCVTGKPQVSYRESITIPADFDYTHKKQSGGAGQYGRVIGTLSPVDDITKNIFETAIVGGRIPDKYLAACGKGFEEVCEKGPLIGHRVLDVKMLINDGAIHAVDSNELSFKTATMSAFRDAFLRAQPVIMEPIMNVSVTSPNEFQGNVIGLLNKLQAVIQDTENGH-DEFTLKAECALSTMFGFATSLRASTQGKGEFSLEFSHYAPTAPHVQKELISEFQKKQAKK.. 761
3 -148.000[J] KOG0469 Elongation factor 2  ali follow..  24  13MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAAGETRFTDTRKDEQERCITIKSTAISLFFNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATGSGLHGWAFTLKQFAEMYAGKKWSSTQTDESKRGFCQFVLDPIFMVFDAVMNIKKDKTAALVEKLGIKLANDEKDLEGKPLMKVFMRKWLPAGTMLQMIAFHLPSPVTAQKYRMHDDEAAVAIKTCDPNGPLMMYISKMVPTSDKGRYAFGRVFSGKVATGMKARIQGPNYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQLVKGGTITTYKDAHNMRVMKFSSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCI-FEESGEHIIAGAGELHLEICLKDLEEDHCIPLKKSDPVVSYRETVQSESN----QICLSKSPNKHNRLHCTAQPMPDGGPNLLMDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRFNVHDVTLHADAIHRGGGQITARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKDTRKRKGLKEG 841
4 -140.000[J] KOG0468 U5 snRNP-specific protein  ali follow..  21  125MDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMERYTDTLFTEQERGCSIKATPVTLVLQDYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCINKIDRLILELKLPPQDAYFKLKHIVSPILGNVCFASSLYGFCFTLKSFAKLYADTKTRKFSKKQPHNSAQRSFVEFILEPMYKLIAQVVGDVSDTLAELNVRVSKEEMKSNIRPLLRLVCNRFMGDSGFVDMCVEHIKSPLENAKRKVKEGDIYRDMISCNQYGTLMVHSSKMYNDDCTFFQVLARIVSGTLHAGQEVRDEEDSRILQVGRLWVFESRYKVELNRVPAGNWVLIEGIDQCIVKVDINVPEDLYIFRPLKFTQSIIKIAVEPVNPSELPKMLDGLRKVNKSYPLLSTRVE-ESGEHVILGTGELYLDCVMHDLRKMYEIDIKVADPVVAFCETVVETSSLKEPLEKGLAEDIENGTVCINWNKKRIGGPNILVDDTLPSEVDKNLLTSIVQGFQWGTREGPLCEEPIRNVKFKILDGVIANEALHRGGGQITARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLARRRGHVTQDAPVGSPIYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIIIRPLEPQQASH 931
5 -105.000[J] COG4108 Peptide chain release factor RF-3  ali follow..  19  9FGEVSKRRTFAIISHPDAGKTTITEKVLLFGRAIQVAGTAKSDWMEMEKERGISVTTSVMQFPYGDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPIVTFMNKLDREIRDPMELMDEVENELKIACSPITWPIGCGKEFKGVYHIHRDETILYTSGQGHTIQEERIIKGLDNPELDQ--AVGADLAAQLREELELVLGASHEFDRELFLQGELTPVFFGTALGNFGVDHMLDGLTQWAPSPMPRQAAE------RVVEASEEKFTGFVFKIQANMDPKHRDRIAFVRIVSGTYKQGMKMNHVRLGKQVNISDAVTFMAGDRARAEEAFAGDIIGLHNHGTIQIGDTFTQGE-TLKFTGIPNFAPELFRRIRLRDPLKQKQLLKGLVQL-SEEGAVQVFRPLQNNDLIVGAVGVLQFDVVVSRLKSEYNVEAIYEGVNVATARWVEVKKFEEFKRKNQSNLALDGGDNLAYIAPTMVNLNLAQER.............................................................................................................................................................................. 519
6 -77.900[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  23  2...IENLRNIAIIAHVDHGKTTLVDKLLKLSGTLDRESERVMDSNDQEKERGITILAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQIFDNLGATDEQLDFPIVYASALNGIAGLDHEKM-------------------------------------------------------------------------DDNMDALFQAIIDHVPAPVV------------------DTEGPFQMQISQLDYNSFLGVIGIGRITRGKVKSNTPVVAISDDGSKRILKIMGHHGLQRVEVAEAEAGDIVCVSGMEELFISDTLCDPQNVEALPPLTVDQPTVSMTFQVNDSPFAGRIKERLEKELLHNVALRVEPGDSPEKFKVSGRGELHLSVLIETMRRE-GFELAVGRPEVVIIEKD---------------------------------------------------------------------------------------------------------------GEKQEPYENVTIDIEEQHQGSVMEQMGLRKGDLSNMIPDGKGRVRLEYTIPARGLIGFRNNFLTLTSGTGILTSTFSHYGPIKAGEVSNRQN........... 485
7 -75.800[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  25  36EFTPDKIRNFGIVAHVDHGKSTLADRLLEMCGAVPPGQKQMLDKLQVERERGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEKNIQIIPVINKIDLPGADIKSVETQLKNLFEFNP---------------------------------------------------------------------------------------EECLHISAKSGLNVDKVLEAIIDRVPAP------------------TAIIDAPFRSMIFDSYFDHFRGAIAHIMVKEGSVKKGDKIQSYQNEKVYDVSGVMRPEMVKCTELRAGQVGYLVCMRTVNEAVVGETLFAETTSKTFAEIKGVKPTVYAGLFPVETSDYESLKQAVERLCLNDPSVTVIPDSSKAL--IGFLGVLHMEVFGARLSQEYDASVILCQPSVEYRAKIK--------------------------------------------------------------------------------DNETIRKKRYDGMEEIRILDPSKFPDESDVDSFLEPMVKVRMIVPNEMMGTVNGLCSECRGERGEITSIDSTRLVILWRLPLAEAVDFFERLKKLTSGYASFDYEPDGWQDTRLVKLTILINS.......... 534
