current user: public




Query: TM0018 TM0018 281899 Purified-2001-08-24, from JCSG0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEVSTSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKYAFIAFGGDGGTYDIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLKKNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPCVRFWRVNDDKTVEISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLLSRPDAKEIVDELQEYVDRRWERLLTLEEVTKDKPIRLast
1 -105.0005c4i_C mol:protein length:314 Oxalate oxidoreductase subunit beta  ali model follow..  39  4.....RIASIKKAPDEEYYVPGHRTCAGCGPALTYR---LVAKAAGPNTIFIGPTGCMYVANTSYGCGPWRVPWIHAQITNGGAVASGIEAAYKAMIRKKKTD-AEFPNIIVMAGDGGAVDIGLQALSAMLYRGHDVLFICYDNESYANTGIQTSPTTPYGANTTFTPPGEVVPGKKLFPKDNPKVIAHGELKYVATASIGWPVDLMNKVRKGLNQEGPAYIHIHAPCPKGWQFPADKTIEMAKLAVQTGMFQLYEYENGEYKLSVKVDKRKPVSEYMKLQKRFAHLK-----PEHIAKMQAFVDARCAEVGITVPVVASN... 313
2 -58.0001b0p_A mol:protein length:1231 PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)  ali model follow..  26  790....LPRDSLKGSQFQEPLMEFSGACSGCGE---TPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTAWGNSLFEDAAEYGFGMNMSMFARRTHAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTG-----KKDLARMVMTYGYVYVATVSMGSKQQFLKVLKEAESFPGPSLVIAYATCINGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSVEEFLMAQNRFAVLDRPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFA 1175
3 -8.1504k9q_A mol:protein length:539 Benzoylformate Decarboxylase  ali model follow..  16  356.....................................LEVLKENSPKEIVLVEECPSIVPLMQDVFRINQPDTFYTFA---SGGLGWDLPAAVGL--ALGEEVSGRNRPVVTLMGDGSFQ-YSVQGIYTGVQQKTHVIYVVFQNEEY---GILKQFAELEQT--------PNVPGLDLPGLDIVAQGKAYG---AKSLKVETLDELKTAYLEALSFKGTSVIVV.................................................................................................... 522
4 -7.8604q9d_A mol:protein length:545 Benzoylformate decarboxylase  ali model follow..  17  361.....................................YEVLSNVKPDDAAVVMESTSTMLDLFTWLPTTHPASFFATG---SGGIGWGVPAAVGI--ALGDRARGVDRTVVATIGDGSFQ-YSIQAIWTAAQHKLPIVFVVLRNGEY---AILKSFADLEKT--------PNVPGLQLPGLDISSIAAGFG---CRTATVESTDMLEAELKTALQADGPTVLVV.................................................................................................... 527
5 -7.8002o1x_A mol:protein length:629 1-deoxy-D-xylulose-5-phosphate synthase  ali model follow..  15  33LTEELRGEIVRVCSR-----GGLHLASSLGAVDIITALHYVLDSPRDRILVGHQAYAHKILTGGFTKVSESEHDAITVGHASTSLTNALGMALARDAQ------GKDFHVAAVIGDGSTGGMALAALNTIGDMGRKMLIVLNDNEMSINVGAMNKFMRGLAGKKAVEAVSKPLADFMSRAKNSVNPFAAMGVRYVGPVDGHNVQELVWLLERLVDLDGPTILHIVTTKGKGLSYAEADPIYWHGPA--------FDPATGEYVPSSAYSWSAAFGEAVKTDPRTFVVTPAMREGSGLVEFSRVHPHRY................ 366
6 -7.5804gg1_A mol:protein length:536 Benzoylformate decarboxylase  ali model follow..  13  359.....................................FDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFCA---AGGTGFALPAAI------GVQLAEPERQVIAVIGDGSAN-YSISALWTAAQYNIPTIFVIMNNGTY---GALRWFAGVLE--------AENVPGLDVPGIDFRALAKGYG---VQALKADNLEQLKGSLQEALSAKGPVLIEVST.................................................................................................. 523
7 -7.3603duf_A mol:protein length:369 Pyruvate dehydrogenase E1 component subunit a  ali model follow..  14  54......................................MVYTRILDQRSISLNRQGRLGFYAPTAGQEASQIAILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGGKKAVAITYTGDGGTSQGDFEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQ---KAVAAGIPGIQVDGMDPLAVYAA----------------VKAARERAINGEGPTLIETLC---YGPHTMSGDDPTRYRSKELENEW----------------AKKDPLRKFLEAKG----LWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTD... 343
8 -6.7803wl4_A mol:protein length:267 Uncharacterized protein  ali model follow..  10  1.............................................................................MFENVSTFEEAFNKLLKEVLEFNLENPFEDKKVICIEPHPDDCAIGMGGIKKLSDEGVEVIYICMTDG---YMGTTDEKLSGHELALI----------RRREEEESAKLLGVRKIYWLRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRR--TGFLAIESVALKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFR 251
9 -6.5902pgn_A mol:protein length:589 Cyclohexane-1,2-dione Hydrolase (Cdh)  ali model follow..  13  379...................................RAMAEVRKVQRPEDIIVTDIGNHTLPMFGGAILQRPRRLVTS--MAEGILGCGFPMAL------GAQLAEPNSRVFLGTGDGA-LYYHFNEFRVAVEHKLPVITMVFTNESY---GANWTLMNHQFGQNNWT---------EFMNPDWVGIAKAFG---AYGESVRETGDIAGALQRAIDSGKPALIEIPV.................................................................................................. 545
10 -6.5501ozf_A mol:protein length:566 Acetolactate synthase, catabolic  ali model follow..  13  375...................................RIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMIS--NGQQTMGVALPWAIGAWLVN------PERKVVSVSGDGG-FLQSSMELETAVRLKANVLHLIWVDNGY---NMVAIQEEKKYQRLSGVEFGPM---------DFKAYAESFG---AKGFAVESAEALEPTLRAAMDVDGPAVVAI.................................................................................................... 539

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.