current user: public




Query: TM0018 TM0018 281899 Purified-2001-08-24, from JCSG1214

Results of FFAS03 search in PDB1214
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEVSTSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKYAFIAFGGDGGTYDIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLKKNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPCVRFWRVNDDKTVEISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLLSRPDAKEIVDELQEYVDRRWERLLTLEEVTKDKPIRLast
1 -58.8001b0p_A mol:protein length:1231 PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)  ali model follow..  27  790....LPRDSLKGSQFQEPLMEFSGACSGCGE---TPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTAWGNSLFEDAAEYGFGMNMSMFARRTHAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTG-----KKDLARMVMTYGYVYVATVSMGYSKQFLKVLKEAESFPGPSLVIAYATCINGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSVEEFLMAQNRFAVLDRPEDAKRLRAQVAHELDVRFKELEHMAATNIFES.. 1173
2 -8.3904k9q_A mol:protein length:539 Benzoylformate Decarboxylase  ali model follow..  16  355....................................VLEVLKENSPKEIVLVEECPSIVPLMQDVFRINQPDTFYTF---ASGGLGWDLPAAVGL--ALGEEVSGRNRPVVTLMGDG-SFQYSVQGIYTGVQQKTHVIYVVFQNEEY---GILKQFAE--------LEQTPNVPGLDLPGLDIVAQGKAYG---AKSLKVETLDELKTAYLEALSFKGTSVIVV.................................................................................................... 522
3 -8.3004Q9D Entity 1(prereleased)  ali follow..  17  360....................................VYEVLSNVKPDDAAVVMESTSTMLDLFTWLPTTHPASFFAT---GSGGIGWGVPAAVGI--ALGDRARGVDRTVVATIGDGSFQ-YSIQAIWTAAQHKLPIVFVVLRNGEY---AILKSFAD--------LEKTPNVPGLQLPGLDISSIAAGFG---CRTATVESTDMLEAELKTALQADGPTVLVV.................................................................................................... 527
4 -8.0502o1x_A mol:protein length:629 1-deoxy-D-xylulose-5-phosphate synthase  ali model follow..  14  33LTEELRGEIVRVCSR-----GGLHLASSLGAVDIITALHYVLDSPRDRILVGHQAYAHKILTGGFTKVSESEHDAITVGHASTSLTNALGMALARDAQ------GKDFHVAAVIGDGSTGGMALAALNTIGDMGRKMLIVLNDNEMSINVGAMNKFMRGLQVQKWFQEGEGAGKKRHFFDPASVNPFAAMGVRYVGPVDGHNVQELVWLLERLVDLDGPTILHIVTTKGKGLSYAEADPIYWHGPA--------FDPATGEYVPSSAYSWSAAFGEAVKTDPRTFVVTPAMREGSGLVEFSRVHPHRY................ 366
5 -7.8304gg1_A mol:protein length:536 Benzoylformate decarboxylase  ali model follow..  13  359.....................................FDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFC---AAGGTGFALPAAI------GVQLAEPERQVIAVIGDGSAN-YSISALWTAAQYNIPTIFVIMNNGTY---GALRWFAGVLE--------AENVPGLDVPGIDFRALAKGYG---VQALKADNLEQLKGSLQEALSAKGPVLIEVST.................................................................................................. 523
6 -7.8004MPJ Entity 1(prereleased)  ali follow..  12  359.....................................FDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFC---AAGGLGFALPAAI------GVQLAEPERQVIAVIGDG-SANYSISALWTAAQYNIPTIFVIMNNGTY---GALRWFAGVLE--------AENVPGLDVPGIDFRALAKGYG---VQALKADNLEQLKGSLQEALSAKGPVLIEVST.................................................................................................. 523
7 -7.3303exe_A mol:protein length:382 Pyruvate dehydrogenase E1 component subunit a  ali model follow..  14  124.................................................LTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNG--------KDEVCLTLYGDGAANQ--FEAYNMAALWKLPCIFICENNRYGMGTSVERAAAS-----TDYYKRGDFIPGLRVDGMDILCVREA----------------TRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQE-------------------SKSDPIMLL-----KDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLE 348
8 -7.1203ey9_A mol:protein length:572 Pyruvate dehydrogenase [cytochrome]  ali model follow..  15  362....................................LAQQISHFAADDAIFTCDVGTPTVWAARYGKRRLLGSFNHGSMANAMPQALGAQATE------------PERQVVAMCGDGG-FSMLMGDFLSVVQMKLPVKIVVFNNSVLGFVAMEMKAG------------GYLTDGTELHDTNFARIAEACG---ITGIRVEKASEVDEALQRAFSIDGPVLVDVVV.................................................................................................. 527
9 -7.1102bp7_A mol:protein length:410 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT  ali model follow..  16  180..........................................................................ISGNLATQFVQAVGWAMASAIKG--------DTKIASAWIGDGATAESDFTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGESTTFAGRGVGCG--IASLRVDGNDFVAVYAA----------------SRWAAERARRGLGPSLIEWVT-----YRAGPHSTSDDPRPADDWSHFPL-----------GDPIAR--LKQHLIKIG----HWSEEEHQATTAEFEAAVIAAQKEAEQYGTL....... 378
10 -7.0403duf_A mol:protein length:369 Pyruvate dehydrogenase E1 component subunit a  ali model follow..  17  152.....................................................................................AAGVALGLKMRG--------KKAVAITYTGDGGTSQGDFEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQ---KAVAAGIPGIQVDGMDPLAVYAA----------------VKAARERAINGEGPTLIETLC-----FRYGPHTMSGDDPTRYRS---------KELENEWAKKDPLVRFRKFLEAKG----LWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTD... 343

FFAS is supported by the NIH grant R01-GM087218-01
6 4 5 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.