current user: public




372361
Query: PG9878A NP_717203.1 372361 PDB-2007-01-25, from JCSG0113

Results of FFAS03 search in PDB0113
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MEMTKVTGKFDVKLTPENAYATGVGGVNLGRMALDKTFYGELEARSQGEMLSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFGIMTDGQNRLHLEVVPHSGAGELTGLYGTMAISIENGQHFYEFSFCFEPASEVEGLast
1 -75.0002ooj_A mol:protein length:141 Hypothetical protein  ali model follow..  100  2MEMTKVTGKFDVKLTPENAYATGVGGVNLGRMALDKTFYGELEARSQGEMLSAMTAVKGSAGYVAIEQVVGKLCGRQGSFVLQHFGIMTDGQNRLHLEVVPHSGAGELTGLYGTMAISIENGQHFYEFSFCFEPASEVEG 141
2 -61.5002q03_A mol:protein length:138 Uncharacterized protein  ali model follow..  25  7.KLQTIIGMFQITAWDETSYFESDNGAKLTQAVITQSYQGVLQGHSEIRYLMSYQD-NANATFVGFEHFTGSLGDKKGSFILQHKGLFAAGVASSEFELVERSATGDFVHLVGKGHFVSENGQANYQITLQDS....... 138
3 -7.1604dxz_A mol:protein length:111 Inhibitor of g-type lysozyme  ali model follow..  12  1....................AGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYMFGPGIDDSVDLSRYSPELDSHGQYSL-PASGKYELR-VMQTRNDARKNKTKKYNVDIQIK....... 111
4 -7.0304dy3_A mol:protein length:111 Inhibitor of g-type lysozyme  ali model follow..  13  1....................AGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQKVHVSISNEGADTYLFGPGIDDSVDLSRYSPELDSHGQYSL-PASGKYELR-VLQTRNDARKNKTKKYNVDIQIK....... 111
5 -7.0001zvc_A mol:protein length:189 allene oxide cyclase  ali model follow..  16  66.......................................GITAG------LCVVIEHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDS---FLAIT--GGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLAN... 152
6 -6.9101k7g_A mol:protein length:479 secreted protease C  ali model follow..  17  325.........................................VGGLKGNVSIAHGVTIENAIGGSGNDILVGILQGGAGN------------------VLYGGAGADTLYGGAGRDTFVYGSGQDST.............. 397
7 -6.6404dy5_A mol:protein length:111 Gifsy-1 prophage protein  ali model follow..  12  1....................TGKNVNVEFDKGQNSARYSGVIKGYDYDTYNFQARKGQKVHVSISNEGADTYLFGPGIS-DSVDLSRYSSELDGNGQYTLPASGKYELK-VLQTRNEARKNKAKKYSVNIQIK....... 111
8 -6.4701kap_P mol:protein length:479 ALKALINE PROTEASE  ali model follow..  16  321........................................DVGGLKGNVSIAAGVTVENAIGGSGSDLLIGVLKGGAGN------------------ILYGGLGADQLWGGAGADTFVYGDIA................. 391
9 -6.4201srp_A mol:protein length:471 SERRALYSIN  ali model follow..  18  312........................................DVGGLKGNVSIAAGVTIENAIGGSGNDVIVGVLKGGAGN------------------VLFGGGGADELWGGAGKDIFVFSAAS................. 382
10 -6.3303uvf_A mol:protein length:255 Intron-encoded DNA endonuclease I-HjeMI  ali model follow..  14  10....................................................................LVGLFEG-DGYFSITKKGKYLTYELGIELSIKDVQLIYKIKDILGVGKVSFRKRNEIEMVSLRIRDKNHL.. 78

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.