current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

374753
Query: PJ05853H YP_164873.1 374753 PDB-2008-03-10, from JCSG0113

Results of FFAS03 search in PDB0113
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MDTPANKPCIICVAITGSVPTKADNPAVPITVSEQVESTQEAFEAGAAIAHCHVRNDDGTPSSDPDRFARLTEGLHTHCPGMIVQFSTGGRSGAGQARGGMLPLKPDMASLSVGSNNFPSRVYENPPDLVDWLAAQMRSYRVTPEIEAFDLSHILRAIDMHGRGLLYGKLYVQFVMGVKNAMPADREVFDFYVRMMRTRAPQAEWCAAGIGANQLTVNEWAIAAGGHTRTGLEDNIRLDRQTLAPSNAALVRRSVELCDKYQRPVASWQQAREILGLPAAARNLast
1 -116.0003chv_A mol:protein length:284 Prokaryotic domain of unknown function (DUF84  ali model follow..  100  2MDTPANKPCIICVAITGSVPTKADNPAVPITVSEQVESTQEAFEAGAAIAHCHVRNDDGTPSSDPDRFARLTEGLHTHCPGMIVQFSTGGRSGAGQARGGMLPLKPDMASLSVGSNNFPSRVYENPPDLVDWLAAQMRSYRVTPEIEAFDLSHILRAIDMHGRGLLYGKLYVQFVMGVKNAMPADREVFDFYVRMMRTRAPQAEWCAAGIGANQLTVNEWAIAAGGHTRTGLEDNIRLDRQTLAPSNAALVRRSVELCDKYQRPVASWQQAREILGLPAAARN 284
2 -113.0003no5_A mol:protein length:275 Uncharacterized protein  ali model follow..  65  2....MNKPCIISVAITGSLPRKKDNPAVPITVSEQVESTQAAFEAGATLVHLHVRNDDETPTSNPDRFALVLEGIRKHAPGMITQVSTGGRSGAGNERGAMLSLRPDMASLATGSVNFPTRVYDNPPELVDWLAAEMKTYGIKPEVEAFDLSMIFQAAAMQAAGAIVGPLHIQFVMGIKNAMPVDREVLEFYVQTLKRLSPDATWTGAGIGRHQLTMARWSLELGGHCRTGLEDNVRLDKNTLAPSNAALVRQVAELCEEYGRPVATAAQAREIMSL...... 274
3 -113.0003fa5_A mol:protein length:282 protein of unknown function (DUF849)  ali model follow..  74  2MSDPAGKPCIICVAITGSLPTKENNPAVPITLAEQVESTHEAFEAGASIAHCHVRDDEGRPTSDPDRFAALKEGLERHCPGMIVQLSTGGRSGAGQARGAMLPLCPDMASLSVGSNNFPTRVYENPPDLVDWLAAEMLKYDIKPEIEAFDLSHILQAKRMAGDGRLAGTPYVQFVMGVRNAMPADRDVFDYYIHTVRRFGEDAPWCAAGIGPSQIVLNEWAISSGGHARTGLEDNVRLDRDRLAPSNAALVGRAVELCEKYERPVATWRQARQILGLRM.... 281
4 -108.0002y7d_A mol:protein length:282 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME  ali model follow..  36  2......EPLILTAAITGAETTRADQPNLPITPEEQAKEAKACFEAGARVIHLHIREDDGRPSQRLDRFQEAISAIREVVPEIIIQISTGGAVESFDKRLAPLALKPEMATLNAGTLNFGDDIFINHPADIIRLAEAFKQYNVVPEVEVYESGMVDAVARLIKKGIIQNPLHIQFVLGVPGGMSGKPKNLMYMMEHLKEEIPTATWAVAGIGRWHIPTSLIAMVTGGHIRCGFEDNIFYHKGVIAESNAQLVARLARIAKEIGRPLATPEQAREILALNK.... 276
