current user: public




Query: FR14793A YP_807875.1 392607 PDB-2010-07-06, from JCSG1214

Results of FFAS03 search in PDB1214
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MTPLDANVELPTEVKAMIEQSSDAQAATALVNYVIKLAAAAEIHFTDLQLQVLTNHLIEMLGRSKSGEQLPAVDPTMFAEVSQKSLDLADQVVQHIGHLEVAEKYVLSIHFEAAQDKILast
1 -56.8003nuf_A mol:protein length:119 PRD-containing transcription regulator  ali model follow..  100  2MTPLDANVELPTEVKAMIEQSSDAQAATALVNYVIKLAAAAEIHFTDLQLQVLTNHLIEMLGRSKSGEQLPAVDPTMFAEVSQKSLDLADQVVQHIGHLEVAEKYVLSIHFEAAQDKI 119
2 -34.2003gwh_A mol:protein length:111 Transcriptional antiterminator (BglG family)  ali model follow..  13  4..............RPLSEVNQHSQLMAQLVEVIEDSFQ-MKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLLLKNEYPLCYNTAWKLIKILQQVHEAEAVYLTLHLIPINQ.. 111
3 -31.1003rio_A mol:protein length:180 PtsGHI operon antiterminator  ali model follow..  12  83........................KLVDISNDVIYHISNRTNHSLNEHIHIALTDHIAFAIKRQQQGFDMKNPFLMETQSLYPEEYQIAKEVIDMINELPEGEIGFIALHIHSALTN. 180
4 -28.4001tlv_A mol:protein length:221 Transcription antiterminator licT  ali model follow..  10  16........................ECMEVSEEIISYAKLQLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLWETKRLYKDEFAIGKEALVMVKNLPEDEAGFIALHIVNAELN. 113
5 -28.3001h99_A mol:protein length:224 TRANSCRIPTION ANTITERMINATOR LICT  ali model follow..  10  16........................ECMEVSEEIISYAKLQLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLWETKRLYKDEFAIGKEALVMVKNLPEDEAGFIALHIVNAELN. 113
6 -16.3004r6i_A mol:protein length:478 Anthrax toxin expression trans-acting positiv  ali model follow..  10  179...........................QNITDLINKMEKILNVQMYTYSKHKLCVLFAITISRLLSGNTIDNVSGLILVNKNDDHYKTVASITSELQNLHETEISFLALALLLSLGN. 273
7 -7.2603f2e_A mol:protein length:100 SIRV coat protein  ali model follow..  12  2....................QTNVPKFTAVAEQVSAVLSQYGIT-NRAIYQGFGLKVARALNRLGGGPALVNMING-LKAYYISAFNANPTVLDAVTDITGSPTGYVS.......... 90
8 -6.6602qnl_A mol:protein length:162 Uncharacterized protein  ali model follow..  12  2.....................................................................MHTQEALFVRLALDAWNTQSSRTDKLIQSLSNEAGTYLLGHLTAVHDAM 61
9 -6.2603erm_A mol:protein length:91 uncharacterized conserved protein  ali model follow..  3...................................................AMAVETLYRSTRDLETTFVDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVF 69
10 -6.2204dwl_A mol:protein length:131 Bbp7  ali model follow..  2......................................................SHMEPIEEATKCYDQML---------IVERYERVISYLYPIAQSIPRKHGVAREMFLKCLLGQV 56

FFAS is supported by the NIH grant R01-GM087218-01
6 4 5 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.