current user: public




Query: FR14793A YP_807875.1 392607 PDB-2010-07-06, from JCSG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MTPLDANVELPTEVKAMIEQSSDAQAATALVNYVIKLAAAAEIHFTDLQLQVLTNHLIEMLGRSKSGEQLPAVDPTMFAEVSQKSLDLADQVVQHIGHLEVAEKYVLSIHFEAAQDKILast
1 -55.6003nuf_A mol:protein length:119 PRD-containing transcription regulator  ali model follow..  100  2MTPLDANVELPTEVKAMIEQSSDAQAATALVNYVIKLAAAAEIHFTDLQLQVLTNHLIEMLGRSKSGEQLPAVDPTMFAEVSQKSLDLADQVVQHIGHLEVAEKYVLSIHFEAAQDKI 119
2 -32.2003gwh_A mol:protein length:111 Transcriptional antiterminator (BglG family)  ali model follow..  13  4..............RPLSEVNQHSQLMAQLVEVIEDSFQ-MKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLLLKNEYPLCYNTAWKLIKILQQVHEAEAVYLTLHLIPINQ.. 111
3 -30.9003rio_A mol:protein length:180 PtsGHI operon antiterminator  ali model follow..  12  83........................KLVDISNDVIYHISNRTNHSLNEHIHIALTDHIAFAIKRQQQGFDMKNPFLMETQSLYPEEYQIAKEVIDMINELPEGEIGFIALHIHSALTN. 180
4 -26.6001tlv_A mol:protein length:221 Transcription antiterminator licT  ali model follow..  10  16........................ECMEVSEEIISYAKLQLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLWETKRLYKDEFAIGKEALVMVKNLPEDEAGFIALHIVNAELN. 113
5 -26.3001h99_A mol:protein length:224 TRANSCRIPTION ANTITERMINATOR LICT  ali model follow..  10  16........................ECMEVSEEIISYAKLQLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLWETKRLYKDEFAIGKEALVMVKNLPEDEAGFIALHIVNAELN. 113
6 -16.4004r6i_A mol:protein length:478 Anthrax toxin expression trans-acting positiv  ali model follow..  10  179...........................QNITDLINKMEKILNVQMYTYSKHKLCVLFAITISRLLSGNTIDNVSGLILVNKNDDHYKTVASITSELQNLHETEISFLALALLLSLGN. 273
7 -7.9503f2e_A mol:protein length:100 SIRV coat protein  ali model follow..  13  2....................QTNVPKFTAVAEQVSAVLSQYGITPNRAIYQGFGLKVARALNRLGGGPALVNMINGLKAY-YISAFNANPTVLDAVTDITGSPTGYVS.......... 90
8 -6.8302qnl_A mol:protein length:162 Uncharacterized protein  ali model follow..  12  2.....................................................................MHTQEALFVRLALDAWNTQSSRTDKLIQSLSNEAGTYLLGHLTAVHDAM 61
9 -6.3003erm_A mol:protein length:91 uncharacterized conserved protein  ali model follow..  3...................................................AMAVETLYRSTRDLETTFVDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVF 69
10 -5.9602gsc_A mol:protein length:128 Putative uncharacterized protein XCC0516  ali model follow..  17  15...............................................................................DAWRDSMELVEMIYRLTEVFPDQERYGLTAQLRRAAVSI 53

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.