current user: public




281899
Query: TM0018 TM0018 281899 Purified-2001-08-24, from JCSG0113

Results of FFAS03 search in PDB0113
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEVSTSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKYAFIAFGGDGGTYDIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLKKNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPCVRFWRVNDDKTVEISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLLSRPDAKEIVDELQEYVDRRWERLLTLEEVTKDKPIRLast
1 -56.8001b0p_A mol:protein length:1231 PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)  ali model follow..  26  789...VLPRDSLKGSQFQEPLMEFSGACSGCGE---TPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNWGNSLFEDAAEYGFGMNMSMFARRTHAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTG-----KKDLARMVMTYGYVYVATVSMYSKQQFLKVLKEAESFPGPSLVIAYATCINQGRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSVEEFLMAQNRFAVLDRPEDAKRLRAQVAHELDVRFKELEHMAATNIFES.. 1173
2 -9.7503fzn_A mol:protein length:534 Benzoylformate decarboxylase  ali model follow..  12  358....................................VFDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFCA---AGGLGFALPAAI------GVQLAEPERQVIAVIGDG-SANYSISALWTAAQYNIPTIFVIMNNGTYGAL-----------RWFAGVLEAENVPGLDVPGIDFRALAKGYG---VQALKADNLEQLKGSLQEALSAKGPVLIEV.................................................................................................... 521
3 -9.6904GPE Entity 1(prereleased)  ali follow..  12  358....................................VFDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFCA---AGGMGFALPAAI------GVQLAEPERQVIAVIGDG-SANYSISALWTAAQYNIPTIFVIMNNGTYGAL-----------RWFAGVLEAENVPGLDVPGIDFRALAKGYG---VQALKADNLEQLKGSLQEALSAKGPVLIEV.................................................................................................... 521
4 -9.2001pyd_A mol:protein length:556 PYRUVATE DECARBOXYLASE  ali model follow..  15  370....................................MWNQLGNFLQEGDVVIAETGTSAFGINQTTFTYGISQVLWGSIGFTTGATLGAAFAAEEID--------PKKRVILFIGDG-SLQLTVQEISTMIRWGLKPYLFVLNNDGYT---------------IEKLIHGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSDNSKIRMIEIMLP................................................................................................. 541
5 -9.2001qpb_A mol:protein length:563 PYRUVATE DECARBOXYLASE (FORM B)  ali model follow..  15  370....................................MWNQLGNFLQEGDVVIAETGTSAFGINQTTFTYGISQVLWGSIGFTTGATLGAAFAAEEID--------PKKRVILFIGDG-SLQLTVQEISTMIRWGLKPYLFVLNNDGYT---------------IEKLIHGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSDNSKIRMIEVMLP................................................................................................. 541
6 -8.9402vjy_A mol:protein length:563 PYRUVATE DECARBOXYLASE  ali model follow..  15  370....................................VWTQVGEFLREGDVVITETGTSAFGINQTHFTYGISQVLWGSIGFTTGATLGAAFAAEEID--------PKKRVILFIGDG-SLQLTVQEISTMIRWGLKPYLFVLNNDGYT---------------IERLIHGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKDNTRIRLIEVMLP................................................................................................. 541
7 -8.8303ey9_A mol:protein length:572 Pyruvate dehydrogenase [cytochrome]  ali model follow..  15  362....................................LAQQISHFAADDAIFTCDVGTPTVWAARYGKRRLLGSFNHGSMANAMPQALGAQATE------------PERQVVAMCGDGG-FSMLMGDFLSVVQMKLPVKIVVFNNSVLGFVAMEMKAG------------GYLTDGTELHDTNFARIAEACG---ITGIRVEKASEVDEALQRAFSIDGPVLVDVVV.................................................................................................. 527
8 -8.7101ovm_A mol:protein length:552 Indole-3-pyruvate decarboxylase  ali model follow..  18  365....................................FWRTLQTFIRPGDIILADQGTSAFGAIDLRLVNFIVQPLWGSIGYTLAAAFGAQTA------------CPNRRVIVLTGDG-AAQLTIQELGSMLRDKQHPIILVLNNEGYT---------------VERAIHGAEQRYNDIALWNWTHIPQALSLDPQSECRVSEAEQLADVLEKVAHHERLSLIEVMLP................................................................................................. 531
9 -8.6403exe_A mol:protein length:382 Pyruvate dehydrogenase E1 component subunit a  ali model follow..  15  124.................................................LTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNG--------KDEVCLTLYGDGAANQ-GFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAS-----TDYYKRGDFIPGLRVDGMDILCVREA----------------TRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQ------------EVRSKSDP--IMLLKDRMVNSN----LASVEELKEIDVEVRKEIEDAAQFATADPEPPLEE... 349
10 -8.4902bp7_A mol:protein length:410 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT  ali model follow..  14  180..........................................................................ISGNLATQFVQAVGWAMASAIKG--------DTKIASAWIGDGATAE--HTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGESTTFAGRGVGCG--IASLRVDGNDFVAVYAA----------------SRWAAERARRGLGPSLIEWVTYRAGPHSTSDDPSKYRPADDWSH--------------PLGDPIAR--LKQHLIKIG----HWSEEEHQATTAEFEAAVIAAQKEAEQYGTLANGHI.. 383

FFAS is supported by the NIH grant R01-GM087218-01
6 0 8 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Rychlewski L, Jaroszewski L, Li W, Godzik A. Comparison of sequence profiles. Strategies for structural predictions using sequence information. Protein Sci. 2000 Feb;9(2):232-41.