current user: public




Query: PE00025C YP_807469.1 368040 PDB-2006-09-01, from JCSG0113

Results of FFAS03 search in PDB0113
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQRLast
1 -67.0002i8d_A mol:protein length:123 Uncharacterized conserved protein of COG5646  ali model follow..  100  2MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR 123
2 -63.1002oc6_A mol:protein length:124 YdhG protein  ali model follow..  45  2MDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIVKAGYDTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK 124
3 -56.2002kl4_A mol:protein length:118 BH2032 protein  ali model follow..  37  4MEVFAEYLKGIDHPDHRDRTEEILSWVAATFPNLEPQMKWNTPMFSNQGTFIIGFSTSKHHLSVSPEEIGISQFADAIAQAGYSTKGLFRIPWNDPVHYELLKQMIEFNIQDKE........ 118
4 -7.4002fki_A mol:protein length:126 Protein yjbR  ali model follow..  3...................ISELLQYCMA-KPGAEQSVHNDWKAIKVEDVLFAMVKEVENRPAVSLAELLRQQHSDVRPSRHLNKAHWSTVYLDGSLPDSQIYYLVDASYQQAVNLLPEEKR 112
5 -6.4902od0_A mol:protein length:105 Hypothetical protein VP1028  ali model follow..  3................KPILKDSMKLF-EALGTIKSRSMFGGFGLFADETMFALVVNNQLHIRADQQTSSDFETQGLKPRGFPVVTKYYAISSELWESSDRLIEVAKKSLENAK........ 104
6 -6.2503f6o_A mol:protein length:118 Probable transcriptional regulator, ArsR fami  ali model follow..  6.EQLNGIFQALADPTRRAVLGRLSR--PATVSELAKPFDMALP-------------SFMKHIHFLEDSGWIRTHKQGRVRTCAIEKEPFTQQELWESRTDRLEQFVTEHTVTAHAKATP... 117
7 -6.2403d1t_A mol:protein length:257 UPF0343 protein NGO0387  ali model follow..  12  60MSRFVALMEQHTEVLDFAQLHRLTAEMVALLDSRAGKISVSFPFFRKKTAPVSGIRSLLDYMKVMIPVTSLCPCSKEISQYGAHNQRSVSLTSDAEVGIEEVIDYVETQAS........... 189
8 -6.1603ez1_A mol:protein length:423 Aminotransferase MocR family  ali model follow..  12  304...LEGLMRDHAA--IAPKFRAVDEVLRAELGEGGEYATWTLP----KGGYFISLDTADRVVKLAEAAGVSLTPAGATYPAGQDHNRNLRLAPTRPPVEEVVAACIRLATEEYR........ 420
9 -6.0603f6v_A mol:protein length:151 Possible transcriptional regulator, ArsR fami  ali model follow..  13  39VLVVLDQLEVAAEPTRRRLVQLLTS--EQTVNNLAAHFPASRS-------------AISQHLRVLTEAGLVTPRKDGRFRYYRLDPQGLAFDSFWIDELDRLVADATEEAASKGDS...... 145
10 -5.9802k5w_A mol:protein length:117 Hypothetical Cytosolic Protein BcR103A  ali model follow..  12  12....DVYYMQIKGEGTIEKVDG------------RNLRNYTLPAYDEDGV--ITFRSTKKENDHKLNKYAFLRLYVDQDDNSKNEISSIEVKSYEEIQKADLPEKVKDKFTIKLE....... 111

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.