current user: public

Query: PE00025C YP_807469.1 368040 PDB-2006-09-01, from JCSG1214

Results of FFAS03 search in PDB1214
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
4 -6.0004jpb_W mol:protein length:151 Chemotaxis protein CheW  ali model follow..  34IEMVIEKSDITPVPKSRHFVEGVINLRGRIIPVVNLAKILGISFDEQKMKSIIVARTKDVEVGFLV---------DRVLGVLRITENQLDLTNVSDKFGKKSKGLVK............... 131
6 -5.7803u2m_A mol:protein length:115 FAD-linked sulfhydryl oxidase ALR  ali model follow..  17  20LHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPDLRKRLARNHPDTRTRAAFTQWLCHLHNEVN........................................................... 88
7 -5.7704e0h_A mol:protein length:106 Mitochondrial FAD-linked sulfhydryl oxidase E  ali model follow..  12  15LHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPDFEKYIRENAPQVESREELGRWMCEAHNKVN........................................................... 83
8 -5.7303u5s_A mol:protein length:126 FAD-linked sulfhydryl oxidase ALR  ali model follow..  17  31LHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPDLRKRLARNHPDTRTRAAFTQWLXHLHNEVN........................................................... 99
9 -5.7202fio_A mol:protein length:123 Late genes activator  ali model follow..  11  1...............................PKTQRGIYHNLEYVASNTDVTFFFSSELY----------LNKFLDGYQEYRKKFNKKIERVAVTPWNMDMLADITFYSEVEKR........ 76

FFAS is supported by the NIH grant R01-GM087218-01
7 9 6 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25.