current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

372361
Query: PG9878A NP_717203.1 372361 PDB-2007-01-25, from JCSG0614

Results of FFAS03 search in PDB0614
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MEMTKVTGKFDVKLTPENAYATGVGGVNLGRMALDKTFYGELEARSQGEMLSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFGIMTDGQNRLHLEVVPHSGAGELTGLYGTMAISIENGQHFYEFSFCFEPASEVEGLast
1 -74.1002ooj_A mol:protein length:141 Hypothetical protein  ali model follow..  100  2MEMTKVTGKFDVKLTPENAYATGVGGVNLGRMALDKTFYGELEARSQGEMLSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFGIMTDGQNRLHLEVVPHSGAGELTGLYGTMAISIENGQHFYEFSFCFEPASEVEG 141
2 -61.7002q03_A mol:protein length:138 Uncharacterized protein  ali model follow..  25  7.KLQTIIGMFQITAWDETSYFESDNGAKLTQAVITQSYQGVLQGHSEIRYLMSYQD-NANATFVGFEHFTGSLGDKKGSFILQHKGLFAAGVASSEFELVERSATGDFVHLVGKGHFVSENGQANYQITLQDS....... 138
3 -8.0604q63_A mol:protein length:105 Uncharacterized protein Lpg0364  ali model follow..  17  1......................................................................GHMDERRKYFRLKNHGEINASLDNNSIEIVEISSNGAVTDIPKEGVLKLQIHNFIMELCYEVIRAED... 72
4 -7.3601p8k_Z mol:protein length:254 Intron-encoded endonuclease I-AniI  ali model follow..  13  9....................................................................LVGLFEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKILGIGIVSFRKRNEIEMVALRIRDKNHL.. 77
5 -7.2703uvf_A mol:protein length:255 Intron-encoded DNA endonuclease I-HjeMI  ali model follow..  14  10....................................................................LVGLFEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKDILGVGKVSFRKRNEIEMVSLRIRDKNHL.. 78
6 -7.2603eh8_A mol:protein length:254 Intron-encoded DNA endonuclease I-AniI  ali model follow..  13  9....................................................................LVGLYEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKKILGIGIVSFRKRNEIEMVALRIRDKNHL.. 77
7 -7.0304dxz_A mol:protein length:111 Inhibitor of g-type lysozyme  ali model follow..  12  1....................AGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYMFGPGIDDSVDLSRYSPELDSHGQYSL-PASGKYELR-VMQTRNDARKNKTKKYNVDIQIK....... 111
8 -6.9501k7g_A mol:protein length:479 secreted protease C  ali model follow..  17  324........................................DVGGLKGNVSIAHGVTIENAIGGSGNDILVGILQGGAGN------------------VLYGGAGADTLYGGAGRDTFVYGSGQDST.............. 397
9 -6.7704dy3_A mol:protein length:111 Inhibitor of g-type lysozyme  ali model follow..  13  1....................AGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYLFGPGIDDSVDLSRYSPELDSHGQYSL-PASGKYELR-VLQTRNDARKNKTKKYNVDIQIK....... 111
10 -6.6004h69_A mol:protein length:194 Allene oxide cyclase  ali model follow..  11  62.................................VYDGSLQRRLGITAGICTLISHNAEKKGDRYEAQYSFYFGDY--GHISVQGPYITYE---DTELVVT--GGTGIFAGCHGVAKLHQIIFPVKLFYTFYLQGIKKLP. 160

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.