current user: public




281899
Query: TM0018 TM0018 281899 Purified-2001-08-24, from JCSG0614

Results of FFAS03 search in PDB0614
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEVSTSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKYAFIAFGGDGGTYDIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLKKNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPCVRFWRVNDDKTVEISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLLSRPDAKEIVDELQEYVDRRWERLLTLEEVTKDKPIRLast
1 -52.9001b0p_A mol:protein length:1231 PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)  ali model follow..  26  790....LPRDSLKGSQFQEPLMEFSGACSGCGE---TPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTAWGNSLFEDAAEYGFGMNMSMFARRTHAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAG-----KRTGKKDLARMVMTYGYVYVATVSMGSKQQFLKVLKEAESFPGPSLVIAYATCINGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAEFLMAQNRFAVLDRPEDAKRLRAQVAHELDVRFKELEHMAATNIFES.. 1173
2 -8.3504k9q_A mol:protein length:539 Benzoylformate Decarboxylase  ali model follow..  16  356.....................................LEVLKENSPKEIVLVEECPSIVPLMQDVFRINQPDTFYTF---ASGGLGWDLPAAVGL--ALGEEVSGRNRPVVTLMGDG-SFQYSVQGIYTGVQQKTHVIYVVFQNEEY---GILKQFAE--------LEQTPNVPGLDLPGLDIVAQGKAYG---AKSLKVETLDELKTAYLEALSFKGTSVIVV---------------------PITKELKPLF..................................................................... 532
3 -8.2304Q9D Entity 1(prereleased)  ali follow..  17  361.....................................YEVLSNVKPDDAAVVMESTSTMLDLFTWLPTTHPASFFAT---GSGGIGWGVPAAVGI--ALGDRARGVDRTVVATIGDGSFQ-YSIQAIWTAAQHKLPIVFVVLRNGEY---AILKSFAD--------LEKTPNVPGLQLPGLDISSIAAGFG---CRTATVESTDMLEAELKTALQADGPTVLVV.................................................................................................... 527
4 -8.0302o1x_A mol:protein length:629 1-deoxy-D-xylulose-5-phosphate synthase  ali model follow..  14  33LTEELRGEIVRVCSR-----GGLHLASSLGAVDIITALHYVLDSPRDRILVGHQAYAHKILTGGFTKVSESEHDAITVGHASTSLTNALGMAL------ARDAQGKDFHVAAVIGDGSTGGMALAALNTIGDMGRKMLIVLNDNEMSINVGAMNKFMRGLQVQKWFQEGEGAGKKRHFFDPASVNPFAAMGVRYVGPVDGHNVQELVWLLERLVDLDGPTILHIVTTKGKGLSYAEADPIYWHGPA--------FDPATGEYVPSSAYSWSAAFGEAVKTDPRTFVVTPAMREGSGLVEFSRVHPHRY................ 366
5 -7.9504gg1_A mol:protein length:536 Benzoylformate decarboxylase  ali model follow..  13  359.....................................FDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFC---AAGGTGFALPAAI------GVQLAEPERQVIAVIGDGSAN-YSISALWTAAQYNIPTIFVIMNNGTY---GALRWFAGVLE--------AENVPGLDVPGIDFRALAKGYG---VQALKADNLEQLKGSLQEALSAKGPVLIEVST.................................................................................................. 523
6 -7.9304MPJ Entity 1(prereleased)  ali follow..  13  359.....................................FDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSYYFCA---AGGLGFALPAAI------GVQLAEPERQVIAVIGDG-SANYSISALWTAAQYNIPTIFVIMNNGTY---GALRWFAGVLE--------AENVPGLDVPGIDFRALAKGYG---VQALKADNLEQLKGSLQEALSAKGPVLIEVST.................................................................................................. 523
7 -7.3103duf_A mol:protein length:369 Pyruvate dehydrogenase E1 component subunit a  ali model follow..  16  142...................................................................................QIIIGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQ---KAVAAGIPGIQVDGMDPLAVYAA----------------VKAARERAINGEGPTLIETLC---YGPHTMSGDDPTRYRSKELENEW----------------AKKDPLRKFLEAKG----LWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTD... 343
8 -7.2103exe_A mol:protein length:382 Pyruvate dehydrogenase E1 component subunit a  ali model follow..  12  83...............QEACCVGLEAGINPTDHLITAY--TFTRGLSVREILAELTG----KGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLY-GDGAANQ--FEAYNMAALWKLPCIFICENNRYGMGTSVERAAAS-----TDYYKRGDFIPGLRVDGMDILCVREA----------------TRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVSYRTREEIQE-------------------SKSDPIMLL-----KDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLE 348
9 -7.0203ey9_A mol:protein length:572 Pyruvate dehydrogenase [cytochrome]  ali model follow..  15  363.....................................AQQISHFAADDAIFTCDVGTPTVWAARYGKRRLLGSFNHGSMANAMPQALGAQATE------------PERQVVAMCGDGG-FSMLMGDFLSVVQMKLPVKIVVFNNSVLGFVAMEMKAG------------GYLTDGTELHDTNFARIAEACG---ITGIRVEKASEVDEALQRAFSIDGPVLVDVVV.................................................................................................. 527
10 -6.7102bp7_A mol:protein length:410 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT  ali model follow..  14  170................................................................YSVREAGFFTISGNLATQFVQAVGWAMASAIKG--------DTKIASAWIGDGATAESDFTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGESTTFAGRGVGCG--IASLRVDGNDFVAVYAA----------------SRWAAERARRGLGPSLIEWVT---RAGPHSTSDDPSKYRPADDWSHF----------------PLGDPIKQHLIKIG----HWSEEEHQATTAEFEAAVIAAQKEAEQYGTLAN..... 380

FFAS is supported by the NIH grant R01-GM087218-01
6 2 0 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Bourne PE, Allerston CK, Krebs W, Li W, Shindyalov IN, Godzik A.,Friedberg I, Liu T, Wild D, Hwang S, Ghahramani Z, Chen L, Westbrook J. The status of structural genomics defined through the analysis of current targets and structures. Pac Symp Biocomput. 2004;:375-86.