8 -75.000[M] COG0481 Membrane GTPase LepA  ali follow..  23  1...MKNIRNFSIIAHIDHGKSTLSDRLIQTCGGLREMEAQVLDSMDLERERGITIKAQSVTLNYKTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRC---------------------------------------------------------------------------------------SAKTGVGIEDVLEEIVHKIPAP------------------EGDPNAPLQALIIDSWFDNYLGVVSLVRIKNGTLRKGDKIKVMSTGQSYNVDRLGIFTPKTTILNCGEVGWVVCAIKDILGAPVGDTLTSHNNPASLPGFKKVKPQVYAGLFPISSDDYEAFRDALGKLSLNDASLFYEPENSTAL--CGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVEKT--------------------------------------------------------------------------------DGEVIYVDSPSKLPPLN-----------NITEIREPIAECNMLLPQTYLGNVITLCVEKRGVQTNMVYHGNQ-VALTYEIPMGEVLDFFDRLKSTSRGYASLDYGFKRFQAADMVRVDIMIN........... 488
9 -30.800[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  16  178....PRSPVVTIMGHVDHGKTTLLDKFR--------------TQVAAVETGGITQHIGAFLVSLPGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKVKKELLAY-----------DVVCEDYGGDVQAVPV-----------------------------------------------------------------------SALTGDNLMALAEATVALA----------------EMLELKADPNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCW-----AKVRLMFDENGKTIDEAYPSMPVGITGWRDLSAGEEI------LEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAKAREKYGHLLWKKRSILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDASHECELELVHFGVGDISANDVNLAETFDGVIYGFNVNAGNVIQQSAAKKG---------VKIKLHKIIYRLVEDLQEELSSRLPCAVEEHPVGEAS-----ILATFSVTEGKKKVPVAG-CRVQKGQL----EKQKKFKLTRNGHSLTSLKHHKDDISIVKTGMDEDNMEFQVGDRIVCYEEKQIQAKTSWDPG.... 726
10 -28.700[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  18  47FVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLGQ--YSQIDKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKQVVYINKVDMVEPDMIELVE---------------------------------------------------------------------------------MEMRELLSEYGFDGDNTPIVSGSALCALSITKLMEAVDSYITLPER------------------KTDVPFLMAIEDVFSISGRGTVVTGRVERGTLKKGAEIEIVGYGSKTTVTGIEMFKK----QLDAAVAGDNCGLIKREQLKRGMIVAQPGTVAPHQKFKARRTGFVDKYRPQLYSRTSDVTVELTHPDPNDSDKMVMPG-DNVEMICTLIHPIVIEKGQRFTVREGGSTVGTA................................................................................................................................................................................................................................ 432
11 -26.000[J] COG0050 GTPases - translation elongation factors  ali follow..  20  6FERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYG----QIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIVFMNKCDMV-------------------------------------------------------------------------DDEELLELV-------EMEVRELLSAYDFPGDDLPVVRGSALKAAKIIELAGYLDSYIPEPER------------------AIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVGEEVVGIKDTVKSTCTGVEMFR----KLLDEGRAGENVGVIKREDIERGQVLAKPGSIKPHTTFESEVYILSKDEGGRHTPFFKGYRPQFY-FRTTDVTGTIELPEGVEMVMPGDNINMIVTLIHPIAMDDGL...................................................................................................................................................................................................................................... 373
12 -25.800[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  17  21AQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIKRHGTQLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVINKMDLV-------------------------------------------------------------DYSEETFTRIREDYLTFAGQLPGNLDIR----------------FVPL---SALEGDNVAPTLLEVLETVEIQRV------------------VDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVLPSGVESNVARIVTFDG----DREEAFAGEAITLVDEIDISRGDLLLAADEALPAVQ-SASVDVVWMAEQPLSPGQSYDIKIAGKKTRARVDGIRYQVDINNLTLPLNGIGLVDLTFDEPLVLDRYQQNPVTGGLIFIDRLS....................................................................................................................................................................................................................... 425
