current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

368040
Query: PE00025C YP_807469.1 368040 PDB-2006-09-01, from JCSG0614

Results of FFAS03 search in PDB0614
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQRLast
1 -73.4002i8d_A mol:protein length:123 Uncharacterized conserved protein of COG5646  ali model follow..  100  2MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKKHLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFWQR 123
2 -69.6002oc6_A mol:protein length:124 YdhG protein  ali model follow..  41  2MDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIKAGYDYTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK 124
3 -61.0002kl4_A mol:protein length:118 BH2032 protein  ali model follow..  35  4MEVFAEYLKGIDHPDHRDRTEEILSWVAATFPNLEPQMKWNTPMFSNQGTFIIGFSTSKHHLSVSPEEIGISQFADAIQAGYSATKGLFRIPWNDPVHYELLKQMIEFNIQDKE........ 118
4 -5.9402l9j_A mol:protein length:121 Matrix protein 2-1  ali model follow..  18  21VGVLESYIGSINNITKQSACVAMSKLLTELIKKLRDNEEPNSPKIRVYNTVISYIESNRK-----------------------NNKQTIHL---KRLPADVLKKTIKNTLDIHKS....... 114
5 -5.9403gfa_A mol:protein length:198 Putative nitroreductase  ali model follow..  13  8...................................................................................SKRRSIRKYKNQSISHETIEKIIEAINAPSSKNRQPWR. 46
6 -5.9002jkr_I mol:protein length:142 AP-2 COMPLEX SUBUNIT SIGMA-1  ali model follow..  16...LAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQ 134
7 -5.6604iav_A mol:protein length:326 Carboxypeptidase T  ali model follow..  1.....DFPSYDSGYHNYNEMVNKINTVASNYPNIVKKFSIGK---SYEGRELWAVKISDNHAREHLTVEMALYTLDLFTQNYNLDSRITNLVNNREIYIVFNINPDGGEYDISSGSYKSWRK 130
8 -5.5903g7s_A mol:protein length:549 Long-chain-fatty-acid--CoA ligase (FadD-1)  ali model follow..  423.......VGFIDEEGFLHFQDRVKEVIKTIAPFELEALLMKHEAVMEAGEVPKAFIVLKPEYRGKVDEEDIIEWVRERISGYKRVR---EVEFVEELPRTASGKLLRRLLREKEAEG..... 543
9 -5.5903u2m_A mol:protein length:115 FAD-linked sulfhydryl oxidase ALR  ali model follow..  17  20LHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPDLRKRLARNHPDTRTRAAFTQWLCHLHNEVN........................................................... 88
10 -5.5501obr_A mol:protein length:326 CARBOXYPEPTIDASE T  ali model follow..  1.....DFPSYDSGYHNYNEMVNKINTVASNYPNIVKKFSIGK---SYEGRELWAVKISDNHAREHLTVEMALYTLDLFTQNYNLDSRITNLVNNREIYIVFNINPDGGEYDISSGSYKSWRK 130

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.