current user: public




Query: FR14793A YP_807875.1 392607 PDB-2010-07-06, from JCSG0113

Results of FFAS03 search in PDB0113
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MTPLDANVELPTEVKAMIEQSSDAQAATALVNYVIKLAAAAEIHFTDLQLQVLTNHLIEMLGRSKSGEQLPAVDPTMFAEVSQKSLDLADQVVQHIGHLEVAEKYVLSIHFEAAQDKILast
1 -54.1003nuf_A mol:protein length:119 PRD-containing transcription regulator  ali model follow..  100  2MTPLDANVELPTEVKAMIEQSSDAQAATALVNYVIKLAAAAEIHFTDLQLQVLTNHLIEMLGRSKSGEQLPAVDPTMFAEVSQKSLDLADQVVQHIGHLEVAEKYVLSIHFEAAQDKI 119
2 -39.6003rio_A mol:protein length:180 PtsGHI operon antiterminator  ali model follow..  12  58YDKMFILKDEKEQKQFKKLLDYVDEKLVDISNDVIYHISRTNHSLNEHIHIALTDHIAFAIKRQQQGFDMKNPFLMETQSLYPEEYQIAKEVIDMINELPEGEIGFIALHIHSALTN. 180
3 -35.5003gwh_A mol:protein length:111 Transcriptional antiterminator (BglG family)  ali model follow..  12  5...................PLSEVNQHSQLMAQLVEVIEDMKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPLMLLLKNEYPLCYNTAWKLIKILQQVHEAEAVYLTLHLIPINQ.. 111
4 -31.4001h99_A mol:protein length:224 TRANSCRIPTION ANTITERMINATOR LICT  ali model follow..  12  1..........GAMEKFKTLLYDIPIECMEVSEEIISYAKLLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLWETKRLYKDEFAIGKEALVMVKNLPEDEAGFIALHIVNAELN. 113
5 -31.2001tlv_A mol:protein length:221 Transcription antiterminator licT  ali model follow..  13  16.........................ECMEVSEEIISYAKLLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLWETKRLYKDEFAIGKEALVMVKNLPEDEAGFIALHIVNAELN. 113
6 -9.3503f2e_A mol:protein length:100 SIRV coat protein  ali model follow..  12  2....................QTNVPKFTAVAEQVSAVLSQYGIT-NRAIYQGFGLKVARALNRLGGGPALVNMIN--LKAYYISAFNANPTVLDAVTDITGSPTGYVS.......... 90
7 -7.1603gor_A mol:protein length:157 Putative metal-dependent hydrolase  ali model follow..  1......SNAMSRAKKWVQYFLSHRHVTMELIHKIDEAHYDYKPTPTSMTAKQLATHMYNFANTAKHGDPFRQKIEEPETNLAKLAETYTEKTRQLIESMSDDDLQLAMDHEIHHKGQL 138
8 -7.0603dka_A mol:protein length:155 DinB-like Protein  ali model follow..  10  2.........MCQSNQIVSHFLSHRNVTNELAEKISKDHYSYKPAETSMSAEELVKHIHLFANVIKEGNPFQNKQEETETDLNVLAKTYTEKTVAILEQLTEEQLQLAMEHEIHHKGNL 136
9 -6.5302f22_A mol:protein length:144 BH3987  ali model follow..  11  12........................NMTNALAKEIPESKWDIQLIPELGTLRKLFIHIDVYRDGLKTGSKFPGRLASDEHRLLDELERSMEELVFEFKQTTFNSLGTVIQHEGIHQGQY 123
10 -6.4802db7_A mol:protein length:64 Hairy/enhancer-of-split related with YRPW mot  ali model follow..  12  24..........................FRECLAEVARYLSIIGLDASDPLRVRLVSHLNNYASQRE..................................................... 63

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.