13 -25.200[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  16  2........IIVTSGHVDHGKTALLKALTGTS----------TAHLPEEKKRGMTIDLGYAYLPLENKVLGFIDVPGHEKFLSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILRQLQFHEIVVITKADRTNSA-------------------------------------------------------------------------------------QIESLIQTIKQDYSFLRNANYFVTSAETGQGISELRHYLANLAEL--------------------ADTQKPFRYAIDRVFSVKGAGTVVTGTAFSGTVKVNDEIY-LSTGQKIRIKAI-----AQNTSSEQGIAGQRLALLDRTPMKRGDWLLQNEPLPPTDRIYHGASRTTGKLTLLQGKNAAKNDRTLAEIILDSPLF-ILRSGDTKTLIAGAR....................................................................................................................................................................................................................................................... 339
14 -24.900[J] KOG0458 Elongation factor 1 alpha  ali follow..  14  161VKSALPHLSFVVLGHVDAGKSTLMGRLLYDLNIVETMGKSIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNADGQTKEHMLLASSLGIHNLIIMNKMDNVDWS-QQRFEEIKSKLLPYLVDIGFF------------------------------------EDNINWVPISGFSGEGVYKIEYTDEVRQ-------------------------YNGPNLMSTLENAAFKISKENE----------------GINKDDPFVLEIIPSKKTSNDLALVSGKLESGSIQPGESLTIYPSEQSCIVDKIQVGSQQGQSETDVAIKGDFVTLAYPEDIQNGDLAASVDYSSIHSAQCFVLELLLPGTPFILFIGVKEQPARIKRLISFIDKGNTASKKKIRHLGSKQRAFVEIELI............................................................................................................................................................................................................................................... 572
15 -24.100[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  15  1MKNQSEI-NIGLVGHVDHGKTTLTKALSGVWTDTHSEETKITFRKCPQCEAPMCYTTAEICERCGLRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCQPQTKEHLMALDVIGVKDIVVQNKIDIVSKERALESY---------------------------------------------------------------------------------REIKEFVKGTCAED--APIIPVSAQQGANIDILIETIEERIKTP------------------KRDVDKPARMYVARSFDEHLAGGVIGGSLVQGRLRVGDEIEIRPGIQVKKDGKQITGLVAGGEEMEEVGPGGLVGVLTKADSLSGSVAGEPGTPPVRHSFTMETHLLERVVGTKEETKVEPIK------TGEPLMINVGTTTTVGVVKSARADDADVVL................................................................................................................................................................................................................................................ 377
16 -24.100[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  18  1MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIQEMGKGVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGKNGQTREHALLAQTLGVKQLIVCNKMDSTEPPFS------------------------------------------------EARFTEITNEVSGFIKKIGYNPKAV--PFVPISGFNGDNMLE-------VSSNMPWFKGWAVERKSGKTLLEALDSIIPPQRPT-------------------DRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEMHH----ESLPEAVPGDNVGFVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPQISNGYTPVLDCHTAHIACKFNELKEKVDRRTGKKVEDFPKFLKSDAGIVELIPTKPLCVE.................................................................................................................................................................................................................................. 413
17 -23.800[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  12  43........NIGTIGHVAHGKSTVVKAISLERNITIKLGYAQLDDPSCPRPECYRSCGSSMPDEFPVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCQPQTSEHLAAIEIMKLKHLILQNKIDLVKER-------------------------------------------------------QAKEQYEQILAFVQGTVAE-----------------------------APIIPISAQLKYNIEVVCEYIVKKIPVPPR------------------DFTSEPRLIVIRSFDDDLKGGVAGGSILKGVLKVGQETEVRPGIVSKDSEGKLMCKSAEHNDLQYAAPGGLIGVLCRADRMVGQILGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVL................................................................................................................................................................................................................................................ 429
