current user: public




392607
Query: FR14793A YP_807875.1 392607 PDB-2010-07-06, from JCSG0614

Results of FFAS03 search in PDB0614
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MTPLDANVELPTEVKAMIEQSSDAQAATALVNYVIKLAAAAEIHFTDLQLQVLTNHLIEMLGRSKSGEQLPAVDPTMFAEVSQKSLDLADQVVQHIGHLEVAEKYVLSIHFEAAQDKILast
1 -60.2003nuf_A mol:protein length:119 PRD-containing transcription regulator  ali model follow..  100  2MTPLDANVELPTEVKAMIEQSSDAQAATALVNYVIKLAAAAEIHFTDLQLQVLTNHLIEMLGRSKSGEQLPAVDPTMFAEVSQKSLDLADQVVQHIGHLEVAEKYVLSIHFEAAQDKI 119
2 -39.0003gwh_A mol:protein length:111 Transcriptional antiterminator (BglG family)  ali model follow..  13  2............SLRPLSEVNQHSQLMAQLVEVIEDSFQ-MKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLLLKNEYPLCYNTAWKLIKILQQVHEAEAVYLTLHLIPINQ.. 111
3 -30.8001h99_A mol:protein length:224 TRANSCRIPTION ANTITERMINATOR LICT  ali model follow..  14  110..........AELNEEMPNIINITKVMEEILSIVKYHFK-IEFNEESLHYYRFVTDLKFFAQRLFNGTHMESEDDFLVKEKYHRAYECTKKIQTYIERLTSDELLYLTIDIERVVKQ. 223
4 -30.1001tlv_A mol:protein length:221 Transcription antiterminator licT  ali model follow..  16  110..........AELNEEMPNIINITKVMQEILSIVKYHFK-IEFNEESLHYYRFVTHLKFFAQRLFNGTHMESQDDFLVKEKYHRAYECTKKIQTYIERLTSDELLYLTIHIERV.... 220
5 -27.6003rio_A mol:protein length:180 PtsGHI operon antiterminator  ali model follow..  12  82....................EKLVDISNDVIYHISNRTNH---SLNEHIHIALTDHIAFAIKRQQQGFDMKNPFLMETQSLYPEEYQIAKEVIDMINELPEGEIGFIALHIHSALTN. 180
6 -7.6301enj_A mol:protein length:138 ENDONUCLEASE V  ali model follow..  12  1MTRINLTLVSELADQHLMAEYRQLPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFYDKL---EFLRKRQIELIAECLKRGFNIKDTTVQDISDIPQEHEASIAISQARLDEKI 122
7 -7.0001eni_A mol:protein length:138 ENDONUCLEASE V  ali model follow..  11  1MTQINLTLVSELADQHLMAEYRELPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFYDKLE----LRKRQIELIAECLKRGFNIKDTTVQDISDIPQEHEASIAISQARLDEKI 122
8 -6.8702oqm_A mol:protein length:192 Hypothetical protein  ali model follow..  8....NLYFQGMLYDLTVVQFSKMLKNLNAIFDKAEAFAELKKVDMDVLLNSRLAADQFNLIRQVQTGQLETAPKHDDSETTLAELRQRIASVLTYLEGFSEADF.............. 120
9 -6.5903erm_A mol:protein length:91 uncharacterized conserved protein  ali model follow..  3...................................................AMAVETLYRSTRDLETTFVDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVF 69
10 -6.3103f2e_A mol:protein length:100 SIRV coat protein  ali model follow..  12  2....................QTNVPKFTAVAEQVSAVLSQYGITPNRAIYQGFGLKVARALNRLGGGPALVNMINGL-KAYYISAFNANPTVLDAVTDITGSPTGYVS.......... 90

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 2 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Reed JC, Doctor KS, Godzik A. The domains of apoptosis: a genomics perspective. Sci STKE. 2004 Jun 22;2004(239):re9. Review.