5 -103.0003e02_A mol:protein length:311 uncharacterized protein DUF849  ali model follow..  26  3...KQSKKIIITCAVTGSIHTPTMSPYLPITPEEIVKEGVAAAEAGAAMLHLHARDPNGRPSQDPDLFMRFLPQLKERTDAILNITTGGGLGSLDERLAPARAARPEVASMNMGSLNFNDFILSNTFSQIERGMTELGASGTRFEFECYDVGHLYNLAHFVDRKLVEPPFFLQCVFGILGGIGADPENLLHMRTIADRFGQDYYLSVLAAGRHQMPFVTMSAILGGNVRVGLEDSLYSGKGQLATSNAEQVRKIRRIIEELSLDIATPDEARAMLKTKGANET 309
6 -103.0003e49_A mol:protein length:311 uncharacterized protein DUF849 with a TIM bar  ali model follow..  27  3...GSSRKVIITCAVTGAIHTPSMSPYLPVTPDEVAQASIGAAEAGAAVIHLHARDPDGRPTQDPAAFAEFLPRIKSNTDAVINLTTGGSPHMTVEERLRATHYMPELASLNMGSMNFGDLVFKNTFADIEFILKTCGGNGTRFEFECYDTSHLYNLAHFVDRKLATPPFFVQTVFGLLGGIGPHPEDLAHMRRTADRFGADYVWSILGAGRHQIPLASIGAAQGANVRVGLEDSLWIAPGELAETNAAQVRKIRQVIEGLSLEVASPAEARTMLGLKGPQNV 309
7 -102.0003lot_A mol:protein length:314 uncharacterized protein  ali model follow..  28  3...RKDDVVIVTCAITGAIHTPSMSPYLPVTPDQIVEEAVKAAEAGAGMVHIHARDPDGRPTTDVEVFRYICREIKKQSDVVINVTTGGGGTPVEERAKVVPALKPEIATFNMGSMNFADIVFRNTFKDLEALSRIFKENDTKPELECYDIGQIYNTAFMFHEGYLEPPLRLQFIHGILGGIGTAVEDVLFMKQTADRLRENYTWSLVGAGRFQMPLGTLAVIMGGDVRVGLEDSLYIERGKLAKSNAEQVEKMVRIVKELGKRPATPDEVREILGLKGKERV 312
8 -100.0003c6c_A mol:protein length:316 3-keto-5-aminohexanoate cleavage enzyme  ali model follow..  28  10YFQGMSRKVILTCAVTGNAPFNPKHPSMPITPAQIADACVEAAKAGASVAHIHVRDPTGGGSRDPVLFKEVVDRVRSSGTDIVLNLTCGLGAPVAERVKHLEDCLPEIASLDITTGNQLEFVYLNTTRTLRAMARRFQELGIKPELEVFSPGDILFGKQLIEEGLIDGVPLFQMVLGVLWGAPASTETMIYQRNLI---PANAQWAAFGIGRDQMPMMAQAALLGGNVRVGLEDNLYLSRGVFA-TNGQLVERARTVIEHLGMSVATPDEARDIMGLSRPA.. 310
9 -9.7503t7v_A mol:protein length:350 methylornithine synthase PylB  ali model follow..  79.................YYNCRNEINRYRLTMEEIKETCKTLKGAGFHMVDLTM-GEDPYYYEDPNRFVELVQIVKEELG---LPIMISPGLMDNATLLKAREKGANFLALYQETYDYRKLRVGQSFDGRVNARRFAKQQGYCVEDGIL-ILSLRGMSTNDPDMVRVMTFLPQEGTPLEGFRDKSNLSELKIISVLRLMFPKRLIPA-SLDLEGIDGMVLRLNAGANIVTSILPPDSQLEGRDLEERDRDIKSVVRRLEIMGMKPARQADFEAVLGC...... 350
10 -8.6102yxo_A mol:protein length:267 Histidinol phosphatase  ali model follow..  10  17..............................HPEAYLEEAR---AKGLKGVVFHSDPESRMRLEALPFYLLALERVRERAQDLYVGIGLEADFHPGTEGFLAQLLRRYPFDYVIGSVHY----LGAWPLDHPDHQEEYAWRDLKEVFRAY----FQEVEKAARSGLFHAIGHLDLPFGHRLPEEALLELAEPALRAVAEAGLFLDVNTAGLRRPAPALLRRARELGIGLVLG-------SDAHRPEEVGFAFPEVQALLAGLGFREAYYFVEGSPVAYP..... 262

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.