18 -23.700[J] KOG0459 Polypeptide release factor 3  ali follow..  17  95EANKKRHLNVVFIGHVDAGKSTIGGQILFLSGQVKDKSREIMDTNEEERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEGGQTREHVQLAKTLGVSKLIVVNKMDDPTVNWKERYDEIEQKMVPFLKASGYNTKKDVVFLPISGLMGKNMDQRMGQEICP------------------------------------------------------------------SGPSFFEVLDSIEIPPR------------------DPNGPFRMPIIDKFKD--MGTVVMGKVESGSIREGDSLVVMPNKEQVKVVAIYCDE----DKVKRAGPGENLRVIEDEDILSGFVLSSIVNPVPAVTEFVAQLQIKAILHIHAVVEECEIIELKSQI---DLKTRKPMKKKVLFVKNGAAVVCRIQVTNSICIEKFSDFPQLGRFTLR-GKTIAVGKVTELLSSVSSA....................................................................................................................................................................................................... 532
19 -23.000[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  19  4MASQKPHLNLITIGHVDHGKSTLVGRLLYEHGEIEQKGKAVMDRFKEERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREGVMEQTREHAFLARTLGVPQMVVINKMDATSPPYSEK-------------------------------------RYNEVKADAEKLLRSIGFKDISFVPISGYKGDNVTKP------------------------------SPNMPWYKGPTLLQAL-DAFKVPEK------------------PINKPLRIPVEDVYSITGIGTVPVGRVETGVLKPGDKVIFLPADKQGDVKSIEMHH----EPLQQAEPGDNIGFIAKNDIKRGDVCGHLDTPPTVVKAFTAQIIVLNHPSVIAPGYKPVFHVHTAQVACRIDEIVKTLNPKDGTTLKEKPDFIKNDVAIVKVIPDKPLVIE.................................................................................................................................................................................................................................. 396
20 -21.300[R] COG5258 GTPase  ali follow..  20  109........TVVALGNVDAGKSTLVGVLTVLTGRTSAVSLRLLFSGDKVVNHGLIDPLDEAEYKRSDKLVLLVDVGGHERYLRTALRGLFSPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEFQKTVEEVVRILKMPGV---------------------------------------------SKIPYIIKDTNDVVLA----------------AKAMPAGRVAPVFYVSSVTGHGLDLLLRFLSLLPRRR------------------RWDYGGEFLMYISDIYLVKGVGVVIGGLVEKGILHVGDRVWLGPYSDGKWMQTVVKSIHFNRTPVESAKAGSFITVAKVEKVEKGMVLSARP................................................................................................................................................................................................................................................................................................................... 425
21 -18.700[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  18  53....TKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSM------EPNEGTFVLHNENNTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAAS-ASVIKNKTPVLLCCNKTDKVTA---HTKEFIRKQMEKEIDKLRVSRSAIST----ADIANDFTLGIEGEVFSFSHCHNKVTVAEASGLTGETDQVQEFIREHVK................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 259
22 -17.800[E] COG4917 Ethanolamine utilization protein  ali follow..  17  1......MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAV------------------------EFNDKGDIDTPGEYFNHPRWYHALITVDMLIYVHGANDPESRLPAGLLDIGV--SKRQIAVISKTDMPDADVAATRKLLLETGFEEPM-FELNSHDPQSVQQLVDYLASLT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 146
23 -17.400[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  19  448.........VTIMGHVDHGKTTLLDRFRESRVTEGEAG-------------GITQHIGAYQIKANGKKITFLDTPGHEAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPQRVTQELTEH-----------------------------------------------------------------------------GVFPVAWDPENGSEFVEI---SAKFNQNLDELLDTVL-----------------VAEVQELKADPTVRAIGTVVEARLDQGKGAIATLLVQQGTLHVQDPIVVGNT------GRVRTMTNDLGRRIKEAGPSTPIELTGLSDVQAGDHFAVFEDEKAARAAEGQTKSVNIIIKADVQGSAEALAASLQKIEVEGVKVDI---------VHSAVGAIS-DISLAAASNAFNVRPTGLAREQAAQEEVD-----------------LHSIIYKVIEEVETAMRGMLDPEFKEEIIGEAIVRETFN----VSKVGTIAGFMVIRGKVAIHDGAIASLKHFKDDVKEVGN.................................................................................................................. 913
