FFAS03: Fold & Function Assignment System

FFAS03: Fold & Function Assignment System
Current login: not logged in

[login/register] [new search] [precalculated results] [public results] [pairwise alignment] [references] [about FFAS] [Godzik lab publications]

Messages: All databases updated in June, 2010, PDB database is updated every Wednesday.
Databases of virulence factors (VFDB) and human proteins related to diseases (HUMSAVAR) are now available for FFAS searches.

1.Please, paste one amino-acid sequence in fasta format (if the fasta description line is included, make sure enter a new line after it)
2.Please, submit the next sequence only after completion of your previous search.
3.Sequences longer than 1000 aa should be split into (putative) domains.

. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
mkfskfgqkftqptgisqlmddlgdalksdqpvnmlgggnpakidavnelfletykalgndndtgkanss aiismanysnpqgdsafidalvgffnrhydwnltsenialtngsqnaffylfnlfggafvnehsqdkes ksvdksillpltpeyigysdvhvegqhfaavlphidevthdgeegffkyrvdfealenlpalkegriga iccsrptnptgnvltdeemahlaeiakrydipliidnaygmpfpniiysdahlnwdnntilcfslskig lpgmrtgiivadakvieavsamnavvnlaptrfgaaiatplvandrikqlsdneikpfyqkqatlavkl lkqalgdyplmihkpegaiflwlwfkdlpistldlyerlkakgtlivpseyffpgvdvsdyqhahecir msiaadeqtlidgikvigevvrelydnk

Select database(s) to be searched, and click Search (to select multiple databases hold down the CTRL key):

Databases of profiles:

Hot Paper and Paper of the Day:
		Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.
		Alonso A, Sasin J, Bottini N, Friedberg I, Friedberg I, Osterman A, Godzik A., Hunter T, Dixon J, Mustelin T. Protein tyrosine phosphatases in the human genome. Cell. 2004 Jun 11;117(6):699-711. Review.

FFAS is supported by the NIH grant R01-GM087218-01

jobs submitted since Sep. 25, 2005

Comments and questions to: webmaster