current user: public




Query: PG9878A NP_717203.1 372361 PDB-2007-01-25, from JCSG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MEMTKVTGKFDVKLTPENAYATGVGGVNLGRMALDKTFYGELEARSQGEMLSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFGIMTDGQNRLHLEVVPHSGAGELTGLYGTMAISIENGQHFYEFSFCFEPASEVEGLast
1 -71.7002ooj_A mol:protein length:141 Hypothetical protein  ali model follow..  100  2MEMTKVTGKFDVKLTPENAYATGVGGVNLGRMALDKTFYGELEARSQGEMLSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFGIMTDGQNRLHLEVVPHSGAGELTGLYGTMAISIENGQHFYEFSFCFEPASEVEG 141
2 -61.1002q03_A mol:protein length:138 Uncharacterized protein  ali model follow..  25  6TKLQTIIGMFQITAWDETSYFESDNGAKLTQAVITQSYQGVLQGHSEIRYLMSYQD-NANATFVGFEHFTGSLGDKKGSFILQHKGLFAAGVASSEFELVERSATGDFVHLVGKGHFVSENGQANYQITLQD........ 137
3 -8.8004q63_A mol:protein length:105 Uncharacterized protein Lpg0364  ali model follow..  17  1......................................................................GHMDERRKYFRLKNHGEINASLDNNSIEIVEISSNGAVTDIPKEGVLKLQIHNFIMELCYEV........ 67
4 -8.1705btu_A mol:protein length:184 PyrI4  ali model follow..  15  93......................................SGVRLGTATGNAVVLKMEPHMWQFHQSVSELAD------GSFEAVGVIDCTAMLRRMTQVLRVTGRSGRYAGKSGFMTLAISDNQRPPHYSVQV........ 181
5 -6.7104d40_A mol:protein length:89 PILD PROCESSED PROTEIN  ali model follow..  10  25................................SRNGLYPASQSLANSPYYSFSYTPTADKFGFSLKAVPTNRQSDPCGTLSLDHKGV..................................................... 79
6 -6.4901p8k_Z mol:protein length:254 Intron-encoded endonuclease I-AniI  ali model follow..  13  9....................................................................LVGLFEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKILGIGIVSFRKRNEIEMVALRIRDKNH... 76
7 -6.4701r0u_A mol:protein length:148 protein ywiB  ali model follow..  11  29................................VIEFRTTGFYYVKQNKVYLSYYEEHDLGKVKTIVKVSEGEVL-RSGAVKMNQ--RFVTGASTIAKYKMS--GELELKTSTKSIQSDLDEEKGRISIAYDMHVGDEQEH 134
8 -6.4605cer_A mol:protein length:401 Bd0816  ali model follow..  14  251........................NGSGNNEGTTAKPIYNEATCETMIKTLYTLNKSLEAKGYKLSDVL--SVANKDSDSTIDNFGGNAAGSMIAK--------TGTVNKAKTAGSISTKEGEFYFAI............ 345
9 -6.4103uvf_A mol:protein length:255 Intron-encoded DNA endonuclease I-HjeMI  ali model follow..  14  10....................................................................LVGLFEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKDILGVGKVSFRKRNEIEMVSLRIRDKNH... 77
10 -6.3101kez_A mol:protein length:300 ERYTHRONOLIDE SYNTHASE  ali model follow..  61.........................................MADGPGEVTVICCAGTAAISGPHEFTRLAGALRGIAPVRAVPQPGYEEGEPLPSSMAAVAAVQADAVIRTQGDKPFVVAGHSAGALMAYALATELLDRG 159

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.