24 -14.000[R] COG0218 Predicted GTPase  ali follow..  13  23....DELPEIALAGRSNVGKSSFINTMLNRKNLAR-----------TSGKPGKT---QLLNFFNIDDKMRFVDVPGY-CMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPGKWNKHESAIKKKLNFDPSDDFILFSSVSK-AGMDEAWD............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 189
25 -13.100[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  14  14LGLWQKEAKILFLGLDNAGKTTLLHMLK----------------DERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYD-SKRELDALLSDEALATVPFLILGNKIDIPYA---ASEDELRYHLGLTNF................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 151
26 -13.100[R] COG3596 Predicted GTPase  ali follow..  13  41.........IGIMGKTGAGKSSLCNALFAGEVSP------------VSDVAACTRDPLRFRLQIGEHFMTIVDLPGVGEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVIGERHKMLFVISQSDKAEPT--------------------------------------------------SGGNILSTEQKQNISRKICLLHELFQP-------------------------VHPVCAVSVRLQWGLRVMAERMIKCLPREPSSPVVALLQHPFRTWVAREQARDDFGETVDTILDTVSTFPLIPAPVRTIIQAVRSSVVSVARAVWDFF............................................................................................................................................................................................................................................................................................................................................................ 288
27 -13.100[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  14  15....KKEMRILMVGLDAAGKTTILYKLK----------------LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSND-ARDELHRMLNEDELRDAVLLVFANKQDLPNA---MNAAEITDKLGLHSLCATSGEGLYEGLDWLSNNIASKA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 181
28 -13.000[R] COG1084 Predicted GTPase  ali follow..  18  160....LDAFTVVIAGFPNVGKSTLLRTL---TGAEPEVADY-----------FTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEMVALENIADVIMFIFDASETCESQYSLYLGIRSVFDIPVVTVFNKMDLAENV-----KYLEEYINMVEDPLKVSAFEGRGVSKIIKKLEG.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 323
29 -13.000[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  14  19....NKEMRILMLGLDAAGKTTILYKLK----------------LNQSVVTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSAD-ARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 175
30 -13.000[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  15  12LWGSNKELRILILGLDGAGKTTILYRLQ----------------IGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTD-ASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQ..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 182
31 -12.800[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  16  10MKQKERELRLLMLGLDNAGKTTILKKFN----------------GEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSAD-CQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIRE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 140
32 -12.800[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  17  18....KEEMELTLVGLQFSGKTTFVNVI--------ASGQFAEDMIP-------TVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 145
33 -12.800[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  14  15....SREMRILILGLDGAGKTTILYRLQ----------------VGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSAD-SKDELLYMLREEELAGAILVVLANKQDMDGC---MTVAEVHHALGLENL................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 148
34 -12.700[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  15  11KSAPDQEVRILLLGLDNAGKTTLLKQLA----------------SEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSAD-TGQELAELLEEEKLSCVPVLIFANKQDLLTA---APASEIAEGLNLHTI................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 148
