current user: public




Query: PG9878A NP_717203.1 372361 PDB-2007-01-25, from JCSG1214

Results of FFAS03 search in PDB1214
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MEMTKVTGKFDVKLTPENAYATGVGGVNLGRMALDKTFYGELEARSQGEMLSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFGIMTDGQNRLHLEVVPHSGAGELTGLYGTMAISIENGQHFYEFSFCFEPASEVEGLast
1 -75.6002ooj_A mol:protein length:141 Hypothetical protein  ali model follow..  100  2MEMTKVTGKFDVKLTPENAYATGVGGVNLGRMALDKTFYGELEARSQGEMLSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFGIMTDGQNRLHLEVVPHSGAGELTGLYGTMAISIENGQHFYEFSFCFEPASEVEG 141
2 -62.7002q03_A mol:protein length:138 Uncharacterized protein  ali model follow..  25  7.KLQTIIGMFQITAWDETSYFESDNGAKLTQAVITQSYQGVLQGHSEIRYLMSYQD-NANATFVGFEHFTGSLGDKKGSFILQHKGLFAAGVASSEFELVERSATGDFVHLVGKGHFVSENGQANYQITLQDS....... 138
3 -9.3504q63_A mol:protein length:105 Uncharacterized protein Lpg0364  ali model follow..  17  1......................................................................GHMDERRKYFRLKNHGEINASLDNNSIEIVEISSNGAVTDIPKEGVLKLQIHNFIMELCYEVIRAED... 72
4 -7.7401p8k_Z mol:protein length:254 Intron-encoded endonuclease I-AniI  ali model follow..  13  9....................................................................LVGLFEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKILGIGIVSFRKRNEIEMVALRIRDKNHL.. 77
5 -7.6803eh8_A mol:protein length:254 Intron-encoded DNA endonuclease I-AniI  ali model follow..  13  9....................................................................LVGLYEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKILGIGIVSFRKRNEIEMVALRIRDKNHL.. 77
6 -7.5003uvf_A mol:protein length:255 Intron-encoded DNA endonuclease I-HjeMI  ali model follow..  14  10....................................................................LVGLFEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKDILGVGKVSFRKRNEIEMVSLRIRDKNHL.. 78
7 -6.6402ml3_A mol:protein length:181 Poly(beta-D-mannuronate) C5 epimerase 6  ali model follow..  16  1.........................................ADPGVEGTPVVGSDLDDELHGTLGSEQILGQLYGYAGN------------------LLDGGAGRDKLSGGEGADTFRFALREDSH.............. 73
8 -6.5203v39_A mol:protein length:418 D-alanyl-D-alanine carboxypeptidase  ali model follow..  12  252........................NGSGNNEGSVAKPVYNEATCEMMIKVLYSLDKSLSAKGYDLSDVMA--VAAKDKASTVGSYGGVMAGSTTAK--------TGSVNKAKTLMGSVSTKNGEIYFAVL.......... 347
9 -6.5201r0u_A mol:protein length:148 protein ywiB  ali model follow..  11  29................................VIEFRTTGFYYVKQNKVYLSYYEEHDLGKVKTIVKVSEGEVL-RSGAVKMNQ--RFVTGASTIAKYKMS--GELELKTSTKSIQSDLDEEKGRISIAYDMHVGDEQEH 134
10 -6.4701srp_A mol:protein length:471 SERRALYSIN  ali model follow..  18  312........................................DVGGLKGNVSIAAGVTIENAIGGSGNDVIVGVLKGGAGN------------------VLFGGGGADELWGGAGKDIFVFSAAS................. 382

FFAS is supported by the NIH grant R01-GM087218-01
6 4 4 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.