35 -12.500[R] COG1160 Predicted GTPases  ali follow..  11  6.........VALVGRPNVGKSTLFNRLTRTRDAL------------VADFPGLTRDRKYGHAHIAGYDFIVIDTGGEEKMAEQSLLAIDEADIVLFLVDARAGLTAADIGIANYLRQRNKITVVVANKTDGIDADSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRTSEEEQDEWEQEFDFDSEEDTALIDDALDEELEEEQDKNIKIAIVGRPNVGKSTLTNRILGEDRV---VFDMPGTTRDSIYIPMERDGQQYTLIDTAGVRKRGKVHLAVEKFSVILTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQKDRVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACATQKMTTSLLTRILQMATDEHQPPMIGGRRPGGYNPPIIVVHGNQ------MDKLPDSYKRYLSNYYRKSLKIRLLFQEGSNPFAGRKNKLTPNQLRKRKR......................................................................................................................................................................................................... 494
36 -12.100[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  77........KVAFFGRTSSGKSSVINAMLKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPG--ELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEWKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVANALEAQNRIFFVSAKE-----------VLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRSVLVDEFCSEFHPNPDVLKIYKSELNKHIEDGMGRNL------------------------------ADRCTDEVNALVLQTQQEIIENLKPLLPA--GIQDKLHTLIPCKKFDLSYNLNYHKLCSDFQEDIVFRFSLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGLASVTSRTMGIIIVGGVIIGWKLLSVSLTMYGALYLYERLSWTT---AKERAFKQQFVNYATEKLRMIV-------SSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES..... 741
37 -11.900[R] COG2229 Predicted GTPase  ali follow..  14  5........KIIFTGPVGVGKTTAIAAISDEALVQTDASASDMTL-DRKRNTTVAMDYGAISLD-EDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSI............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 172
38 -11.500[R] KOG2486 Predicted GTPase  ali follow..  17  133....DGLPEFALVGRSNVGKSSLLNSLVRRKRLAL-----------TSKKPGKT---QCINHFRINDKWYLVDLPGY-KFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKK.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 262
39 -11.100[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  14  15....KEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTV------GQNVATIPVD---SKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSD-CSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVGVKDAIEWMIVRLERNK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 190
40 -11.100[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  15  1...MKRPLIIGVGGPVGAGKTMLIERLTYLSTKGYSMAAITNDIYTKEDARILLNTSVLMCDKHPDLQLLFLESGGDNLSATFSPD---LVDFSIYIIDVAQGEKIPR----KGGQGMIKSDLFIINKVDYVGANVEVMKADTL-KSRGNKDFFVTNLKTDEGLKSVADWIEKR............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 198
41 -11.000[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  13  87.PDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPIAVMHGDEEGSIPGNALVVDAKKQFRALSVTIVDTPGGYDFTGVLEWFAERVDRIILLFDAHKDISDEFKRCIEALAGNEDKIRIVLNKSDMVDQQLMRVYGALMWSL--------------GKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLND.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 330
42 -10.900[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  11  166....PNTRTVLICGYPNVGKSSFMNKVTRADVDVQPY--------------FTTKSLFVGHTDYKYLRYQVIDTPGILD-SITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKSLFPLVIVCNKTDLMPMNISEEDRKLIEEMKSEAMKTAM--GVMSVKNAACERLLDQRVEAKMKSKKINDHLNRFHVAIPKPRDSIERLPCIPQVVLEAKAKEAAAMEKRKTEKDLEEENGGAGVYSASLKKNYMPEILDGHNVADFIDPDILQRLAELEREEGIREAGVEEADMEMDIEKLSDEQ--------LKQLSEIRKKKAILIKNHRLKKTVAQNRSTVPRKFDKDKKYTTKRMGRELSAMGLDPSSAMDRARSKSRGRKRDRSEDAGNDAMDVDDEQQSNKKQRVRSKSRAMSISRSQSRPPAHEVVPGEGFKDSTQKLSAIKISNKSHKKRDNARRGEADRVIPTLRPKHLFSGKRGKGKTDR................................................................................................................................................................................................... 670
43 -10.600[R] COG1159 GTPase  ali follow..  13  11.........IAIVGRPNVGKSTLLNKLL---------GQKIS----TSRKAQTTRHRIVGIHTEGPYQAIYVDTPG---MNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLRDGKAPVILAVNKVDNVQ----------------------------------------------------------------------------------------EKVDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPAIHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVTNERGGYDINGLILVEREGQKKMVAKIKTIGIEARKDMQEMFEAPVHLELWVK............................................................................................................................................................................................................................................................................................................................... 280
44 -9.980[P] COG0370 Fe2+ transport system protein B  ali follow..  12  5........TYCILGNPNTGKTSLFNAL---TGSYEYVGN------------GVTVEKKVGT--LRSKTGKLIDLPGIYDLNPISRDLEEKFDCMLNIVDSSQ---ERNLNLTVQLLEYGAPVVMGLNMIDVAAGRIHLNIQNLAKKLRIPILPVVA---SGKGTEDILSTLSEKH---APAIPLVLQYGEPAEKAIKEIQALTKELIPAKQSRWLAIQFLSKNEVTEAFLTSNSAFEQLQQIRAELESELNGKLENHF--------HQVRASYIHDICLTSVEYTRNSDIPLSDKLDKIFTHKLLGIPIFLGIMWLIFQITFTWVGAPLSDMLDGFIGGSLTDWVTSFLTTIGASGFIIDLVADGIIAG-----------VGGVLVFVPQILVIF--EDSGYMARIAVVMDRVME-----IFGLNGKAFIPMIIGFGCNVPGIMAARSESKERTLTILVSPFMSCSARLPVYALFVGVFFEKHQALVVLSLYVIGIKTILKKDNSVFVVELPPYRLPKTLWRSTWEKGKGFLRK---AGTFIFAGSVIIWLLNYAGPSGLDVP--------MGESFLAIIGGMLAPLLVPLGFGTWQAGATLIPGFLAKEVVVSTM................................................................... 584
45 -9.750[R] KOG0395 Ras-related GTPase  ali follow..  13  14.VPAKNSYRMVVLGASRVGKSSIVSRFL------GRFEDQYTPTIEDFHRKVYNIRGDMY-------QLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGD-VSAKKNTNVDEMFYVLFSMAKLP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 193
46 -9.710[S] COG1739 Uncharacterized conserved protein  ali follow..  10  75.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SGSAGRPILGQIDSVGITDVLVVVV---FGGTLLGVPGLIHAYKEATAQALAVAEVVEKNIEKTVWLKCEYPFLNEAIRIAKQYQADILERDLQLD--CRLTVSLSLVNYEACVAAWKNTRQIEVNTE.............................. 199
47 -9.530[K] KOG1534 Putative transcription factor FET5  ali follow..  13  6.........AFVCGVASSGKSTFCGALMYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLEIGDYDEDYLIFDMPGQIELIRHLQVTLNFRPCAVYLLESQFLVDRTK-SAMSAMVMMEVPHINLLSKMDLLKDNNNITKAELKRFLNTDP--------------------------------------------------------LLLTGEINETTNPKFHELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYIDDAT.................................................................................................................................................................................................................................................................................................................................................................................................................................... 253
48 -9.470[R] KOG0394 Ras-related GTPase  ali follow..  16  3.SRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATI-----------GADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWRESDPENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 173
49 -9.340[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  13  7.NGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATI-----------GVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRNIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYEKPFLWLARKLAGNP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 174
50 -9.280[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  17  3.EDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATI-----------GVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDTFVKLDNWLNELETYCTRNDIVNMLVGNKID......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 125
51 -9.230[E] COG1703 Putative periplasmic protein kinase ArgK and related GTPases of G3E family  ali follow..  14  57.........LGVTGTPGAGKSTFLEAFGLLIREGLKVAVIAVDPSSPVTGGSIRARELMLLCEAAGYDVVIVETVGVGQSETEVAR---MVDCFISLQIAGGGDDLQGI----KKGLMEVADLIVINKDDGDNHNVAIARHMYESALEWQPRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTE------EEVLNHLFANEDF--DRYYRQTLLAVKNNTLSPR--------TGLRQLSEFIQT...................................................................................................................................................................................................................................................................................................................................................................................................................................... 327
52 -9.210[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  14  4.VSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATI-----------GIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWRNERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKAGFNIKPLFRKIAAAL............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 170
53 -9.200[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  17  3.PEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTI-----------GVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWDRYASENVNKLLVGNKCDLTSQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIK........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 170
54 -9.190[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  14  4.EDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATI-----------GVGFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLI........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 171
55 -9.150[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  15  4.GDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDF----REKRVVYRASGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIM........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 182
56 -9.140[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  14  7.DQKSFKFKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTI-----------QASFQNKTVNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWKTCLGNTAEILIVGNKIDLEEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMI........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 174
57 -9.130[DZU] KOG2655 Septin family protein (P-loop GTPase)  ali follow..  11  37........TLMVVGESGLGKSTLVNSLF--LTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPGFGDIDEQYERFLR-IHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKEILRLKCRIMQEIESHGIKI---CGANTLLEVKGKKVRGRLYPW-GVVEVENPDHCDFIKLRTMLITHMQDLQEVTQEVHYEN.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 296
58 -9.130[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  17  3.ETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTI-----------GVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWRTLASPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTIL........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 170
59 -9.110[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  15  15.GNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTI-----------GAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 181
60 -9.060[R] KOG1533 Predicted GTPase  ali follow..  11  36.........VLVIGAPGAGKSTFCAGLTIFSQTKRPFLTINLDPANDTMAYAPDVNILLQKIEANHKKYLIIDCPGQLELYKSEGELWKVIR-ALHLADSLYCSDPSK-STLATMVTMEMPQVNCLSKADLFSEDGTYDLEFFSHL---------------PDVNRLLDLLNEVP------------------------------------------GLEKYRKLNEAICGVISDFDLVSFVPLAVENKESMMKVIQMV........................................................................................................................................................................................................................................................................................................................................................................................................................................ 277

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]